3S14F

Rna polymerase ii initiation complex with a 6-nt rna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
EKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 25
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.940.10 Alpha Beta Alpha-Beta Complex Eukaryotic RPB6 RNA polymerase subunit Eukaryotic RPB6 RNA polymerase subunit 3s14F00
2JA6F 2R92F 2WAQK 2WB1I 4G7ZE 3CQZF 2O5IE 3S1MF 5E17E 4XLPE 3HOXF 4KMUE 2R7ZF 4A3LF 4BXXF 3WODE 1I50F 1SFOF 3GTOF 3S2HF 5IYCF 5C4XF 2NVYF 3K7AF 5C4JF 3PO3F 4BY7F 3GTQF 3I4NF 1TWGF 4OIQE 1I3QF 2Y0SI 2VUMF 4A3DF 2JA7F 5TMFE 4BBSF 4GZYE 5FLMF 3GTJF 4X6AF 5D4CE 5M5XF 4OIRE 4Y52F 1Y1VF 3S17F 2O5JE 4AYBK 3GTPF 3RZDF 3GTMF 5TMCE 3HOZF 2BE5E 1SMYE 4LK1E 4A3MF 3HOYF 3FKIF 4BY1F 2A6EE 4XSZE 4C3IF 2E2HF 4YFNE 2JA5F 4C3HF 5IPLE 2NVTF 4A3KF 1ZYRE 2NVQF 3H3VG 3S1NF 1I6HF 5E18E 3S14F 3S16F 4Q5SE 4Q4ZE 4YG2E 3HKZK 2YU9F 4MEYE 5IYDF 1K83F 2JA8F 4KN7E 1R9TF 1TWHF 5BYHE 4OIOE 4A3BF 5C44F 2E2JF 2E2IF 4MEXE 4OIPE 5C3EF 2PMZK 4YFKE 4LLGE 3RZOF 4C3JF 4G7HE 2NVXF 3DXJE 3S1QF 4YFXE 2CW0E 4XSXE 5M5WF 2B63F 5FJ8F 4ZH4E 4LK0E 4BBRF 3S2DF 4JK1E 1TWAF 5M3MF 4A3FF 3GTGF 3M4OF 4A93F 1TWCF 3HOVF 4Y7NF 1I6VE 4XLNE 4KN4E 2A69E 3S1RF 3PO2F 5M3FF 4LJZE 1Y1WF 3M3YF 1YNJK 3GTKF 3HOWF 4A3IF 5M5YF 3H0GF 4A3JF 3S15F 1QKLA 4G7OE 5IP9F 5D4DE 2R93F 3HOUF 2A6HE 3I4MF 3EQLE 2PPBE 1TWFF 1YNNK 1HQME 1WCMF 4MQ9E 5D4EE 4A3EF 4OINE 2A68E 4A3CF 4A3GF 4C2MF 5IYBF 3GTLF 1IW7E 5IP7F
chains in the Genus database with same CATH superfamily
2JA6F 2R92F 2WAQK 2WB1I 4G7ZE 3CQZF 2O5IE 3HOWE 3S1MF 4XLPE 4A3ME 3HOXF 4A3GF 5E17E 4KMUE 2R7ZF 4A3LF 2KRXA 4BBSE 3GTLE 4BXXF 3WODE 5FLME 4X6AE 4Y52E 1I50F 1SFOF 3GTOF 3S2HF 3S2DE 5IYCF 5C4XF 2NVYF 3H0GE 3K7AF 5C4JF 3S15E 3PO3F 3FKIE 4BY7F 3GTQF 3H3VF 3I4NF 1TWGF 4OIQE 1I3QF 2Y0SI 2VUMF 4A3DF 3PO2E 4QIWK 5C4XE 2JA7F 1K83E 1R9TE 5TMFE 4BBSF 4A3LE 4GZYE 5FLMF 3GTJF 4X6AF 5D4CE 5M5XF 4OIRE 4Y52F 1Y1VF 3S17F 2O5JE 1TWAE 4AYBK 5M3ME 3S1ME 2JA6E 4A93E 3GTPF 2YU9E 3RZDF 3GTMF 3S16E 5TMCE 3HOZF 2BE5E 2R7ZE 3CQZE 1SMYE 4LK1E 4A3MF 2NVTE 3HOYF 2NVQE 3FKIF 4BY1F 5FJ8E 3S1NE 4BY7E 1TWGE 3I4NE 4A3CE 2A6EE 4A3GE 3RZOE 2VUME 2E2JE 4XSZE 4A3FE 4C3IF 2E2HF 3GTGE 5C3EE 4YFNE 2JA5F 2NVXE 4C3HF 1SFOE 3S2HE 5IPLE 2Y0SH 2NVTF 4A3KF 5IYCE 1ZYRE 2JA8E 4QIWH 2NVQF 3H3VG 3S1NF 1TWHE 3S17E 1I6HF 3I4ME 5E18E 3S14F 4BXXE 3GTPE 4Q5SE 3S16F 4Q4ZE 4YG2E 3HOZE 3GTKE 3HKZK 3M3YE 2YU9F 4MEYE 5IYDF 4A3IE 1K83F 2JA8F 5M5YE 4KN7E 1R9TF 1TWHF 4AYBH 5BYHE 4OIOE 3S14E 4A3BF 5C44F 5M5WE 5M3FE 2E2JF 2E2IF 4MEXE 4OIPE 5C3EF 2PMZK 4YFKE 1I3QE 4LLGE 3RZOF 4A3DE 1WCME 4C3JF 1TWFE 4C3HE 4G7HE 2JA5E 3DXJE 2NVXF 3M4OE 4A3EE 3S1QF 1TWCE 3HOVE 4YFXE 2CW0E 4XSXE 5M5WF 2B63F 5IP9E 3GTME 5FJ8F 4BY1E 4ZH4E 3HOUE 1I50E 4LK0E 2R93E 3GTOE 4BBRF 1DZFA 1Y1VE 3S2DF 4JK1E 1TWAF 5M3MF 4A3FF 3GTGF 3M4OF 4A93F 1TWCF 3HOVF 3HOXE 4Y7NF 1I6VE 4XLNE 3HKZH 2WAQH 4KN4E 1I6HE 2A69E 2WB1H 1EIKA 4A3BE 3S1RF 2E2IE 3PO2F 5M3FF 4LJZE 1Y1WF 2R92E 3M3YF 4C2ME 1YNJK 5IYBE 3GTKF 3HOWF 2JA7E 4Y7NE 5IP7E 4A3IF 4C3IE 2E2HE 5M5YF 5IYDE 2NVYE 3H0GF 4A3JF 2PMZH 3S15F 1QKLA 4A3KE 5IP9F 5D4DE 4G7OE 2B63E 2R93F 3HOUF 3GTQE 2A6HE 3I4MF 4BBRE 3EQLE 2PPBE 1TWFF 1YNNK 4A3JE 1HQME 1WCMF 4C3JE 3S1QE 3HOYE 4MQ9E 5D4EE 4A3EF 4OINE 3PO3E 5M5XE 2A68E 3K7AE 5C4JE 3GTJE 3S1RE 4C2MF 5IYBF 3GTLF 5C44E 4A3CF 1Y1WE 3RZDE 1IW7E 5IP7F
chains in the Genus database with same CATH topology
2JA6F 2R92F 2WAQK 2WB1I 4G7ZE 3CQZF 2O5IE 3S1MF 5E17E 4XLPE 3HOXF 4KMUE 2R7ZF 4A3LF 2KRXA 4BXXF 3WODE 1I50F 1SFOF 3GTOF 3S2HF 5IYCF 5C4XF 2NVYF 3K7AF 5C4JF 3PO3F 4BY7F 3GTQF 3I4NF 1TWGF 4OIQE 1I3QF 2Y0SI 2VUMF 4A3DF 4QIWK 2JA7F 5TMFE 4BBSF 4GZYE 5FLMF 3GTJF 4X6AF 5D4CE 5M5XF 4OIRE 4Y52F 1Y1VF 3S17F 2O5JE 4AYBK 3GTPF 3RZDF 3GTMF 5TMCE 3HOZF 2BE5E 1SMYE 4LK1E 4A3MF 3HOYF 3FKIF 4BY1F 2A6EE 4XSZE 4C3IF 2E2HF 4YFNE 2JA5F 4C3HF 5IPLE 2NVTF 4A3KF 1ZYRE 2NVQF 3H3VG 3S1NF 1I6HF 5E18E 3S14F 3S16F 4Q5SE 4Q4ZE 4YG2E 3HKZK 2YU9F 4MEYE 5IYDF 1K83F 2JA8F 4KN7E 1R9TF 1TWHF 5BYHE 4OIOE 4A3BF 5C44F 2E2JF 2E2IF 4MEXE 4OIPE 5C3EF 2PMZK 4YFKE 4LLGE 3RZOF 4C3JF 4G7HE 2NVXF 3DXJE 3S1QF 4YFXE 2CW0E 4XSXE 5M5WF 2B63F 5FJ8F 4ZH4E 4LK0E 4BBRF 3S2DF 4JK1E 1TWAF 5M3MF 4A3FF 3GTGF 3M4OF 4A93F 1TWCF 3HOVF 4Y7NF 1I6VE 4XLNE 4KN4E 2A69E 3S1RF 3PO2F 5M3FF 4LJZE 1Y1WF 3M3YF 1YNJK 3GTKF 3HOWF 4A3IF 5M5YF 3H0GF 4A3JF 3S15F 1QKLA 4G7OE 5IP9F 5D4DE 2R93F 3HOUF 2A6HE 3I4MF 3EQLE 2PPBE 1TWFF 1YNNK 1HQME 1WCMF 4MQ9E 5D4EE 4A3EF 4OINE 2A68E 4A3CF 4A3GF 4C2MF 5IYBF 3GTLF 1IW7E 5IP7F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA6 F;  2R92 F;  2WAQ K;  2WB1 I;  4G7Z E;  3CQZ F;  2O5I E;  3S1M F;  5E17 E;  4XLP E;  3HOX F;  4KMU E;  2R7Z F;  4A3L F;  4BXX F;  3WOD E;  1I50 F;  1SFO F;  3GTO F;  3S2H F;  5IYC F;  5C4X F;  2NVY F;  3K7A F;  5C4J F;  3PO3 F;  4BY7 F;  3GTQ F;  3I4N F;  1TWG F;  4OIQ E;  1I3Q F;  2Y0S I;  2VUM F;  4A3D F;  2JA7 F;  5TMF E;  4BBS F;  4GZY E;  5FLM F;  3GTJ F;  4X6A F;  5D4C E;  5M5X F;  4OIR E;  4Y52 F;  1Y1V F;  3S17 F;  2O5J E;  4AYB K;  3GTP F;  3RZD F;  3GTM F;  5TMC E;  3HOZ F;  2BE5 E;  1SMY E;  4LK1 E;  4A3M F;  3HOY F;  3FKI F;  4BY1 F;  2A6E E;  4XSZ E;  4C3I F;  2E2H F;  4YFN E;  2JA5 F;  4C3H F;  5IPL E;  2NVT F;  4A3K F;  1ZYR E;  2NVQ F;  3H3V G;  3S1N F;  1I6H F;  5E18 E;  3S14 F;  3S16 F;  4Q5S E;  4Q4Z E;  4YG2 E;  3HKZ K;  2YU9 F;  4MEY E;  5IYD F;  1K83 F;  2JA8 F;  4KN7 E;  1R9T F;  1TWH F;  5BYH E;  4OIO E;  4A3B F;  5C44 F;  2E2J F;  2E2I F;  4MEX E;  4OIP E;  5C3E F;  2PMZ K;  4YFK E;  4LLG E;  3RZO F;  4C3J F;  4G7H E;  2NVX F;  3DXJ E;  3S1Q F;  4YFX E;  2CW0 E;  4XSX E;  5M5W F;  2B63 F;  5FJ8 F;  4ZH4 E;  4LK0 E;  4BBR F;  3S2D F;  4JK1 E;  1TWA F;  5M3M F;  4A3F F;  3GTG F;  3M4O F;  4A93 F;  1TWC F;  3HOV F;  4Y7N F;  1I6V E;  4XLN E;  4KN4 E;  2A69 E;  3S1R F;  3PO2 F;  5M3F F;  4LJZ E;  1Y1W F;  3M3Y F;  1YNJ K;  3GTK F;  3HOW F;  4A3I F;  5M5Y F;  3H0G F;  4A3J F;  3S15 F;  1QKL A;  4G7O E;  5IP9 F;  5D4D E;  2R93 F;  3HOU F;  2A6H E;  3I4M F;  3EQL E;  2PPB E;  1TWF F;  1YNN K;  1HQM E;  1WCM F;  4MQ9 E;  5D4E E;  4A3E F;  4OIN E;  2A68 E;  4A3C F;  4A3G F;  4C2M F;  5IYB F;  3GTL F;  1IW7 E;  5IP7 F; 
#chains in the Genus database with same CATH topology
 2JA6 F;  2R92 F;  2WAQ K;  2WB1 I;  4G7Z E;  3CQZ F;  2O5I E;  3HOW E;  3S1M F;  4XLP E;  4A3M E;  3HOX F;  4A3G F;  5E17 E;  4KMU E;  2R7Z F;  4A3L F;  2KRX A;  4BBS E;  3GTL E;  4BXX F;  3WOD E;  5FLM E;  4X6A E;  4Y52 E;  1I50 F;  1SFO F;  3GTO F;  3S2H F;  3S2D E;  5IYC F;  5C4X F;  2NVY F;  3H0G E;  3K7A F;  5C4J F;  3S15 E;  3PO3 F;  3FKI E;  4BY7 F;  3GTQ F;  3H3V F;  3I4N F;  1TWG F;  4OIQ E;  1I3Q F;  2Y0S I;  2VUM F;  4A3D F;  3PO2 E;  4QIW K;  5C4X E;  2JA7 F;  1K83 E;  1R9T E;  5TMF E;  4BBS F;  4A3L E;  4GZY E;  5FLM F;  3GTJ F;  4X6A F;  5D4C E;  5M5X F;  4OIR E;  4Y52 F;  1Y1V F;  3S17 F;  2O5J E;  1TWA E;  4AYB K;  5M3M E;  3S1M E;  2JA6 E;  4A93 E;  3GTP F;  2YU9 E;  3RZD F;  3GTM F;  3S16 E;  5TMC E;  3HOZ F;  2BE5 E;  2R7Z E;  3CQZ E;  1SMY E;  4LK1 E;  4A3M F;  2NVT E;  3HOY F;  2NVQ E;  3FKI F;  4BY1 F;  5FJ8 E;  3S1N E;  4BY7 E;  1TWG E;  3I4N E;  4A3C E;  2A6E E;  4A3G E;  3RZO E;  2VUM E;  2E2J E;  4XSZ E;  4A3F E;  4C3I F;  2E2H F;  3GTG E;  5C3E E;  4YFN E;  2JA5 F;  2NVX E;  4C3H F;  1SFO E;  3S2H E;  5IPL E;  2Y0S H;  2NVT F;  4A3K F;  5IYC E;  1ZYR E;  2JA8 E;  4QIW H;  2NVQ F;  3H3V G;  3S1N F;  1TWH E;  3S17 E;  1I6H F;  3I4M E;  5E18 E;  3S14 F;  4BXX E;  3GTP E;  4Q5S E;  3S16 F;  4Q4Z E;  4YG2 E;  3HOZ E;  3GTK E;  3HKZ K;  3M3Y E;  2YU9 F;  4MEY E;  5IYD F;  4A3I E;  1K83 F;  2JA8 F;  5M5Y E;  4KN7 E;  1R9T F;  1TWH F;  4AYB H;  5BYH E;  4OIO E;  3S14 E;  4A3B F;  5C44 F;  5M5W E;  5M3F E;  2E2J F;  2E2I F;  4MEX E;  4OIP E;  5C3E F;  2PMZ K;  4YFK E;  1I3Q E;  4LLG E;  3RZO F;  4A3D E;  1WCM E;  4C3J F;  1TWF E;  4C3H E;  4G7H E;  2JA5 E;  3DXJ E;  2NVX F;  3M4O E;  4A3E E;  3S1Q F;  1TWC E;  3HOV E;  4YFX E;  2CW0 E;  4XSX E;  5M5W F;  2B63 F;  5IP9 E;  3GTM E;  5FJ8 F;  4BY1 E;  4ZH4 E;  3HOU E;  1I50 E;  4LK0 E;  2R93 E;  3GTO E;  4BBR F;  1DZF A;  1Y1V E;  3S2D F;  4JK1 E;  1TWA F;  5M3M F;  4A3F F;  3GTG F;  3M4O F;  4A93 F;  1TWC F;  3HOV F;  3HOX E;  4Y7N F;  1I6V E;  4XLN E;  3HKZ H;  2WAQ H;  4KN4 E;  1I6H E;  2A69 E;  2WB1 H;  1EIK A;  4A3B E;  3S1R F;  2E2I E;  3PO2 F;  5M3F F;  4LJZ E;  1Y1W F;  2R92 E;  3M3Y F;  4C2M E;  1YNJ K;  5IYB E;  3GTK F;  3HOW F;  2JA7 E;  4Y7N E;  5IP7 E;  4A3I F;  4C3I E;  2E2H E;  5M5Y F;  5IYD E;  2NVY E;  3H0G F;  4A3J F;  2PMZ H;  3S15 F;  1QKL A;  4A3K E;  5IP9 F;  5D4D E;  4G7O E;  2B63 E;  2R93 F;  3HOU F;  3GTQ E;  2A6H E;  3I4M F;  4BBR E;  3EQL E;  2PPB E;  1TWF F;  1YNN K;  4A3J E;  1HQM E;  1WCM F;  4C3J E;  3S1Q E;  3HOY E;  4MQ9 E;  5D4E E;  4A3E F;  4OIN E;  3PO3 E;  5M5X E;  2A68 E;  3K7A E;  5C4J E;  3GTJ E;  3S1R E;  4C2M F;  5IYB F;  3GTL F;  5C44 E;  4A3C F;  1Y1W E;  3RZD E;  1IW7 E;  5IP7 F; 
#chains in the Genus database with same CATH homology
 2JA6 F;  2R92 F;  2WAQ K;  2WB1 I;  4G7Z E;  3CQZ F;  2O5I E;  3S1M F;  5E17 E;  4XLP E;  3HOX F;  4KMU E;  2R7Z F;  4A3L F;  2KRX A;  4BXX F;  3WOD E;  1I50 F;  1SFO F;  3GTO F;  3S2H F;  5IYC F;  5C4X F;  2NVY F;  3K7A F;  5C4J F;  3PO3 F;  4BY7 F;  3GTQ F;  3I4N F;  1TWG F;  4OIQ E;  1I3Q F;  2Y0S I;  2VUM F;  4A3D F;  4QIW K;  2JA7 F;  5TMF E;  4BBS F;  4GZY E;  5FLM F;  3GTJ F;  4X6A F;  5D4C E;  5M5X F;  4OIR E;  4Y52 F;  1Y1V F;  3S17 F;  2O5J E;  4AYB K;  3GTP F;  3RZD F;  3GTM F;  5TMC E;  3HOZ F;  2BE5 E;  1SMY E;  4LK1 E;  4A3M F;  3HOY F;  3FKI F;  4BY1 F;  2A6E E;  4XSZ E;  4C3I F;  2E2H F;  4YFN E;  2JA5 F;  4C3H F;  5IPL E;  2NVT F;  4A3K F;  1ZYR E;  2NVQ F;  3H3V G;  3S1N F;  1I6H F;  5E18 E;  3S14 F;  3S16 F;  4Q5S E;  4Q4Z E;  4YG2 E;  3HKZ K;  2YU9 F;  4MEY E;  5IYD F;  1K83 F;  2JA8 F;  4KN7 E;  1R9T F;  1TWH F;  5BYH E;  4OIO E;  4A3B F;  5C44 F;  2E2J F;  2E2I F;  4MEX E;  4OIP E;  5C3E F;  2PMZ K;  4YFK E;  4LLG E;  3RZO F;  4C3J F;  4G7H E;  2NVX F;  3DXJ E;  3S1Q F;  4YFX E;  2CW0 E;  4XSX E;  5M5W F;  2B63 F;  5FJ8 F;  4ZH4 E;  4LK0 E;  4BBR F;  3S2D F;  4JK1 E;  1TWA F;  5M3M F;  4A3F F;  3GTG F;  3M4O F;  4A93 F;  1TWC F;  3HOV F;  4Y7N F;  1I6V E;  4XLN E;  4KN4 E;  2A69 E;  3S1R F;  3PO2 F;  5M3F F;  4LJZ E;  1Y1W F;  3M3Y F;  1YNJ K;  3GTK F;  3HOW F;  4A3I F;  5M5Y F;  3H0G F;  4A3J F;  3S15 F;  1QKL A;  4G7O E;  5IP9 F;  5D4D E;  2R93 F;  3HOU F;  2A6H E;  3I4M F;  3EQL E;  2PPB E;  1TWF F;  1YNN K;  1HQM E;  1WCM F;  4MQ9 E;  5D4E E;  4A3E F;  4OIN E;  2A68 E;  4A3C F;  4A3G F;  4C2M F;  5IYB F;  3GTL F;  1IW7 E;  5IP7 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...