The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
40
|
sequence length |
224
|
structure length |
210
|
Chain Sequence |
AMSYRVSTGAAHAAKGGGLVSGDSYSMMELGARKYAAAISDGRAHFESNETIKLLEKILESGIDEKIAIKTINSILSLRIYSTLDLSIIDLQDASCKFLKVGSTPSFIKRGDQVMKVQASIINEFDVEVVSEQLKAGDLLIMMSDGIFEGPKHVENHDLWMKRKMKGLKTNDPQEIADLLMEEVIRTRSGQIEDDMTVVVVRIDHNTPKW
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the phosphatase domain of the cell fate determinant SpoIIE from Bacillus subtilis.
pubmed doi rcsb |
| molecule keywords |
Stage II sporulation protein E
|
| molecule tags |
Hydrolase
|
| source organism |
Bacillus subtilis
|
| total genus |
40
|
| structure length |
210
|
| sequence length |
224
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
3.1.3.16: Protein-serine/threonine phosphatase. |
| pdb deposition date | 2011-08-02 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF07228 | SpoIIE | Stage II sporulation protein E (SpoIIE) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 4-Layer Sandwich | Phosphatase 2c; domain 1 | PPM-type phosphatase domain |
#chains in the Genus database with same CATH superfamily 3W43 A; 3W40 A; 3PU9 A; 3W45 A; 3T9Q A; 3ES2 A; 3W42 A; 3KDJ B; 3JRQ A; 5ITI A; 5JO1 B; 3FXM A; 3FXJ A; 2POP A; 3KB3 B; 4DS8 B; 3RNR A; 2J4O A; 3N3C A; 3ZVU B; 2J86 A; 2I44 A; 2Y09 A; 4LGB B; 4YZG A; 2PNQ A; 2CM1 A; 3FXO A; 4JND A; 3F79 A; 2I0O A; 4RAF A; 3ZT9 A; 2PK0 A; 3NMN B; 1TXO A; 2P8E A; 3FXK A; 4DA1 A; 3UJK A; 4LGA B; 5D2U A; 3D8K A; 4WVO B; 3QN1 B; 3T91 A; 2IQ1 A; 4LA7 B; 4RAG A; 2XZV A; 3FXL A; 3RT0 A; 3W44 A; 4OIC B; 4LG5 B; 4RA2 A; 4YZH A; 2JFR A; 4N0G A; 3W41 A; 3UJG B; 1A6Q A; 3NMV B; 3MQ3 A; 3NMT B; 3EQ2 A; 3UJL B; 5JO2 B; 2V06 A; 2IRM A; 5F1M A; 2JFS A; 2J82 A; 2JFT A; 2ISN A; 2POM A; 3KE6 A; #chains in the Genus database with same CATH topology 3W43 A; 3W40 A; 3PU9 A; 3W45 A; 3T9Q A; 3ES2 A; 3W42 A; 3KDJ B; 3JRQ A; 5ITI A; 5JO1 B; 3FXM A; 3FXJ A; 2POP A; 3KB3 B; 4DS8 B; 3RNR A; 2J4O A; 3N3C A; 4IIK A; 3ZVU B; 2J86 A; 2I44 A; 2Y09 A; 4LGB B; 4YZG A; 2PNQ A; 2CM1 A; 3FXO A; 4JND A; 3F79 A; 2I0O A; 4RAF A; 3ZT9 A; 2PK0 A; 3NMN B; 1TXO A; 2P8E A; 3FXK A; 4DA1 A; 3UJK A; 4LGA B; 5D2U A; 3D8K A; 4WVO B; 3QN1 B; 3T91 A; 2IQ1 A; 4LA7 B; 4RAG A; 2XZV A; 3FXL A; 3RT0 A; 3W44 A; 4OIC B; 4LG5 B; 4RA2 A; 4IIP A; 4YZH A; 2JFR A; 4N0G A; 3W41 A; 3UJG B; 1A6Q A; 3NMV B; 3MQ3 A; 3NMT B; 3EQ2 A; 3UJL B; 5JO2 B; 2V06 A; 2IRM A; 5F1M A; 2JFS A; 2J82 A; 2JFT A; 2ISN A; 2POM A; 3KE6 A; #chains in the Genus database with same CATH homology 3W43 A; 3W40 A; 3PU9 A; 3W45 A; 3T9Q A; 3ES2 A; 3W42 A; 3KDJ B; 3JRQ A; 5ITI A; 5JO1 B; 3FXM A; 3FXJ A; 2POP A; 3KB3 B; 4DS8 B; 3RNR A; 2J4O A; 3N3C A; 3ZVU B; 2J86 A; 2I44 A; 2Y09 A; 4LGB B; 4YZG A; 2PNQ A; 2CM1 A; 3FXO A; 4JND A; 3F79 A; 2I0O A; 4RAF A; 3ZT9 A; 2PK0 A; 3NMN B; 1TXO A; 2P8E A; 3FXK A; 4DA1 A; 3UJK A; 4LGA B; 5D2U A; 3D8K A; 4WVO B; 3QN1 B; 3T91 A; 2IQ1 A; 4LA7 B; 4RAG A; 2XZV A; 3FXL A; 3RT0 A; 3W44 A; 4OIC B; 4LG5 B; 4RA2 A; 4YZH A; 2JFR A; 4N0G A; 3W41 A; 3UJG B; 1A6Q A; 3NMV B; 3MQ3 A; 3NMT B; 3EQ2 A; 3UJL B; 5JO2 B; 2V06 A; 2IRM A; 5F1M A; 2JFS A; 2J82 A; 2JFT A; 2ISN A; 2POM A; 3KE6 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...