The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
32
|
sequence length |
136
|
structure length |
123
|
Chain Sequence |
RTYSSLLEEFATELGLEEIETNELGHGAVTIDKIWVVHLAPINEKELVAFMRAGILTGQSQLYDILRKNLFSPLSGVIRCALDKDDHWLLWSQLNINDTSGTQLASVLTSLVDKAVTLRPSSS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Context-dependent protein folding of a virulence peptide in the bacterial and host environments: structure of an SycH-YopH chaperone-effector complex.
pubmed doi rcsb |
| molecule tags |
Chaperone/chaperone effector
|
| source organism |
Yersinia pestis
|
| molecule keywords |
Putative yopH targeting protein
|
| total genus |
32
|
| structure length |
123
|
| sequence length |
136
|
| ec nomenclature | |
| pdb deposition date | 2012-08-02 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF05932 | CesT | Tir chaperone protein (CesT) family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Yope Regulator; Chain: A, | Yope Regulator; Chain: A, |
#chains in the Genus database with same CATH superfamily 2XGA A; 1K6Z A; 4G6T A; 4JMF B; 1JYO A; 1RY9 A; 1S28 A; 4GF3 A; 1XKP B; 1JYA A; 3TU3 A; 3EPU A; 2PLG A; 3KXY A; 1K3E A; 2BSH A; 2BHO A; 2BSJ A; 1XKP C; 4AKX A; 1TTW A; 1N5B A; 1K3S A; 1L2W A; 2BSI A; 2FM8 A; 3CXJ A; #chains in the Genus database with same CATH topology 2P9N D; 2XGA A; 1K6Z A; 2P9S D; 4GSL C; 4EBR A; 2P9U F; 3DXK D; 2P9L D; 4G6T A; 4XEI F; 3RSE D; 4JMF B; 1TYQ D; 1RY9 A; 1JYO A; 1S28 A; 3DXM D; 3UKU D; 2P9K F; 3ULE F; 3VX8 B; 2P9P F; 3CXJ A; 3UKR F; 3DXM F; 4GF3 A; 1XKP B; 2P9N F; 3DWL D; 2P9S F; 1JYA A; 3TU3 A; 3DXK F; 3EPU A; 2P9I D; 2PLG A; 2MQD A; 2P9L F; 4JD2 D; 2DYT A; 3RSE F; 3KXY A; 1K3E A; 1K8K D; 1U2V D; 2BSH A; 4H5B A; 1TYQ F; 3UKU F; 2BHO A; 2BSJ A; 2P9U D; 1XKP C; 4AKX A; 3DWL F; 1TTW A; 1N5B A; 4XEI D; 1K3S A; 3ULE D; 2P9K D; 4JD2 F; 1L2W A; 2P9P D; 2BSI A; 2FM8 A; 2P9I F; 2KC5 A; 2LPU A; 1K8K F; 1U2V F; 2OD0 A; 3UKR D; 3VX7 B; #chains in the Genus database with same CATH homology 2P9N D; 2XGA A; 1K6Z A; 2P9S D; 4GSL C; 4EBR A; 2P9U F; 3DXK D; 2P9L D; 4G6T A; 4XEI F; 3RSE D; 4JMF B; 1TYQ D; 1RY9 A; 1JYO A; 1S28 A; 3DXM D; 3UKU D; 2P9K F; 3ULE F; 3VX8 B; 2P9P F; 3CXJ A; 3UKR F; 3DXM F; 4GF3 A; 1XKP B; 2P9N F; 3DWL D; 2P9S F; 1JYA A; 3TU3 A; 3DXK F; 3EPU A; 2P9I D; 2PLG A; 2MQD A; 2P9L F; 4JD2 D; 2DYT A; 3RSE F; 3KXY A; 1K3E A; 1K8K D; 1U2V D; 2BSH A; 4H5B A; 1TYQ F; 3UKU F; 2BHO A; 2BSJ A; 2P9U D; 1XKP C; 4AKX A; 3DWL F; 1TTW A; 1N5B A; 4XEI D; 1K3S A; 3ULE D; 2P9K D; 4JD2 F; 1L2W A; 2P9P D; 2BSI A; 2FM8 A; 2P9I F; 2KC5 A; 2LPU A; 1K8K F; 1U2V F; 3UKR D; 3VX7 B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
