The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
121
|
sequence length |
340
|
structure length |
340
|
Chain Sequence |
MRHGDISSSHDTVGIAVVNYKMPRLHTKAEVIENAKKIADMVVGMKQGLPGMDLVVFPEYSTMGIMYDQDEMFATAASIPGEETAIFAEACKKADTWGVFSLTGEKHEDHPNKAPYNTLVLINNKGEIVQKYRKIIPWCPILGWYPGDTTYVTEGPKGLKISLIVCDDGNYPEIWRDCAMKGAELIVRCQGYMYPAKEQQIMMAKAMAWANNTYVAVANATGFDGVYSYFGHSAIIGFDGRTLGECGTEENGIQYAEVSISQIRDFRKNAQSQNHLFKLLHRGYTGLINSGEGDRGVAECPFDFYRTWVLDAEKARENVEKITRSTVGTAECPIQGIPNE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The mechanism of the amidases: mutating the glutamate adjacent to the catalytic triad inactivates the enzyme due to substrate mispositioning.
pubmed doi rcsb |
| molecule keywords |
Aliphatic amidase
|
| molecule tags |
Hydrolase
|
| source organism |
Bacillus sp.
|
| total genus |
121
|
| structure length |
340
|
| sequence length |
340
|
| ec nomenclature |
ec
3.5.1.4: Amidase. |
| pdb deposition date | 2012-09-05 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00795 | CN_hydrolase | Carbon-nitrogen hydrolase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 4-Layer Sandwich | Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase | Carbon-nitrogen hydrolase |
#chains in the Genus database with same CATH superfamily 4LF0 A; 4CYF A; 4KZF A; 3SZG A; 4H5U A; 2GGL A; 2W1V A; 3ILV A; 4GYN A; 4F4H A; 1UF4 A; 4IZV A; 5H8I A; 3WUY A; 5JQN A; 3IW3 A; 2E2K A; 2E2L A; 3SEQ A; 4HG5 A; 4CYG A; 3P8K A; 3DLA A; 2DYV A; 5KHA A; 4CYY A; 5H8J A; 3HKX A; 3SYT A; 1F89 A; 3KI8 A; 2GGK A; 5H8L A; 2E11 A; 3N05 A; 1UF7 A; 2DYU A; 2UXY A; 4IZU A; 1UF5 A; 4IZW A; 1ERZ A; 3IVZ A; 1EMS A; 2VHH A; 3KLC A; 4HG3 A; 4HGD A; 3SDB A; 3SEZ A; 4IZS A; 5H8K A; 2VHI A; 2PLQ A; 1UF8 A; 1J31 A; 4GYL A; 1FO6 A; 4IZT A; #chains in the Genus database with same CATH topology 4LF0 A; 4CYF A; 4KZF A; 3SZG A; 4H5U A; 2GGL A; 2W1V A; 3ILV A; 4GYN A; 4F4H A; 1UF4 A; 4IZV A; 5H8I A; 3WUY A; 5JQN A; 3IW3 A; 2E2K A; 2E2L A; 3SEQ A; 4HG5 A; 4CYG A; 3P8K A; 3DLA A; 2DYV A; 5KHA A; 4CYY A; 5H8J A; 3HKX A; 3SYT A; 1F89 A; 3KI8 A; 2GGK A; 5H8L A; 2E11 A; 3N05 A; 1UF7 A; 2DYU A; 2UXY A; 4IZU A; 1UF5 A; 4IZW A; 1ERZ A; 3IVZ A; 1EMS A; 2VHH A; 3KLC A; 4HG3 A; 4HGD A; 3SDB A; 3SEZ A; 4IZS A; 5H8K A; 2VHI A; 2PLQ A; 1UF8 A; 1J31 A; 4GYL A; 1FO6 A; 4IZT A; #chains in the Genus database with same CATH homology 4LF0 A; 4CYF A; 4KZF A; 3SZG A; 4H5U A; 2GGL A; 2W1V A; 3ILV A; 4GYN A; 4F4H A; 1UF4 A; 4IZV A; 5H8I A; 3WUY A; 5JQN A; 3IW3 A; 2E2K A; 2E2L A; 3SEQ A; 4HG5 A; 4CYG A; 3P8K A; 3DLA A; 2DYV A; 5KHA A; 4CYY A; 5H8J A; 3HKX A; 3SYT A; 1F89 A; 3KI8 A; 2GGK A; 5H8L A; 2E11 A; 3N05 A; 1UF7 A; 2DYU A; 2UXY A; 4IZU A; 1UF5 A; 4IZW A; 1ERZ A; 3IVZ A; 1EMS A; 2VHH A; 3KLC A; 4HG3 A; 4HGD A; 3SDB A; 3SEZ A; 4IZS A; 5H8K A; 2VHI A; 2PLQ A; 1UF8 A; 1J31 A; 4GYL A; 1FO6 A; 4IZT A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...