The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
95
|
sequence length |
294
|
structure length |
294
|
Chain Sequence |
MRWGYTSVQGFRDEMEDDIVIRSDAVDSFSYAAVFDGHAGSSSVKFLREELYKECVGALQAGSLLNGGDFAAIKEALIKAFESVDRNLLKWLEANGDEEDESGSTATVMIIRNDVSFIAHIGESCAVLSRSGQIEELTDYHRPYGSSRAAIQEVKRVKEAGGWIVNGRICGDIAVSRAFGDIRFKTKKNDMLKKGVDEGRWSEKFVSRIEFKGDMVVATPDIFQVPLTSDVEFIILASDGLWDYMKSSDVVSYVRDQLRKHGNVQLACESLAQVALDRRSQDNISIIIADLGRT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural Mechanism Underlying the Specific Recognition between the Arabidopsis State-Transition Phosphatase TAP38/PPH1 and Phosphorylated Light-Harvesting Complex Protein Lhcb1
pubmed doi rcsb |
| molecule tags |
Hydrolase/hydrolase substrate
|
| source organism |
Arabidopsis thaliana
|
| molecule keywords |
Protein phosphatase 2C 57
|
| total genus |
95
|
| structure length |
294
|
| sequence length |
294
|
| ec nomenclature |
ec
3.1.3.16: Protein-serine/threonine phosphatase. |
| pdb deposition date | 2015-03-25 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 4-Layer Sandwich | Phosphatase 2c; domain 1 | PPM-type phosphatase domain |
#chains in the Genus database with same CATH superfamily 2POP A; 2I44 A; 2IRM A; 5JO2 B; 2J82 A; 3JRQ A; 2CM1 A; 3PU9 A; 3FXL A; 4DS8 B; 3FXJ A; 3UJG B; 2ISN A; 3RT0 A; 3KE6 A; 3D8K A; 4YZG A; 4LGB B; 2POM A; 4LG5 B; 2JFT A; 5JO1 B; 3W42 A; 4DA1 A; 5ITI A; 3KDJ B; 3MQ3 A; 3W44 A; 3N3C A; 3EQ2 A; 2PK0 A; 5F1M A; 5D2U A; 2J86 A; 3W43 A; 3F79 A; 3T91 A; 2P8E A; 4RAG A; 4LA7 B; 3W41 A; 4JND A; 4RAF A; 2I0O A; 3W40 A; 3NMT B; 3W45 A; 2Y09 A; 3UJK A; 3UJL B; 2IQ1 A; 2V06 A; 4YZH A; 3NMV B; 4WVO B; 3KB3 B; 2J4O A; 3QN1 B; 4OIC B; 3ES2 A; 3FXO A; 2JFS A; 3NMN B; 2JFR A; 1A6Q A; 4N0G A; 4LGA B; 1TXO A; 3ZVU B; 3RNR A; 3T9Q A; 3FXM A; 2PNQ A; 3FXK A; 3ZT9 A; 4RA2 A; 2XZV A; #chains in the Genus database with same CATH topology 2POP A; 2I44 A; 2IRM A; 5JO2 B; 2J82 A; 3JRQ A; 2CM1 A; 3PU9 A; 3FXL A; 4DS8 B; 3FXJ A; 3UJG B; 2ISN A; 4IIP A; 3RT0 A; 3KE6 A; 3D8K A; 4YZG A; 4LGB B; 2POM A; 4LG5 B; 2JFT A; 5JO1 B; 3W42 A; 4DA1 A; 5ITI A; 3KDJ B; 3MQ3 A; 3W44 A; 3N3C A; 3EQ2 A; 2PK0 A; 5F1M A; 5D2U A; 2J86 A; 3W43 A; 3F79 A; 3T91 A; 2P8E A; 4RAG A; 4LA7 B; 3W41 A; 4JND A; 4RAF A; 2I0O A; 3W40 A; 3NMT B; 3W45 A; 2Y09 A; 3UJK A; 3UJL B; 2IQ1 A; 2V06 A; 4YZH A; 3NMV B; 4WVO B; 4IIK A; 3KB3 B; 2J4O A; 3QN1 B; 4OIC B; 3ES2 A; 3FXO A; 2JFS A; 3NMN B; 2JFR A; 1A6Q A; 4N0G A; 4LGA B; 1TXO A; 3ZVU B; 3RNR A; 3T9Q A; 3FXM A; 2PNQ A; 3FXK A; 3ZT9 A; 4RA2 A; 2XZV A; #chains in the Genus database with same CATH homology 2POP A; 2I44 A; 2IRM A; 5JO2 B; 2J82 A; 3JRQ A; 2CM1 A; 3PU9 A; 3FXL A; 4DS8 B; 3FXJ A; 3UJG B; 2ISN A; 3RT0 A; 3KE6 A; 3D8K A; 4YZG A; 4LGB B; 2POM A; 4LG5 B; 2JFT A; 5JO1 B; 3W42 A; 4DA1 A; 5ITI A; 3KDJ B; 3MQ3 A; 3W44 A; 3N3C A; 3EQ2 A; 2PK0 A; 5F1M A; 5D2U A; 2J86 A; 3W43 A; 3F79 A; 3T91 A; 2P8E A; 4RAG A; 4LA7 B; 3W41 A; 4JND A; 4RAF A; 2I0O A; 3W40 A; 3NMT B; 3W45 A; 2Y09 A; 3UJK A; 3UJL B; 2IQ1 A; 2V06 A; 4YZH A; 3NMV B; 4WVO B; 3KB3 B; 2J4O A; 3QN1 B; 4OIC B; 3ES2 A; 3FXO A; 2JFS A; 3NMN B; 2JFR A; 1A6Q A; 4N0G A; 4LGA B; 1TXO A; 3ZVU B; 3RNR A; 3T9Q A; 3FXM A; 2PNQ A; 3FXK A; 3ZT9 A; 4RA2 A; 2XZV A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
