The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
13
|
sequence length |
52
|
structure length |
52
|
Chain Sequence |
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAAL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
An intrinsically disordered entropic switch determines allostery in Phd-Doc regulation.
pubmed doi rcsb |
| molecule tags |
Transcription
|
| source organism |
Enterobacteria phage p1
|
| molecule keywords |
Antitoxin phd
|
| total genus |
13
|
| structure length |
52
|
| sequence length |
52
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2015-05-02 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02604 | PhdYeFM_antitox | Antitoxin Phd_YefM, type II toxin-antitoxin system |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | YefM-like fold | YefM-like domain |
#chains in the Genus database with same CATH superfamily 2A6Q A; 3D55 A; 3OEI A; 4ZLX A; 3CTO A; 4ZM2 A; 3K33 B; 3HRY A; 3HS2 A; 3K6Q A; 2ODK A; 3G5O A; 3KH2 E; 3OEI E; 4ZM0 A; #chains in the Genus database with same CATH topology 2A6Q A; 5C5P C; 3D55 A; 3OEI A; 4HKK B; 4L0T C; 4L33 C; 4UI4 C; 4UI6 C; 5C5R C; 5ADQ B; 4L0V C; 4HLF C; 4L2K C; 2ODK A; 4HL5 C; 4HLK C; 4L10 C; 4KZL C; 4ZLX A; 4HLH C; 4HLM C; 4L2G C; 4ZM2 A; 4UI5 C; 3K6Q A; 5ADT B; 4KZU C; 3KH2 E; 3OEI E; 4ZM0 A; 4UVP B; 4L0I C; 3CTO A; 4L2F C; 4UI8 C; 3HRY A; 3HS2 A; 4HLG C; 2ZIX B; 4L0S C; 5C5Q C; 5ADS B; 3G5O A; 4KZQ C; 4L34 C; 4HKI C; 5ADR B; 3K33 B; 3HJ6 A; 4HKN C; 4HMH C; 4L0B C; 4L09 C; 4L32 C; 4UI3 C; 4UI7 C; 5FPF C; 4L31 C; #chains in the Genus database with same CATH homology 2A6Q A; 3D55 A; 3OEI A; 4ZLX A; 3CTO A; 4ZM2 A; 3K33 B; 3HRY A; 3HS2 A; 3K6Q A; 2ODK A; 3G5O A; 3KH2 E; 3OEI E; 4ZM0 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
