3K6QA

Crystal structure of an antitoxin part of a putative toxin/antitoxin system (swol_0700) from syntrophomonas wolfei subsp. wolfei at 1.80 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
139
structure length
139
Chain Sequence
GMQTINATEIRNNFSYYIDTVVRDKPIAVKRNRDVLLFFSEQIIKDLLQDLKIHAELSKEDGIIIGTIDGFDLVVSGESEQEVIQKLAEDLLEYAQDYMNDFKLFYNAPNRKTHYPYILKVLLSSNIDEVKGYIYAEMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative ligand binding protein (YP_753395.1) from Syntrophomonas wolfei str. Goettingen at 1.80 A resolution
rcsb
source organism Syntrophomonas wolfei subsp. wolfei
molecule tags Ligand binding protein
molecule keywords Putative ligand binding protein
total genus 40
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12910 PHD_like Antitoxin of toxin-antitoxin, RelE / RelB, TA system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.620 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3k6qA02
3.40.1620.10 Alpha Beta 3-Layer(aba) Sandwich YefM-like fold YefM-like domain 3k6qA01
4ZLXA 3G5OA 3HS2A 3K33B 3OEIE 3CTOA 2A6QA 2ODKA 3KH2E 4ZM2A 3K6QA 4ZM0A 3HRYA 3OEIA 3D55A
chains in the Genus database with same CATH superfamily
2EM0A 2DIXA 2EMXA 2YTQA 2YWQA 2NUEA 2NUGA 4L0VC 3BIDA 4DV1E 3HTXA 1IBLE 4L33C 4ZM2A 3KH2E 2EOHA 4ZM0A 1UBDC 4DR7E 4ZYGA 2UU9E 4X9JA 4M2ZA 5ADRB 1KYQA 1QU6A 2HGHA 2LUQA 3THOB 2MC5A 4NHRA 3OMLA 1N36E 2EZ6A 2LTRA 4BMJA 2EMIA 4B3ME 4LF7E 2L3CA 4LFBE 2LJHA 4BC9A 3BBGA 2B9DA 2EMBA 4B3RE 1ZU1A 2EQ1A 2CTDA 2YTJA 2JWOA 5T6JA 1ZAAC 2EN3A 2YTPA 1HR0E 4LU9A 4WSPA 5IXMB 2YZTA 2LRSA 1N33E 5AE1A 5A6AA 1J5EE 1HNXE 2L2KB 2HJJA 2EPKX 4F6MA 1YSAC 2FGGA 1RMDA 3M99B 2Q8UA 4F9CB 1X5WA 2EOXA 2EM8A 4WSGA 2YSPA 4BBYA 2UXDE 3C6KA 2ENAA 4L2GC 5KL4A 4HLMC 2K4VA 4ZYEA 4IS1C 2EN2A 3LLHA 2WBSA 1YPNA 4M9VC 2EM9A 2RTXA 3MSWA 1YUJA 4JI0E 4DV6E 4R2SA 1XNRE 2E72A 2KHXA 4MLVA 2A25A 2DMIA 4YY3E 1X47A 4DR5E 3KWRA 3EPLA 4HLHC 4HMHC 2RSIA 4DUZE 1F2IG 2EOZA 2V89A 1IQSA 1PKPA 3ADJA 1T38A 5AC5A 2DLQA 2M1SA 2ODRC 4DR2E 5KL6A 2EMLA 4P78A 1TF6A 2EL4A 3OEIE 1WHNA 2V8QB 4KZUC 1RQ0A 4HEIA 2ZM6E 4Q35B 2EPPA 2EPAA 2EM6A 2EL6A 4M0VA 2L2NA 2YU8A 4DUYE 2GHFA 3G5OA 4BS9A 2L8TA 2EMGA 5LL6R 1T4OA 3J7Yp 4TUIA 4O4KA 2HHHE 4Q28A 1XMOE 4L0TC 4O5GA 2BBGA 2CPNA 5AE3A 4P7DA 2EPXA 2G7HA 2CT1A 2VF1A 1UN6B 3MHHC 4HLFC 1N34E 2YT4A 1YFHA 3T1HE 3HQ1A 4B3SE 2EOIA 2YSOA 1STUA 4O43A 4JV5E 2DB2A 2A6QA 1PJSA 4LF8E 3HPZA 2NABA 3BF2A 2YTNA 4M30A 2EMHA 1WXRA 2V83A 4LF9E 4BCAA 2EQ0A 4HKNC 4KHPE 1X6HA 3EPHA 3HXLA 4X64E 4IJDA 3VYXA 4F9BB 2ENCA 4FK5C 2EPZA 2R76A 5TSEA 4BHCA 5FPFC 1NCSA 3MHSC 4F9AB 2CSHA 1WJPA 4L0IC 4UI6C 1BBGA 2LT7A 3T1YE 1AH5A 3C4TA 5LLQA 2WCC3 4L31C 3C4BA 3IWBA 1IBKE 4O24A 1YYKA 1MEYC 3AV0A 2EM3A 1Z1BA 4UI8C 3K33B 2DMYA 2BB8A 2M7QA 1IQOA 1A1FA 2N3GA 4L0SC 3ADGA 4DV3E 4F6NA 4LF6E 3JAMC 2RPCA 2KOUA 2FTXB 4DV5E 5AASA 4DV7E 2F4VE 1MGTA 2ELYA 2EPCA 3VK6A 1LLMC 2GLIA 4ZLXA 1T4NA 4J8ZA 3HPSA 3IWCA 5A2QC 2LBSB 1PJTA 1PJQA 3KZZA 4GKKE 2M9AA 3TQMA 4KWYA 4L8NA 1EH7A 4GEQB 1JK1A 3F6GA 2J7JA 5IWAE 2YTGA 5CFFE 3L00A 2YPNA 2FV4B 2JY9A 4DMIA 2LMZA 2EPOA 2L92A 2UUBE 1G2DC 3J7AG 3BGHA 4HTGA 3RMPA 4BHBA 5AC4A 1YYWA 3ZOQB 4NXNE 3QG5C 2YTIA 4R2AA 2LUPB 1HNZE 2EOQA 4HLKC 1N32E 2EOYA 4L0BC 1QNTA 4ZYDA 1YYOA 1HNWE 1TN9A 2LJUA 1DQ3A 5A6JA 4JYAE 1KJKA 4I8OA 1WHQA 5DNYA 5LMNE 3AUZA 1EH6A 2N8XA 1GQEA 2JVAA 4WXCA 2JOXA 2EN6A 1A1JA 2RS6A 2JOBA 4X66E 2ENHA 2EOSA 2JPAA 1G2FC 5AE2A 1YZ9A 4X8WA 3DJWA 2EM2A 3C6MA 4R2EA 5ADQB 4JI7E 4WX9A 4YHHE 5C5QC 1T39A 4R2QA 2EM7A 1T4LB 3CTOA 2N3HA 4UI3C 4L10C 3EPJA 4L32C 4GZNC 2VRDA 4L2KC 1ZBTA 1FJGE 2B7VA 1XMQE 2EE8A 1IMUA 2EMAA 3IWDA 3JU0A 2YU5A 4JI8E 5A6BA 2I13A 3VHTB 4R2PA 4LFAE 4GKJE 3KZYA 2EPUA 2MKDA 2EOFA 1TF3A 5ADTB 2V87A 2EPRA 3ECRA 2JYAA 1SR9A 2YRMA 2JP9A 1B69A 4LF5E 4R2CA 4X62E 3OTOE 2L33A 2RQLA 3UK3C 5IT9C 2EMCA 2F8BA 5ADSB 3THNA 4KZQC 2NA2A 3ADIA 2EJ4A 5KL5A 4R2RA 4TUGA 4JI6E 4DV4E 4JI1E 2EM5A 2ZIXB 2HC5A 5A6KA 1A1GA 4F2JC 3HS2A 5KL7A 4L34C 2ODRD 2EMFA 2EPNA 1EKZA 4LTYA 1PDAA 4UI5C 1UILA 1L4SA 4KZSA 5LMUE 1X6FA 2EMWA 4HLGC 4DR1E 2RS7A 2EQ3A 2EPMX 4JI3E 2EL5A 4WYQB 4BC7A 5KL3A 1N3GA 2YTOA 2DRPA 2PRTA 2EORA 2UXCE 1O0WA 4HL5C 4X65E 2YRKA 3FIGA 4ZYHA 2L3JA 4MLQA 2H36X 2NUFA 2EMZA 1I94E 2MDRA 2MC6A 2DGCA 4RH8A 1ZR9A 5BR8E 1P47A 1X49A 2WBTA 2EPLX 2DLKA 3P1XA 1A1IA 4OOGC 3ADLA 1J26A 1NEIA 5A6BD 2MKNA 2DSYA 4B3TE 2EOMA 1BBOA 3EPKA 2V86A 3VYYA 4WXDA 2ODKA 4AQYE 1WRJA 2LTSA 5C5RC 2E5LE 1ZBQA 2V88A 2WZOA 2EOEA 1GZ6A 2IHR1 4F54A 2E1MA 4UVPB 2RSMA 1IBME 2LCEA 2ADRA 2YTDA 5IV8B 1XNQE 3OEIA 2LO3A 3LMLA 2KONA 1DI2A 2EWLA 2MDGA 3K6QA 2VQEE 5FLXC 4R2DA 1BB8A 2WBUA 1UHZA 3HJ6A 2EOOA 2D9HA 2K7IA 2UUCE 3EQ1A 2EM4A 4KZLC 2VQFE 2M4IA 4RHBB 2YTEA 2B7TA 2YTFA 4LF4E 2EOJA 1YUIA 2LE2A 4L09C 4L5NC 2JR1A 4OX9E 2L2MA 2I9IA 1FKAE 2EP3A 5ADZA 1JK2A 1X48A 1GTKA 4L2FC 2JXPA 1SFEA 4R03A 2ELZA 4WFTA 2EMKA 4JI4E 4NXME 2EN7A 1AAYA 1X3CA 1RC7A 4K0KE 2R1FA 2VE7C 3F6HA 3J80C 4DR4E 2UUAE 1X6EA 4DR3E 4JI5E 4LFCE 4DR6E 3H09A 2LVHA 2GPIA 4HKKB 2V85A 5C5PC 1A1KA 5F3WA 4NZVA 1A1LA 4R8OA 4N4RB 3J81C 5KL2A 4WPYA 4UI7C 2EN8A 3D55A 2YRHA 2LV2A 4UI4C 2B3TB 1EH8A 3HRYA 2EN1A 2L6MA 4DV0E 3JTZA 4DV2E 4HKIC 2EN4A 1A1HA 2EMYA 1DGCA 3DF6A 2UXBE 5A69A 4JI2E 4DKKA
chains in the Genus database with same CATH topology
2H36X 2DIXA 4TUIA 2LUPB 1HNZE 2NUFA 2HHHE 4Q28A 1XMOE 1I94E 2MDRA 2NUEA 2NUGA 1N32E 2MC6A 4DV1E 1YYOA 2CPNA 3HTXA 5BR8E 5AE3A 1HNWE 1X49A 4P7DA 1IBLE 2G7HA 3P1XA 3KH2E 4ZM2A 4OOGC 3ADLA 1J26A 4ZM0A 1DQ3A 4B3TE 2DSYA 4DR7E 2VF1A 2UU9E 4JYAE 4I8OA 4M2ZA 1QU6A 2V86A 1N34E 3VYYA 2ODKA 2YT4A 2LUQA 1WHQA 5DNYA 2LTSA 3AUZA 5LMNE 3HQ1A 4AQYE 1GQEA 2JVAA 2MC5A 3T1HE 2JOXA 4B3SE 2RS6A 1STUA 2JOBA 4X66E 2E5LE 2DB2A 1ZBQA 2V88A 4JV5E 2A6QA 3OMLA 1N36E 5AE2A 2EZ6A 2WZOA 4LF8E 4X8WA 1YZ9A 3DJWA 2LTRA 4BMJA 1GZ6A 4B3ME 4LF7E 3HPZA 2IHR1 2L3CA 4LFBE 4F54A 2E1MA 2LJHA 4JI7E 4BC9A 4YHHE 4M30A 2B9DA 1WXRA 4B3RE 2RSMA 2V83A 1IBME 1T4LB 4LF9E 3CTOA 2N3HA 4BCAA 2JWOA 5T6JA 1XNQE 4KHPE 3OEIA 1HR0E 3HXLA 4X64E 3LMLA 4LU9A 4WSPA 2KONA 3VYXA 1DI2A 2YZTA 4F9BB 2EWLA 1ZBTA 2LRSA 5AE1A 1FJGE 2B7VA 1J5EE 1HNXE 1N33E 3K6QA 2L2KB 2VQEE 5FLXC 1XMQE 4F9AB 2FGGA 3IWDA 3JU0A 4JI8E 4LFAE 4F9CB 3T1YE 4GKJE 1UHZA 4BBYA 2V87A 3C4TA 2UXDE 2UUCE 1SR9A 2VQFE 2M4IA 2K4VA 2B7TA 3C4BA 3IWBA 3LLHA 1IBKE 4LF4E 4LF5E 1YYKA 4X62E 3AV0A 2LE2A 3OTOE 2L33A 4L5NC 2RTXA 3MSWA 5IT9C 3K33B 4JI0E 2F8BA 2JR1A 4DV6E 2DMYA 2L2MA 2M7QA 1FKAE 4OX9E 1XNRE 2N3GA 2KHXA 5ADZA 1X48A 3ADGA 4YY3E 4DV3E 4LF6E 1X47A 4R03A 4DR5E 2NA2A 3JAMC 3ADIA 4WFTA 3KWRA 4JI4E 4TUGA 2KOUA 4JI6E 4NXME 2FTXB 4DV4E 4DV5E 5AASA 4DV7E 1RC7A 4JI1E 2F4VE 4DUZE 4K0KE 2VE7C 2V89A 3VK6A 4ZLXA 1T4NA 1PKPA 3F6HA 3J80C 4J8ZA 3HPSA 3ADJA 2UUAE 4DR4E 3IWCA 3HS2A 2M1SA 5A2QC 4DR3E 2ODRD 2LBSB 2ODRC 4DR2E 4JI5E 4LFCE 4DR6E 4GKKE 3H09A 1EKZA 4LTYA 4L8NA 4P78A 1UILA 4GEQB 2V85A 4KZSA 5LMUE 3F6GA 5IWAE 5CFFE 5F3WA 4DR1E 3OEIE 4R8OA 2FV4B 2RS7A 1WHNA 2JY9A 4DMIA 3J81C 2LMZA 2L92A 2UUBE 2V8QB 4WYQB 4JI3E 4BC7A 1RQ0A 4WPYA 2ZM6E 3D55A 3J7AG 3RMPA 2B3TB 3HRYA 4M0VA 2L2NA 2L6MA 4DV0E 4DUYE 3JTZA 4DV2E 2UXCE 1O0WA 1YYWA 3G5OA 4BS9A 4X65E 3ZOQB 2L8TA 4NXNE 3FIGA 3DF6A 2UXBE 5LL6R 1T4OA 4JI2E 4DKKA 2L3JA 3J7Yp
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZLX A;  3G5O A;  3HS2 A;  3K33 B;  3OEI E;  3CTO A;  2A6Q A;  2ODK A;  3KH2 E;  4ZM2 A;  3K6Q A;  4ZM0 A;  3HRY A;  3OEI A;  3D55 A; 
#chains in the Genus database with same CATH topology
 2EM0 A;  2DIX A;  2EMX A;  2YTQ A;  2YWQ A;  2NUE A;  2NUG A;  4L0V C;  3BID A;  4DV1 E;  3HTX A;  1IBL E;  4L33 C;  4ZM2 A;  3KH2 E;  2EOH A;  4ZM0 A;  1UBD C;  4DR7 E;  4ZYG A;  2UU9 E;  4X9J A;  4M2Z A;  5ADR B;  1KYQ A;  1QU6 A;  2HGH A;  2LUQ A;  3THO B;  2MC5 A;  4NHR A;  3OML A;  1N36 E;  2EZ6 A;  2LTR A;  4BMJ A;  2EMI A;  4B3M E;  4LF7 E;  2L3C A;  4LFB E;  2LJH A;  4BC9 A;  3BBG A;  2B9D A;  2EMB A;  4B3R E;  1ZU1 A;  2EQ1 A;  2CTD A;  2YTJ A;  2JWO A;  5T6J A;  1ZAA C;  2EN3 A;  2YTP A;  1HR0 E;  4LU9 A;  4WSP A;  5IXM B;  2YZT A;  2LRS A;  1N33 E;  5AE1 A;  5A6A A;  1J5E E;  1HNX E;  2L2K B;  2HJJ A;  2EPK X;  4F6M A;  1YSA C;  2FGG A;  1RMD A;  3M99 B;  2Q8U A;  4F9C B;  1X5W A;  2EOX A;  2EM8 A;  4WSG A;  2YSP A;  4BBY A;  2UXD E;  3C6K A;  2ENA A;  4L2G C;  5KL4 A;  4HLM C;  2K4V A;  4ZYE A;  4IS1 C;  2EN2 A;  3LLH A;  2WBS A;  1YPN A;  4M9V C;  2EM9 A;  2RTX A;  3MSW A;  1YUJ A;  4JI0 E;  4DV6 E;  4R2S A;  1XNR E;  2E72 A;  2KHX A;  4MLV A;  2A25 A;  2DMI A;  4YY3 E;  1X47 A;  4DR5 E;  3KWR A;  3EPL A;  4HLH C;  4HMH C;  2RSI A;  4DUZ E;  1F2I G;  2EOZ A;  2V89 A;  1IQS A;  1PKP A;  3ADJ A;  1T38 A;  5AC5 A;  2DLQ A;  2M1S A;  2ODR C;  4DR2 E;  5KL6 A;  2EML A;  4P78 A;  1TF6 A;  2EL4 A;  3OEI E;  1WHN A;  2V8Q B;  4KZU C;  1RQ0 A;  4HEI A;  2ZM6 E;  4Q35 B;  2EPP A;  2EPA A;  2EM6 A;  2EL6 A;  4M0V A;  2L2N A;  2YU8 A;  4DUY E;  2GHF A;  3G5O A;  4BS9 A;  2L8T A;  2EMG A;  5LL6 R;  1T4O A;  3J7Y p;  4TUI A;  4O4K A;  2HHH E;  4Q28 A;  1XMO E;  4L0T C;  4O5G A;  2BBG A;  2CPN A;  5AE3 A;  4P7D A;  2EPX A;  2G7H A;  2CT1 A;  2VF1 A;  1UN6 B;  3MHH C;  4HLF C;  1N34 E;  2YT4 A;  1YFH A;  3T1H E;  3HQ1 A;  4B3S E;  2EOI A;  2YSO A;  1STU A;  4O43 A;  4JV5 E;  2DB2 A;  2A6Q A;  1PJS A;  4LF8 E;  3HPZ A;  2NAB A;  3BF2 A;  2YTN A;  4M30 A;  2EMH A;  1WXR A;  2V83 A;  4LF9 E;  4BCA A;  2EQ0 A;  4HKN C;  4KHP E;  1X6H A;  3EPH A;  3HXL A;  4X64 E;  4IJD A;  3VYX A;  4F9B B;  2ENC A;  4FK5 C;  2EPZ A;  2R76 A;  5TSE A;  4BHC A;  5FPF C;  1NCS A;  3MHS C;  4F9A B;  2CSH A;  1WJP A;  4L0I C;  4UI6 C;  1BBG A;  2LT7 A;  3T1Y E;  1AH5 A;  3C4T A;  5LLQ A;  2WCC 3;  4L31 C;  3C4B A;  3IWB A;  1IBK E;  4O24 A;  1YYK A;  1MEY C;  3AV0 A;  2EM3 A;  1Z1B A;  4UI8 C;  3K33 B;  2DMY A;  2BB8 A;  2M7Q A;  1IQO A;  1A1F A;  2N3G A;  4L0S C;  3ADG A;  4DV3 E;  4F6N A;  4LF6 E;  3JAM C;  2RPC A;  2KOU A;  2FTX B;  4DV5 E;  5AAS A;  4DV7 E;  2F4V E;  1MGT A;  2ELY A;  2EPC A;  3VK6 A;  1LLM C;  2GLI A;  4ZLX A;  1T4N A;  4J8Z A;  3HPS A;  3IWC A;  5A2Q C;  2LBS B;  1PJT A;  1PJQ A;  3KZZ A;  4GKK E;  2M9A A;  3TQM A;  4KWY A;  4L8N A;  1EH7 A;  4GEQ B;  1JK1 A;  3F6G A;  2J7J A;  5IWA E;  2YTG A;  5CFF E;  3L00 A;  2YPN A;  2FV4 B;  2JY9 A;  4DMI A;  2LMZ A;  2EPO A;  2L92 A;  2UUB E;  1G2D C;  3J7A G;  3BGH A;  4HTG A;  3RMP A;  4BHB A;  5AC4 A;  1YYW A;  3ZOQ B;  4NXN E;  3QG5 C;  2YTI A;  4R2A A;  2LUP B;  1HNZ E;  2EOQ A;  4HLK C;  1N32 E;  2EOY A;  4L0B C;  1QNT A;  4ZYD A;  1YYO A;  1HNW E;  1TN9 A;  2LJU A;  1DQ3 A;  5A6J A;  4JYA E;  1KJK A;  4I8O A;  1WHQ A;  5DNY A;  5LMN E;  3AUZ A;  1EH6 A;  2N8X A;  1GQE A;  2JVA A;  4WXC A;  2JOX A;  2EN6 A;  1A1J A;  2RS6 A;  2JOB A;  4X66 E;  2ENH A;  2EOS A;  2JPA A;  1G2F C;  5AE2 A;  1YZ9 A;  4X8W A;  3DJW A;  2EM2 A;  3C6M A;  4R2E A;  5ADQ B;  4JI7 E;  4WX9 A;  4YHH E;  5C5Q C;  1T39 A;  4R2Q A;  2EM7 A;  1T4L B;  3CTO A;  2N3H A;  4UI3 C;  4L10 C;  3EPJ A;  4L32 C;  4GZN C;  2VRD A;  4L2K C;  1ZBT A;  1FJG E;  2B7V A;  1XMQ E;  2EE8 A;  1IMU A;  2EMA A;  3IWD A;  3JU0 A;  2YU5 A;  4JI8 E;  5A6B A;  2I13 A;  3VHT B;  4R2P A;  4LFA E;  4GKJ E;  3KZY A;  2EPU A;  2MKD A;  2EOF A;  1TF3 A;  5ADT B;  2V87 A;  2EPR A;  3ECR A;  2JYA A;  1SR9 A;  2YRM A;  2JP9 A;  1B69 A;  4LF5 E;  4R2C A;  4X62 E;  3OTO E;  2L33 A;  2RQL A;  3UK3 C;  5IT9 C;  2EMC A;  2F8B A;  5ADS B;  3THN A;  4KZQ C;  2NA2 A;  3ADI A;  2EJ4 A;  5KL5 A;  4R2R A;  4TUG A;  4JI6 E;  4DV4 E;  4JI1 E;  2EM5 A;  2ZIX B;  2HC5 A;  5A6K A;  1A1G A;  4F2J C;  3HS2 A;  5KL7 A;  4L34 C;  2ODR D;  2EMF A;  2EPN A;  1EKZ A;  4LTY A;  1PDA A;  4UI5 C;  1UIL A;  1L4S A;  4KZS A;  5LMU E;  1X6F A;  2EMW A;  4HLG C;  4DR1 E;  2RS7 A;  2EQ3 A;  2EPM X;  4JI3 E;  2EL5 A;  4WYQ B;  4BC7 A;  5KL3 A;  1N3G A;  2YTO A;  2DRP A;  2PRT A;  2EOR A;  2UXC E;  1O0W A;  4HL5 C;  4X65 E;  2YRK A;  3FIG A;  4ZYH A;  2L3J A;  4MLQ A;  2H36 X;  2NUF A;  2EMZ A;  1I94 E;  2MDR A;  2MC6 A;  2DGC A;  4RH8 A;  1ZR9 A;  5BR8 E;  1P47 A;  1X49 A;  2WBT A;  2EPL X;  2DLK A;  3P1X A;  1A1I A;  4OOG C;  3ADL A;  1J26 A;  1NEI A;  5A6B D;  2MKN A;  2DSY A;  4B3T E;  2EOM A;  1BBO A;  3EPK A;  2V86 A;  3VYY A;  4WXD A;  2ODK A;  4AQY E;  1WRJ A;  2LTS A;  5C5R C;  2E5L E;  1ZBQ A;  2V88 A;  2WZO A;  2EOE A;  1GZ6 A;  2IHR 1;  4F54 A;  2E1M A;  4UVP B;  2RSM A;  1IBM E;  2LCE A;  2ADR A;  2YTD A;  5IV8 B;  1XNQ E;  3OEI A;  2LO3 A;  3LML A;  2KON A;  1DI2 A;  2EWL A;  2MDG A;  3K6Q A;  2VQE E;  5FLX C;  4R2D A;  1BB8 A;  2WBU A;  1UHZ A;  3HJ6 A;  2EOO A;  2D9H A;  2K7I A;  2UUC E;  3EQ1 A;  2EM4 A;  4KZL C;  2VQF E;  2M4I A;  4RHB B;  2YTE A;  2B7T A;  2YTF A;  4LF4 E;  2EOJ A;  1YUI A;  2LE2 A;  4L09 C;  4L5N C;  2JR1 A;  4OX9 E;  2L2M A;  2I9I A;  1FKA E;  2EP3 A;  5ADZ A;  1JK2 A;  1X48 A;  1GTK A;  4L2F C;  2JXP A;  1SFE A;  4R03 A;  2ELZ A;  4WFT A;  2EMK A;  4JI4 E;  4NXM E;  2EN7 A;  1AAY A;  1X3C A;  1RC7 A;  4K0K E;  2R1F A;  2VE7 C;  3F6H A;  3J80 C;  4DR4 E;  2UUA E;  1X6E A;  4DR3 E;  4JI5 E;  4LFC E;  4DR6 E;  3H09 A;  2LVH A;  2GPI A;  4HKK B;  2V85 A;  5C5P C;  1A1K A;  5F3W A;  4NZV A;  1A1L A;  4R8O A;  4N4R B;  3J81 C;  5KL2 A;  4WPY A;  4UI7 C;  2EN8 A;  3D55 A;  2YRH A;  2LV2 A;  4UI4 C;  2B3T B;  1EH8 A;  3HRY A;  2EN1 A;  2L6M A;  4DV0 E;  3JTZ A;  4DV2 E;  4HKI C;  2EN4 A;  1A1H A;  2EMY A;  1DGC A;  3DF6 A;  2UXB E;  5A69 A;  4JI2 E;  4DKK A; 
#chains in the Genus database with same CATH homology
 2H36 X;  2DIX A;  4TUI A;  2LUP B;  1HNZ E;  2NUF A;  2HHH E;  4Q28 A;  1XMO E;  1I94 E;  2MDR A;  2NUE A;  2NUG A;  1N32 E;  2MC6 A;  4DV1 E;  1YYO A;  2CPN A;  3HTX A;  5BR8 E;  5AE3 A;  1HNW E;  1X49 A;  4P7D A;  1IBL E;  2G7H A;  3P1X A;  3KH2 E;  4ZM2 A;  4OOG C;  3ADL A;  1J26 A;  4ZM0 A;  1DQ3 A;  4B3T E;  2DSY A;  4DR7 E;  2VF1 A;  2UU9 E;  4JYA E;  4I8O A;  4M2Z A;  1QU6 A;  2V86 A;  1N34 E;  3VYY A;  2ODK A;  2YT4 A;  2LUQ A;  1WHQ A;  5DNY A;  2LTS A;  3AUZ A;  5LMN E;  3HQ1 A;  4AQY E;  1GQE A;  2JVA A;  2MC5 A;  3T1H E;  2JOX A;  4B3S E;  2RS6 A;  1STU A;  2JOB A;  4X66 E;  2E5L E;  2DB2 A;  1ZBQ A;  2V88 A;  4JV5 E;  2A6Q A;  3OML A;  1N36 E;  5AE2 A;  2EZ6 A;  2WZO A;  4LF8 E;  4X8W A;  1YZ9 A;  3DJW A;  2LTR A;  4BMJ A;  1GZ6 A;  4B3M E;  4LF7 E;  3HPZ A;  2IHR 1;  2L3C A;  4LFB E;  4F54 A;  2E1M A;  2LJH A;  4JI7 E;  4BC9 A;  4YHH E;  4M30 A;  2B9D A;  1WXR A;  4B3R E;  2RSM A;  2V83 A;  1IBM E;  1T4L B;  4LF9 E;  3CTO A;  2N3H A;  4BCA A;  2JWO A;  5T6J A;  1XNQ E;  4KHP E;  3OEI A;  1HR0 E;  3HXL A;  4X64 E;  3LML A;  4LU9 A;  4WSP A;  2KON A;  3VYX A;  1DI2 A;  2YZT A;  4F9B B;  2EWL A;  1ZBT A;  2LRS A;  5AE1 A;  1FJG E;  2B7V A;  1J5E E;  1HNX E;  1N33 E;  3K6Q A;  2L2K B;  2VQE E;  5FLX C;  1XMQ E;  4F9A B;  2FGG A;  3IWD A;  3JU0 A;  4JI8 E;  4LFA E;  4F9C B;  3T1Y E;  4GKJ E;  1UHZ A;  4BBY A;  2V87 A;  3C4T A;  2UXD E;  2UUC E;  1SR9 A;  2VQF E;  2M4I A;  2K4V A;  2B7T A;  3C4B A;  3IWB A;  3LLH A;  1IBK E;  4LF4 E;  4LF5 E;  1YYK A;  4X62 E;  3AV0 A;  2LE2 A;  3OTO E;  2L33 A;  4L5N C;  2RTX A;  3MSW A;  5IT9 C;  3K33 B;  4JI0 E;  2F8B A;  2JR1 A;  4DV6 E;  2DMY A;  2L2M A;  2M7Q A;  1FKA E;  4OX9 E;  1XNR E;  2N3G A;  2KHX A;  5ADZ A;  1X48 A;  3ADG A;  4YY3 E;  4DV3 E;  4LF6 E;  1X47 A;  4R03 A;  4DR5 E;  2NA2 A;  3JAM C;  3ADI A;  4WFT A;  3KWR A;  4JI4 E;  4TUG A;  2KOU A;  4JI6 E;  4NXM E;  2FTX B;  4DV4 E;  4DV5 E;  5AAS A;  4DV7 E;  1RC7 A;  4JI1 E;  2F4V E;  4DUZ E;  4K0K E;  2VE7 C;  2V89 A;  3VK6 A;  4ZLX A;  1T4N A;  1PKP A;  3F6H A;  3J80 C;  4J8Z A;  3HPS A;  3ADJ A;  2UUA E;  4DR4 E;  3IWC A;  3HS2 A;  2M1S A;  5A2Q C;  4DR3 E;  2ODR D;  2LBS B;  2ODR C;  4DR2 E;  4JI5 E;  4LFC E;  4DR6 E;  4GKK E;  3H09 A;  1EKZ A;  4LTY A;  4L8N A;  4P78 A;  1UIL A;  4GEQ B;  2V85 A;  4KZS A;  5LMU E;  3F6G A;  5IWA E;  5CFF E;  5F3W A;  4DR1 E;  3OEI E;  4R8O A;  2FV4 B;  2RS7 A;  1WHN A;  2JY9 A;  4DMI A;  3J81 C;  2LMZ A;  2L92 A;  2UUB E;  2V8Q B;  4WYQ B;  4JI3 E;  4BC7 A;  1RQ0 A;  4WPY A;  2ZM6 E;  3D55 A;  3J7A G;  3RMP A;  2B3T B;  3HRY A;  4M0V A;  2L2N A;  2L6M A;  4DV0 E;  4DUY E;  3JTZ A;  4DV2 E;  2UXC E;  1O0W A;  1YYW A;  3G5O A;  4BS9 A;  4X65 E;  3ZOQ B;  2L8T A;  4NXN E;  3FIG A;  3DF6 A;  2UXB E;  5LL6 R;  1T4O A;  4JI2 E;  4DKK A;  2L3J A;  3J7Y p; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...