3K6QA

Crystal structure of an antitoxin part of a putative toxin/antitoxin system (swol_0700) from syntrophomonas wolfei subsp. wolfei at 1.80 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
139
structure length
139
Chain Sequence
GMQTINATEIRNNFSYYIDTVVRDKPIAVKRNRDVLLFFSEQIIKDLLQDLKIHAELSKEDGIIIGTIDGFDLVVSGESEQEVIQKLAEDLLEYAQDYMNDFKLFYNAPNRKTHYPYILKVLLSSNIDEVKGYIYAEMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein
molecule keywords Putative ligand binding protein
publication title Crystal structure of Putative ligand binding protein (YP_753395.1) from Syntrophomonas wolfei str. Goettingen at 1.80 A resolution
rcsb
source organism Syntrophomonas wolfei subsp. wolfei
total genus 40
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12910 PHD_like Antitoxin of toxin-antitoxin, RelE / RelB, TA system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.620 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3k6qA02
3.40.1620.10 Alpha Beta 3-Layer(aba) Sandwich YefM-like fold YefM-like domain 3k6qA01
2A6QA 3G5OA 4ZM0A 3HRYA 3OEIA 3OEIE 4ZLXA 3CTOA 3KH2E 2ODKA 3K33B 3K6QA 3HS2A 3D55A 4ZM2A
chains in the Genus database with same CATH superfamily
4L0BC 2H36X 2JP9A 2EOEA 2N3HA 4R2AA 1XMQE 1N34E 4WSGA 4L31C 1EH8A 2EZ6A 2EPKX 1FKAE 1HNZE 4HL5C 1HR0E 2L3CA 3JU0A 1RC7A 4KHPE 2N3GA 4LFCE 4L09C 4F54A 4JI8E 4JI0E 4BHBA 2ADRA 2ODRD 3JTZA 1ZU1A 2EMZA 2UXCE 4O5GA 2JWOA 5IWAE 1YPNA 2ENCA 1BBOA 4WFTA 2I9IA 3VYYA 4DV7E 4F6MA 4GEQB 2DMIA 1QNTA 3HRYA 4DR3E 2LTRA 1PJQA 4DV2E 2NUGA 1N3GA 2YTFA 2L2MA 2D9HA 2EOMA 1NEIA 3KZZA 1YYKA 2L33A 4LU9A 1P47A 3KZYA 4DUZE 2LUPB 4KZSA 2GLIA 2EL5A 4ZYGA 3VYXA 1J5EE 2EMLA 4UI7C 2EN7A 3QG5C 4ZYDA 4LF4E 3J7AG 2KONA 5KL6A 1N36E 2I13A 2EOIA 3ECRA 1X47A 3AV0A 2EL4A 1EH7A 2HGHA 2DSYA 4B3SE 4JI1E 2YRMA 2EN1A 4DR6E 4ZLXA 5T6JA 2RTXA 1WHNA 5IXMB 2EOOA 2HC5A 1YYOA 2N8XA 2LV2A 4DV4E 2EMWA 2LTSA 4HKKB 2YWQA 5KL3A 2EPPA 4LF5E 2YU5A 4L2FC 1WHQA 1X6FA 3ADGA 3MSWA 3C6MA 4L2KC 1WJPA 1SFEA 4X66E 2VQFE 5KL5A 2V86A 2DIXA 2UUAE 2MKNA 3HTXA 2JYAA 5TSEA 1DGCA 1L4SA 2V85A 3IWBA 2KOUA 2EPMX 5ADTB 1ZBTA 2EORA 3RMPA 4JI3E 1STUA 2EPAA 4NXME 3KH2E 4ZYHA 4DV3E 4JI6E 2Q8UA 5LL6R 2VQEE 3LLHA 2YTQA 4JV5E 2EOQA 1SR9A 3ADJA 2WCC3 2YTEA 3J81C 1T38A 4DV1E 1B69A 2EOSA 2EL6A 2ENAA 3EPLA 2RPCA 2E72A 2EMKA 1HNWE 1XMOE 4LF6E 2EM0A 1N32E 5C5RC 3VK6A 2VF1A 5BR8E 5A6BA 3EPJA 4BC7A 3JAMC 2MC6A 1A1IA 4YY3E 5LLQA 4KZLC 1ZBQA 1GZ6A 2BBGA 4KWYA 1T4NA 2LJHA 4WXDA 2EMBA 3HS2A 4R03A 1YZ9A 2NABA 2EM8A 2JOXA 2EOZA 2EMIA 2EMYA 2DMYA 2EN4A 1YSAC 3CTOA 2LVHA 2EMHA 3ADIA 1PKPA 4N4RB 2GPIA 2L8TA 5LMUE 1F2IG 3G5OA 2EPNA 5ADSB 4R2EA 1JK2A 2ZIXB 2YTOA 1T4LB 1NCSA 2EN8A 2WBUA 2LCEA 2EOJA 5KL2A 3BGHA 2EPLX 5LMNE 1AAYA 5ADQB 4R2RA 2EOYA 4R2PA 2YU8A 5A69A 4HLKC 1UBDC 1TN9A 1T4OA 5A6JA 2EOHA 4R2SA 3T1YE 2K7IA 1PDAA 2A6QA 4L32C 2V83A 4LFAE 4AQYE 4X9JA 1KJKA 4L0SC 1IBKE 3IWDA 5C5PC 2FTXB 3ZOQB 4WSPA 4OOGC 2YSOA 2EM6A 5AE2A 2EJ4A 3HXLA 4L5NC 1ZAAC 2FV4B 4ZM0A 3MHSC 4O24A 1UN6B 2YTPA 2M7QA 4B3TE 3TQMA 2YTIA 1IQSA 2LRSA 3EPHA 4DR7E 2LBSB 5ADRB 2HHHE 4LFBE 1GTKA 2PRTA 4L0TC 1X6HA 4UVPB 2YZTA 3DF6A 1I94E 4M2ZA 3DJWA 4DR4E 5AC5A 2YTDA 2EMFA 5ADZA 4M9VC 2L6MA 1T39A 2YRKA 4O43A 3M99B 2BB8A 4HEIA 2MDRA 1A1FA 4JI5E 2EPOA 4F6NA 4J8ZA 4GZNC 1X3CA 2EOXA 1YUIA 4IJDA 4IS1C 4DR1E 2DRPA 2LMZA 2EOFA 3FIGA 2EM5A 4HLFC 3L00A 5IV8B 1MEYC 4B3ME 2EP3A 2VRDA 2B9DA 2UXDE 5AE1A 4P7DA 2M4IA 3LMLA 3THNA 2YSPA 3BBGA 4JI7E 5A6KA 4YHHE 2F4VE 4R2DA 3IWCA 5FLXC 2RSMA 4HLGC 1DQ3A 4BC9A 3J80C 2F8BA 2EQ3A 4UI8C 2R1FA 4NZVA 1AH5A 1YYWA 1Z1BA 1KYQA 5CFFE 1TF3A 1J26A 3BIDA 5A6AA 1MGTA 4L8NA 1GQEA 4R2QA 2CTDA 3OTOE 1G2FC 2EM9A 4UI5C 2E1MA 2DB2A 4M0VA 4F2JC 3OEIE 4FK5C 1IBLE 1IQOA 4GKJE 1N33E 3T1HE 1A1KA 1XNRE 2EQ0A 5AE3A 1YFHA 4DUYE 2FGGA 1EH6A 4WXCA 2JXPA 3H09A 1HNXE 3F6HA 2EE8A 4KZUC 4WYQB 1A1JA 2CPNA 4RH8A 4L10C 2NA2A 1UHZA 4DV0E 4L33C 4ZYEA 4JI2E 3C4BA 1PJTA 2EMXA 2B7TA 4WPYA 1PJSA 2EPRA 4KZQC 1A1GA 3KWRA 4F9CB 2UUBE 4WX9A 4RHBB 1TF6A 3K33B 2RSIA 4LF8E 1BBGA 2HJJA 4L0IC 2MC5A 4X65E 2V89A 4DR2E 2CT1A 2JY9A 2K4VA 2MDGA 4JYAE 2YTJA 2DLQA 2ELYA 4GKKE 2EM3A 3VHTB 3HPSA 4HKIC 1QU6A 2UU9E 2VE7C 2LJUA 5FPFC 2ENHA 4BHCA 2EWLA 3P1XA 2V87A 4X62E 2E5LE 2JPAA 2EM7A 4O4KA 1X49A 2A25A 1RMDA 4BS9A 4DV5E 1A1LA 3UK3C 3C4TA 2EN6A 2ZM6E 2LUQA 2EPZA 3OMLA 5IT9C 2ODKA 4X8WA 1X5WA 2EMCA 4JI4E 2L3JA 1YUJA 4DV6E 4LTYA 3HPZA 4M30A 4ZM2A 4NXNE 5KL4A 1X6EA 2EMAA 2L92A 1FJGE 2L2NA 3OEIA 2KHXA 3F6GA 2DGCA 1DI2A 2RQLA 1UILA 1WXRA 3K6QA 5A6BD 3THOB 4MLVA 4P78A 3HQ1A 4HMHC 3AUZA 2EPCA 2B3TB 1JK1A 4L0VC 2L2KB 2MKDA 4Q35B 2EQ1A 5KL7A 2EPXA 2WBSA 4R8OA 2DLKA 2YT4A 4TUGA 2EM2A 2YPNA 3D55A 4UI4C 3J7Yp 2M1SA 4L34C 2EN2A 2EPUA 2YTGA 4B3RE 4LF7E 4DMIA 2UXBE 2EM4A 4DKKA 2M9AA 4BCAA 1A1HA 2ELZA 4UI3C 4UI6C 3HJ6A 4BMJA 4OX9E 4HLHC 2JOBA 4I8OA 1O0WA 2V88A 4K0KE 4HTGA 4HLMC 4NHRA 5C5QC 5F3WA 3BF2A 5DNYA 2WZOA 1LLMC 2YTNA 2RS7A 3ADLA 4HKNC 2LO3A 1IMUA 2EMGA 1RQ0A 4LF9E 4X64E 4DR5E 2EN3A 2JVAA 2YRHA 2V8QB 3C6KA 3EQ1A 4Q28A 4F9BB 1IBME 2LE2A 1XNQE 5AC4A 1X48A 4F9AB 1BB8A 2CSHA 2NUEA 1WRJA 2G7HA 4TUIA 2JR1A 2J7JA 1EKZA 2GHFA 4R2CA 2UUCE 5A2QC 5AASA 2WBTA 2NUFA 2RS6A 1G2DC 4MLQA 2LT7A 2R76A 3MHHC 2IHR1 2B7VA 3EPKA 1ZR9A 4BBYA 2ODRC 4L2GC
chains in the Genus database with same CATH topology
3DF6A 1I94E 4DV3E 4M2ZA 2H36X 4JI6E 3DJWA 5LL6R 4DR4E 2N3HA 2EWLA 1XMQE 5ADZA 1N34E 3P1XA 2L6MA 2VQEE 3LLHA 2V87A 4X62E 2EZ6A 2E5LE 1FKAE 1HNZE 4JV5E 2MDRA 1SR9A 1X49A 3ADJA 1HR0E 4JI5E 4BS9A 4DV5E 3J81C 2L3CA 3C4TA 4J8ZA 4DV1E 3JU0A 1RC7A 4KHPE 2N3GA 2LUQA 2ZM6E 3OMLA 4LFCE 5IT9C 2ODKA 4X8WA 4JI8E 4F54A 4JI0E 1HNWE 4JI4E 2ODRD 3JTZA 4DR1E 2L3JA 1XMOE 4LF6E 2UXCE 2LMZA 3FIGA 3VK6A 2VF1A 2JWOA 5BR8E 4DV6E 1N32E 4LTYA 3HPZA 5IWAE 4BC7A 4M30A 4ZM2A 3JAMC 4NXNE 2MC6A 1FJGE 2L92A 4YY3E 4B3ME 2L2NA 1ZBQA 4WFTA 2KHXA 3F6GA 1DI2A 3OEIA 1GZ6A 3VYYA 4DV7E 1UILA 1WXRA 2B9DA 1T4NA 4GEQB 3K6QA 5AE1A 2LJHA 2UXDE 3HS2A 4P7DA 4R03A 2M4IA 3LMLA 1YZ9A 3HRYA 4P78A 3HQ1A 2JOXA 4DR3E 4JI7E 3AUZA 2LTRA 4YHHE 2B3TB 2F4VE 3IWCA 5FLXC 2RSMA 2L2KB 4DV2E 2NUGA 1DQ3A 4BC9A 3J80C 2F8BA 2DMYA 2L2MA 4R8OA 1YYKA 3CTOA 2L33A 2YT4A 4LU9A 4TUGA 5CFFE 1YYWA 3D55A 1J26A 3ADIA 3J7Yp 1PKPA 2M1SA 5LMUE 2L8TA 4DUZE 2LUPB 3G5OA 4KZSA 4L8NA 4B3RE 1GQEA 4LF7E 3VYXA 3KH2E 1J5EE 4DMIA 3OTOE 1T4LB 2UXBE 2E1MA 4DKKA 2DB2A 4M0VA 3OEIE 4BCAA 4LF4E 3J7AG 1IBLE 4GKJE 2KONA 1N33E 1N36E 3T1HE 5LMNE 4BBYA 1XNRE 1X47A 4BMJA 5AE3A 4OX9E 3AV0A 2JOBA 4DUYE 2DSYA 2FGGA 4I8OA 1O0WA 2V88A 4B3SE 4JI1E 4K0KE 5F3WA 4DR6E 4ZLXA 3H09A 5T6JA 2RTXA 1WHNA 1HNXE 3F6HA 1T4OA 5DNYA 2WZOA 4WYQB 2CPNA 3T1YE 1YYOA 2RS7A 2NA2A 3ADLA 1UHZA 4DV0E 2A6QA 1RQ0A 4LF9E 4DV4E 2V83A 2LTSA 4JI2E 3C4BA 4LFAE 4AQYE 4LF5E 2B7TA 4WPYA 4X64E 2JVAA 4DR5E 1WHQA 2V8QB 4F9BB 4Q28A 1IBKE 3IWDA 3KWRA 4F9CB 3ADGA 2FTXB 2LE2A 3ZOQB 4WSPA 4OOGC 1IBME 2UUBE 1XNQE 3MSWA 5AE2A 3K33B 1X48A 3HXLA 4F9AB 4X66E 4LF8E 4NXME 2VQFE 2NUEA 2G7HA 2V86A 4L5NC 2DIXA 2MC5A 4X65E 4TUIA 2FV4B 2UUAE 2JR1A 1EKZA 4ZM0A 2V89A 3HTXA 4B3TE 2M7QA 2UUCE 4DR2E 5A2QC 2V85A 5AASA 2NUFA 2JY9A 3IWBA 2K4VA 2KOUA 2LRSA 4JYAE 4DR7E 4GKKE 2RS6A 2LBSB 3HPSA 2HHHE 1ZBTA 2IHR1 3RMPA 4JI3E 4LFBE 1STUA 1QU6A 2B7VA 2UU9E 2VE7C 2ODRC 2YZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6Q A;  3G5O A;  4ZM0 A;  3HRY A;  3OEI A;  3OEI E;  4ZLX A;  3CTO A;  3KH2 E;  2ODK A;  3K33 B;  3K6Q A;  3HS2 A;  3D55 A;  4ZM2 A; 
#chains in the Genus database with same CATH topology
 4L0B C;  2H36 X;  2JP9 A;  2EOE A;  2N3H A;  4R2A A;  1XMQ E;  1N34 E;  4WSG A;  4L31 C;  1EH8 A;  2EZ6 A;  2EPK X;  1FKA E;  1HNZ E;  4HL5 C;  1HR0 E;  2L3C A;  3JU0 A;  1RC7 A;  4KHP E;  2N3G A;  4LFC E;  4L09 C;  4F54 A;  4JI8 E;  4JI0 E;  4BHB A;  2ADR A;  2ODR D;  3JTZ A;  1ZU1 A;  2EMZ A;  2UXC E;  4O5G A;  2JWO A;  5IWA E;  1YPN A;  2ENC A;  1BBO A;  4WFT A;  2I9I A;  3VYY A;  4DV7 E;  4F6M A;  4GEQ B;  2DMI A;  1QNT A;  3HRY A;  4DR3 E;  2LTR A;  1PJQ A;  4DV2 E;  2NUG A;  1N3G A;  2YTF A;  2L2M A;  2D9H A;  2EOM A;  1NEI A;  3KZZ A;  1YYK A;  2L33 A;  4LU9 A;  1P47 A;  3KZY A;  4DUZ E;  2LUP B;  4KZS A;  2GLI A;  2EL5 A;  4ZYG A;  3VYX A;  1J5E E;  2EML A;  4UI7 C;  2EN7 A;  3QG5 C;  4ZYD A;  4LF4 E;  3J7A G;  2KON A;  5KL6 A;  1N36 E;  2I13 A;  2EOI A;  3ECR A;  1X47 A;  3AV0 A;  2EL4 A;  1EH7 A;  2HGH A;  2DSY A;  4B3S E;  4JI1 E;  2YRM A;  2EN1 A;  4DR6 E;  4ZLX A;  5T6J A;  2RTX A;  1WHN A;  5IXM B;  2EOO A;  2HC5 A;  1YYO A;  2N8X A;  2LV2 A;  4DV4 E;  2EMW A;  2LTS A;  4HKK B;  2YWQ A;  5KL3 A;  2EPP A;  4LF5 E;  2YU5 A;  4L2F C;  1WHQ A;  1X6F A;  3ADG A;  3MSW A;  3C6M A;  4L2K C;  1WJP A;  1SFE A;  4X66 E;  2VQF E;  5KL5 A;  2V86 A;  2DIX A;  2UUA E;  2MKN A;  3HTX A;  2JYA A;  5TSE A;  1DGC A;  1L4S A;  2V85 A;  3IWB A;  2KOU A;  2EPM X;  5ADT B;  1ZBT A;  2EOR A;  3RMP A;  4JI3 E;  1STU A;  2EPA A;  4NXM E;  3KH2 E;  4ZYH A;  4DV3 E;  4JI6 E;  2Q8U A;  5LL6 R;  2VQE E;  3LLH A;  2YTQ A;  4JV5 E;  2EOQ A;  1SR9 A;  3ADJ A;  2WCC 3;  2YTE A;  3J81 C;  1T38 A;  4DV1 E;  1B69 A;  2EOS A;  2EL6 A;  2ENA A;  3EPL A;  2RPC A;  2E72 A;  2EMK A;  1HNW E;  1XMO E;  4LF6 E;  2EM0 A;  1N32 E;  5C5R C;  3VK6 A;  2VF1 A;  5BR8 E;  5A6B A;  3EPJ A;  4BC7 A;  3JAM C;  2MC6 A;  1A1I A;  4YY3 E;  5LLQ A;  4KZL C;  1ZBQ A;  1GZ6 A;  2BBG A;  4KWY A;  1T4N A;  2LJH A;  4WXD A;  2EMB A;  3HS2 A;  4R03 A;  1YZ9 A;  2NAB A;  2EM8 A;  2JOX A;  2EOZ A;  2EMI A;  2EMY A;  2DMY A;  2EN4 A;  1YSA C;  3CTO A;  2LVH A;  2EMH A;  3ADI A;  1PKP A;  4N4R B;  2GPI A;  2L8T A;  5LMU E;  1F2I G;  3G5O A;  2EPN A;  5ADS B;  4R2E A;  1JK2 A;  2ZIX B;  2YTO A;  1T4L B;  1NCS A;  2EN8 A;  2WBU A;  2LCE A;  2EOJ A;  5KL2 A;  3BGH A;  2EPL X;  5LMN E;  1AAY A;  5ADQ B;  4R2R A;  2EOY A;  4R2P A;  2YU8 A;  5A69 A;  4HLK C;  1UBD C;  1TN9 A;  1T4O A;  5A6J A;  2EOH A;  4R2S A;  3T1Y E;  2K7I A;  1PDA A;  2A6Q A;  4L32 C;  2V83 A;  4LFA E;  4AQY E;  4X9J A;  1KJK A;  4L0S C;  1IBK E;  3IWD A;  5C5P C;  2FTX B;  3ZOQ B;  4WSP A;  4OOG C;  2YSO A;  2EM6 A;  5AE2 A;  2EJ4 A;  3HXL A;  4L5N C;  1ZAA C;  2FV4 B;  4ZM0 A;  3MHS C;  4O24 A;  1UN6 B;  2YTP A;  2M7Q A;  4B3T E;  3TQM A;  2YTI A;  1IQS A;  2LRS A;  3EPH A;  4DR7 E;  2LBS B;  5ADR B;  2HHH E;  4LFB E;  1GTK A;  2PRT A;  4L0T C;  1X6H A;  4UVP B;  2YZT A;  3DF6 A;  1I94 E;  4M2Z A;  3DJW A;  4DR4 E;  5AC5 A;  2YTD A;  2EMF A;  5ADZ A;  4M9V C;  2L6M A;  1T39 A;  2YRK A;  4O43 A;  3M99 B;  2BB8 A;  4HEI A;  2MDR A;  1A1F A;  4JI5 E;  2EPO A;  4F6N A;  4J8Z A;  4GZN C;  1X3C A;  2EOX A;  1YUI A;  4IJD A;  4IS1 C;  4DR1 E;  2DRP A;  2LMZ A;  2EOF A;  3FIG A;  2EM5 A;  4HLF C;  3L00 A;  5IV8 B;  1MEY C;  4B3M E;  2EP3 A;  2VRD A;  2B9D A;  2UXD E;  5AE1 A;  4P7D A;  2M4I A;  3LML A;  3THN A;  2YSP A;  3BBG A;  4JI7 E;  5A6K A;  4YHH E;  2F4V E;  4R2D A;  3IWC A;  5FLX C;  2RSM A;  4HLG C;  1DQ3 A;  4BC9 A;  3J80 C;  2F8B A;  2EQ3 A;  4UI8 C;  2R1F A;  4NZV A;  1AH5 A;  1YYW A;  1Z1B A;  1KYQ A;  5CFF E;  1TF3 A;  1J26 A;  3BID A;  5A6A A;  1MGT A;  4L8N A;  1GQE A;  4R2Q A;  2CTD A;  3OTO E;  1G2F C;  2EM9 A;  4UI5 C;  2E1M A;  2DB2 A;  4M0V A;  4F2J C;  3OEI E;  4FK5 C;  1IBL E;  1IQO A;  4GKJ E;  1N33 E;  3T1H E;  1A1K A;  1XNR E;  2EQ0 A;  5AE3 A;  1YFH A;  4DUY E;  2FGG A;  1EH6 A;  4WXC A;  2JXP A;  3H09 A;  1HNX E;  3F6H A;  2EE8 A;  4KZU C;  4WYQ B;  1A1J A;  2CPN A;  4RH8 A;  4L10 C;  2NA2 A;  1UHZ A;  4DV0 E;  4L33 C;  4ZYE A;  4JI2 E;  3C4B A;  1PJT A;  2EMX A;  2B7T A;  4WPY A;  1PJS A;  2EPR A;  4KZQ C;  1A1G A;  3KWR A;  4F9C B;  2UUB E;  4WX9 A;  4RHB B;  1TF6 A;  3K33 B;  2RSI A;  4LF8 E;  1BBG A;  2HJJ A;  4L0I C;  2MC5 A;  4X65 E;  2V89 A;  4DR2 E;  2CT1 A;  2JY9 A;  2K4V A;  2MDG A;  4JYA E;  2YTJ A;  2DLQ A;  2ELY A;  4GKK E;  2EM3 A;  3VHT B;  3HPS A;  4HKI C;  1QU6 A;  2UU9 E;  2VE7 C;  2LJU A;  5FPF C;  2ENH A;  4BHC A;  2EWL A;  3P1X A;  2V87 A;  4X62 E;  2E5L E;  2JPA A;  2EM7 A;  4O4K A;  1X49 A;  2A25 A;  1RMD A;  4BS9 A;  4DV5 E;  1A1L A;  3UK3 C;  3C4T A;  2EN6 A;  2ZM6 E;  2LUQ A;  2EPZ A;  3OML A;  5IT9 C;  2ODK A;  4X8W A;  1X5W A;  2EMC A;  4JI4 E;  2L3J A;  1YUJ A;  4DV6 E;  4LTY A;  3HPZ A;  4M30 A;  4ZM2 A;  4NXN E;  5KL4 A;  1X6E A;  2EMA A;  2L92 A;  1FJG E;  2L2N A;  3OEI A;  2KHX A;  3F6G A;  2DGC A;  1DI2 A;  2RQL A;  1UIL A;  1WXR A;  3K6Q A;  5A6B D;  3THO B;  4MLV A;  4P78 A;  3HQ1 A;  4HMH C;  3AUZ A;  2EPC A;  2B3T B;  1JK1 A;  4L0V C;  2L2K B;  2MKD A;  4Q35 B;  2EQ1 A;  5KL7 A;  2EPX A;  2WBS A;  4R8O A;  2DLK A;  2YT4 A;  4TUG A;  2EM2 A;  2YPN A;  3D55 A;  4UI4 C;  3J7Y p;  2M1S A;  4L34 C;  2EN2 A;  2EPU A;  2YTG A;  4B3R E;  4LF7 E;  4DMI A;  2UXB E;  2EM4 A;  4DKK A;  2M9A A;  4BCA A;  1A1H A;  2ELZ A;  4UI3 C;  4UI6 C;  3HJ6 A;  4BMJ A;  4OX9 E;  4HLH C;  2JOB A;  4I8O A;  1O0W A;  2V88 A;  4K0K E;  4HTG A;  4HLM C;  4NHR A;  5C5Q C;  5F3W A;  3BF2 A;  5DNY A;  2WZO A;  1LLM C;  2YTN A;  2RS7 A;  3ADL A;  4HKN C;  2LO3 A;  1IMU A;  2EMG A;  1RQ0 A;  4LF9 E;  4X64 E;  4DR5 E;  2EN3 A;  2JVA A;  2YRH A;  2V8Q B;  3C6K A;  3EQ1 A;  4Q28 A;  4F9B B;  1IBM E;  2LE2 A;  1XNQ E;  5AC4 A;  1X48 A;  4F9A B;  1BB8 A;  2CSH A;  2NUE A;  1WRJ A;  2G7H A;  4TUI A;  2JR1 A;  2J7J A;  1EKZ A;  2GHF A;  4R2C A;  2UUC E;  5A2Q C;  5AAS A;  2WBT A;  2NUF A;  2RS6 A;  1G2D C;  4MLQ A;  2LT7 A;  2R76 A;  3MHH C;  2IHR 1;  2B7V A;  3EPK A;  1ZR9 A;  4BBY A;  2ODR C;  4L2G C; 
#chains in the Genus database with same CATH homology
 3DF6 A;  1I94 E;  4DV3 E;  4M2Z A;  2H36 X;  4JI6 E;  3DJW A;  5LL6 R;  4DR4 E;  2N3H A;  2EWL A;  1XMQ E;  5ADZ A;  1N34 E;  3P1X A;  2L6M A;  2VQE E;  3LLH A;  2V87 A;  4X62 E;  2EZ6 A;  2E5L E;  1FKA E;  1HNZ E;  4JV5 E;  2MDR A;  1SR9 A;  1X49 A;  3ADJ A;  1HR0 E;  4JI5 E;  4BS9 A;  4DV5 E;  3J81 C;  2L3C A;  3C4T A;  4J8Z A;  4DV1 E;  3JU0 A;  1RC7 A;  4KHP E;  2N3G A;  2LUQ A;  2ZM6 E;  3OML A;  4LFC E;  5IT9 C;  2ODK A;  4X8W A;  4JI8 E;  4F54 A;  4JI0 E;  1HNW E;  4JI4 E;  2ODR D;  3JTZ A;  4DR1 E;  2L3J A;  1XMO E;  4LF6 E;  2UXC E;  2LMZ A;  3FIG A;  3VK6 A;  2VF1 A;  2JWO A;  5BR8 E;  4DV6 E;  1N32 E;  4LTY A;  3HPZ A;  5IWA E;  4BC7 A;  4M30 A;  4ZM2 A;  3JAM C;  4NXN E;  2MC6 A;  1FJG E;  2L92 A;  4YY3 E;  4B3M E;  2L2N A;  1ZBQ A;  4WFT A;  2KHX A;  3F6G A;  1DI2 A;  3OEI A;  1GZ6 A;  3VYY A;  4DV7 E;  1UIL A;  1WXR A;  2B9D A;  1T4N A;  4GEQ B;  3K6Q A;  5AE1 A;  2LJH A;  2UXD E;  3HS2 A;  4P7D A;  4R03 A;  2M4I A;  3LML A;  1YZ9 A;  3HRY A;  4P78 A;  3HQ1 A;  2JOX A;  4DR3 E;  4JI7 E;  3AUZ A;  2LTR A;  4YHH E;  2B3T B;  2F4V E;  3IWC A;  5FLX C;  2RSM A;  2L2K B;  4DV2 E;  2NUG A;  1DQ3 A;  4BC9 A;  3J80 C;  2F8B A;  2DMY A;  2L2M A;  4R8O A;  1YYK A;  3CTO A;  2L33 A;  2YT4 A;  4LU9 A;  4TUG A;  5CFF E;  1YYW A;  3D55 A;  1J26 A;  3ADI A;  3J7Y p;  1PKP A;  2M1S A;  5LMU E;  2L8T A;  4DUZ E;  2LUP B;  3G5O A;  4KZS A;  4L8N A;  4B3R E;  1GQE A;  4LF7 E;  3VYX A;  3KH2 E;  1J5E E;  4DMI A;  3OTO E;  1T4L B;  2UXB E;  2E1M A;  4DKK A;  2DB2 A;  4M0V A;  3OEI E;  4BCA A;  4LF4 E;  3J7A G;  1IBL E;  4GKJ E;  2KON A;  1N33 E;  1N36 E;  3T1H E;  5LMN E;  4BBY A;  1XNR E;  1X47 A;  4BMJ A;  5AE3 A;  4OX9 E;  3AV0 A;  2JOB A;  4DUY E;  2DSY A;  2FGG A;  4I8O A;  1O0W A;  2V88 A;  4B3S E;  4JI1 E;  4K0K E;  5F3W A;  4DR6 E;  4ZLX A;  3H09 A;  5T6J A;  2RTX A;  1WHN A;  1HNX E;  3F6H A;  1T4O A;  5DNY A;  2WZO A;  4WYQ B;  2CPN A;  3T1Y E;  1YYO A;  2RS7 A;  2NA2 A;  3ADL A;  1UHZ A;  4DV0 E;  2A6Q A;  1RQ0 A;  4LF9 E;  4DV4 E;  2V83 A;  2LTS A;  4JI2 E;  3C4B A;  4LFA E;  4AQY E;  4LF5 E;  2B7T A;  4WPY A;  4X64 E;  2JVA A;  4DR5 E;  1WHQ A;  2V8Q B;  4F9B B;  4Q28 A;  1IBK E;  3IWD A;  3KWR A;  4F9C B;  3ADG A;  2FTX B;  2LE2 A;  3ZOQ B;  4WSP A;  4OOG C;  1IBM E;  2UUB E;  1XNQ E;  3MSW A;  5AE2 A;  3K33 B;  1X48 A;  3HXL A;  4F9A B;  4X66 E;  4LF8 E;  4NXM E;  2VQF E;  2NUE A;  2G7H A;  2V86 A;  4L5N C;  2DIX A;  2MC5 A;  4X65 E;  4TUI A;  2FV4 B;  2UUA E;  2JR1 A;  1EKZ A;  4ZM0 A;  2V89 A;  3HTX A;  4B3T E;  2M7Q A;  2UUC E;  4DR2 E;  5A2Q C;  2V85 A;  5AAS A;  2NUF A;  2JY9 A;  3IWB A;  2K4V A;  2KOU A;  2LRS A;  4JYA E;  4DR7 E;  4GKK E;  2RS6 A;  2LBS B;  3HPS A;  2HHH E;  1ZBT A;  2IHR 1;  3RMP A;  4JI3 E;  4LFB E;  1STU A;  1QU6 A;  2B7V A;  2UU9 E;  2VE7 C;  2ODR C;  2YZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...