3K6QA

Crystal structure of an antitoxin part of a putative toxin/antitoxin system (swol_0700) from syntrophomonas wolfei subsp. wolfei at 1.80 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
139
structure length
139
Chain Sequence
GMQTINATEIRNNFSYYIDTVVRDKPIAVKRNRDVLLFFSEQIIKDLLQDLKIHAELSKEDGIIIGTIDGFDLVVSGESEQEVIQKLAEDLLEYAQDYMNDFKLFYNAPNRKTHYPYILKVLLSSNIDEVKGYIYAEMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative ligand binding protein (YP_753395.1) from Syntrophomonas wolfei str. Goettingen at 1.80 A resolution
rcsb
source organism Syntrophomonas wolfei subsp. wolfei
molecule tags Ligand binding protein
molecule keywords Putative ligand binding protein
total genus 40
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12910 PHD_like Antitoxin of toxin-antitoxin, RelE / RelB, TA system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.620 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3k6qA02
3.40.1620.10 Alpha Beta 3-Layer(aba) Sandwich YefM-like fold YefM-like domain 3k6qA01
2A6QA 4ZM0A 3OEIA 4ZM2A 3CTOA 2ODKA 3OEIE 3HS2A 3K6QA 3HRYA 3K33B 3KH2E 3D55A 3G5OA 4ZLXA
chains in the Genus database with same CATH superfamily
1YSAC 4KZSA 1QU6A 2EPRA 4R2RA 5KL7A 2EPLX 1WHQA 4HLKC 3THNA 1IQOA 4LF7E 4LFAE 3MHHC 2N8XA 4R2CA 4J8ZA 2DGCA 3HS2A 4WPYA 4L34C 3C6MA 2LMZA 1YYWA 3IWCA 2ENAA 3ADJA 2KOUA 2YRMA 2WBUA 3HPSA 1DGCA 2EMGA 1X6EA 2M1SA 3KWRA 5A6BA 5DNYA 1NEIA 2UUAE 4R2SA 2RSMA 2LE2A 2BBGA 3HXLA 3JTZA 4NZVA 2EP3A 2ELZA 2JY9A 4BC9A 4DMIA 5AC5A 2LTRA 2YZTA 5A69A 1WJPA 2D9HA 2N3GA 5IXMB 2LV2A 1QNTA 3ECRA 3VYXA 2LT7A 4YHHE 4AQYE 1T39A 4L32C 1IMUA 1EH6A 2EMHA 3OTOE 4WFTA 2JPAA 2EN2A 1PJQA 2EE8A 4BHCA 3ADIA 2EN7A 5C5QC 2V83A 1Z1BA 4R2EA 2MC6A 2EPOA 4LU9A 4M9VC 1O0WA 1A1FA 2JVAA 5AASA 1FJGE 1T4OA 4HMHC 2NUFA 1WHNA 3H09A 4X62E 5CFFE 3UK3C 2JOBA 2UUBE 4L2FC 2EOZA 4O4KA 1IBME 3ADLA 2PRTA 4O43A 2V86A 2EOIA 1X48A 2I9IA 4NHRA 5KL6A 4UI6C 2EL5A 3BIDA 2L33A 2R76A 4B3TE 2RPCA 1NCSA 4L0VC 2V87A 1JK2A 1YFHA 4B3ME 1GZ6A 2EOSA 4JYAE 4JI8E 2EQ1A 3K33B 2B3TB 4L8NA 4OX9E 1GTKA 4DV4E 2EMZA 5IT9C 4ZM0A 1XMOE 2ENHA 1YYOA 1FKAE 4HLHC 2EPAA 1X3CA 1RQ0A 5TSEA 2YSOA 1P47A 3VHTB 4DV0E 5AC4A 5KL2A 1ZBQA 4DV1E 2CTDA 2EN8A 2LCEA 3TQMA 1A1LA 2B7TA 2UXBE 4LFCE 2EORA 2EOHA 4X64E 3BBGA 3LMLA 2EMKA 4HLMC 4WXCA 2GPIA 2YTPA 5LMUE 5T6JA 2LJUA 4F54A 2EMCA 3L00A 4DR1E 2L8TA 3EPKA 2MKDA 2K4VA 1N32E 2JXPA 4ZYHA 2EOOA 4I8OA 4WXDA 4DR2E 2V88A 2L2NA 2EMWA 2L3JA 2VRDA 4X65E 3OEIE 3J81C 2EPZA 3C4TA 2WCC3 4DV3E 1PDAA 4JI3E 2YRKA 2EMFA 2YRHA 1A1HA 1YUJA 1ZR9A 5AE3A 4HLFC 4M30A 3DF6A 2F8BA 2EOQA 5A6AA 4HLGC 3ADGA 2ZIXB 2EM5A 3HRYA 5A6BD 4WX9A 2JP9A 1X47A 2EPXA 4F9AB 4BCAA 4TUIA 3HTXA 1A1KA 1KYQA 1TN9A 3HPZA 2E5LE 1XMQE 4DR3E 2EOJA 5FLXC 3J7AG 1MGTA 1ZBTA 4DV2E 1MEYC 1KJKA 4BBYA 1HNWE 2EM9A 3C6KA 3D55A 2L3CA 5F3WA 1AH5A 2EMIA 2YWQA 1N3GA 4B3RE 3RMPA 4L0IC 2LRSA 2HJJA 1UN6B 2YU5A 2EQ0A 2EN6A 2EM4A 2YT4A 4LF4E 2EL6A 4KHPE 1IBKE 3T1YE 4JI4E 2EM2A 4GZNC 1XNQE 4R2PA 4WSPA 2EM6A 4UI7C 1PKPA 2EM0A 1ZAAC 4N4RB 4F6NA 4M2ZA 2FTXB 1A1JA 2JR1A 5A6KA 4KZQC 4UVPB 2EM8A 2HHHE 1J26A 5ADQB 2NABA 4R2AA 4TUGA 2MC5A 1WXRA 4DV6E 2EWLA 2DB2A 4L10C 2YSPA 2MKNA 2YTIA 2YU8A 4NXNE 4BC7A 2ODKA 1BBOA 1EKZA 4K0KE 2J7JA 4WYQB 2NUEA 4L0TC 2R1FA 1G2FC 1A1IA 4BMJA 3AUZA 3FIGA 3KZYA 4L0SC 3BGHA 1YUIA 4DR5E 1T4LB 4R03A 1EH8A 2RSIA 2GLIA 1G2DC 2B7VA 1HR0E 2DLQA 3F6HA 2HGHA 2WBSA 3M99B 2HC5A 4L33C 1A1GA 4JI1E 2NUGA 1X6FA 2EM7A 4R2QA 2JYAA 4JI6E 2ODRC 3HQ1A 2EPMX 2LUPB 3VYYA 2UUCE 3QG5C 5KL4A 2EPUA 4LTYA 4L09C 3HJ6A 1SR9A 2LUQA 3LLHA 2EPNA 2YTJA 3P1XA 5FPFC 5ADRB 2LBSB 2GHFA 2EOYA 4DR4E 4L2KC 2A25A 2RTXA 2EMYA 2DMIA 2H36X 4O24A 3ZOQB 2DSYA 2YPNA 2ELYA 2EMXA 4P78A 2CPNA 4GEQB 2UXDE 4UI5C 2DRPA 4ZYEA 4LF9E 2L6MA 4FK5C 2DIXA 2CT1A 2VF1A 5KL3A 2YTOA 2ENCA 2L92A 4IJDA 4WSGA 1DQ3A 4DUZE 2EMAA 1X5WA 1BBGA 1SFEA 2EL4A 5IV8B 3KH2E 3J80C 2M9AA 1T4NA 4R8OA 5BR8E 4B3SE 5AE1A 4R2DA 1PJSA 4ZYDA 1DI2A 2FV4B 1UHZA 2EN1A 2VQFE 5A6JA 4F9CB 3EPHA 1J5EE 2FGGA 4ZYGA 2V8QB 2ODRD 1HNZE 1JK1A 2WBTA 1T38A 4M0VA 2M7QA 2JOXA 2KHXA 5LLQA 4HEIA 2EN4A 4UI4C 2EPKX 2EOFA 2YTDA 4DV5E 2DMYA 4JI7E 2MDGA 1YYKA 1B69A 5ADZA 1UILA 4KWYA 4DV7E 4F2JC 5C5RC 4KZUC 4UI8C 3IWBA 3IWDA 1AAYA 2YTFA 2MDRA 3C4BA 2LTSA 1IBLE 4NXME 3OMLA 4F6MA 2BB8A 2M4IA 2EJ4A 2LVHA 1WRJA 4X66E 2RQLA 2K7IA 2F4VE 2LJHA 3F6GA 2EOXA 3BF2A 4Q35B 2Q8UA 2JWOA 2V89A 2RS7A 2VE7C 2VQEE 1F2IG 4MLVA 1HNXE 4X8WA 2EOEA 4L2GC 1L4SA 5LL6R 4JV5E 4GKKE 4MLQA 3MHSC 4JI5E 1TF3A 3KZZA 5AE2A 1STUA 4JI0E 2KONA 1GQEA 4X9JA 5ADTB 4ZM2A 4LFBE 3MSWA 3DJWA 2YTEA 2EZ6A 1ZU1A 1LLMC 2L2KB 4GKJE 2G7HA 1EH7A 4KZLC 3EPJA 3EPLA 2RS6A 2UU9E 1UBDC 1PJTA 2N3HA 4HKKB 2EPPA 3EQ1A 4LF5E 3J7Yp 4DR7E 4ZLXA 2YTNA 2DLKA 4DKKA 5ADSB 4DUYE 1N34E 4L5NC 4OOGC 2NA2A 1BB8A 5LMNE 5IWAE 3JAMC 1IQSA 4Q28A 3OEIA 2EN3A 1YPNA 4UI3C 4HKIC 4HKNC 2EQ3A 2YTQA 3T1HE 3VK6A 4YY3E 4LF6E 2YTGA 1TF6A 3CTOA 2CSHA 4F9BB 2EMLA 3AV0A 1I94E 2LO3A 4O5GA 2UXCE 4RH8A 4BHBA 4JI2E 4BS9A 2A6QA 2EMBA 2E1MA 5A2QC 1XNRE 1YZ9A 1X49A 1RC7A 2EM3A 2ZM6E 4LF8E 2E72A 4HTGA 2L2MA 1RMDA 1N36E 4IS1C 2V85A 4P7DA 4L0BC 4HL5C 3THOB 3JU0A 5KL5A 2WZOA 2ADRA 2B9DA 4DR6E 5C5PC 2EOMA 4RHBB 4L31C 2EPCA 1N33E 1X6HA 2IHR1 2I13A 3K6QA 3G5OA
chains in the Genus database with same CATH topology
4KZSA 3C4BA 1QU6A 2LTSA 5LMUE 1IBLE 4NXME 5T6JA 4F54A 4NXNE 4BC7A 1WHQA 2ODKA 3OMLA 4DR1E 1EKZA 4K0KE 2L8TA 1N32E 2K4VA 4LF7E 4WYQB 4LFAE 2NUEA 2M4IA 4J8ZA 4I8OA 4DR2E 3K33B 2V88A 2L2NA 2UXDE 2L3JA 3HS2A 4BMJA 4X65E 3AUZA 3FIGA 3J81C 4X66E 4WPYA 4DR5E 1T4LB 2F4VE 4R03A 3C4TA 2LJHA 2LMZA 3F6GA 1YYWA 3IWCA 4DV3E 2JWOA 2B7VA 4JI3E 2V89A 2RS7A 3ADJA 1HR0E 2VE7C 3F6HA 2VQEE 1HNXE 5AE3A 2KOUA 4X8WA 4M30A 5LL6R 3DF6A 2F8BA 4GKKE 4JV5E 4JI1E 3HPSA 2NUGA 2M1SA 3KWRA 5DNYA 4JI5E 3ADGA 2ODRC 2UUAE 4JI6E 3OEIE 2RSMA 1STUA 5AE2A 4JI0E 3HRYA 2LE2A 2KONA 3HQ1A 1GQEA 3HXLA 3VYYA 3JTZA 2LUPB 2UUCE 4BC9A 2JY9A 4DMIA 4LTYA 4ZM2A 2LTRA 2YZTA 4LFBE 3LMLA 1X47A 3MSWA 2N3GA 3DJWA 4F9AB 2EZ6A 1SR9A 2LUQA 3LLHA 3VYXA 2L2KB 3P1XA 4YHHE 4GKJE 4BCAA 2G7HA 4TUIA 4AQYE 3HTXA 2LBSB 2RS6A 2UU9E 3OTOE 4DR4E 4WFTA 3HPZA 2N3HA 2RTXA 1XMQE 2E5LE 4DR3E 2H36X 3ADIA 5FLXC 4LF5E 3ZOQB 3J7Yp 3J7AG 4DR7E 4ZLXA 2V83A 2DSYA 1ZBTA 4DV2E 4P78A 2MC6A 2CPNA 4DKKA 4LU9A 1O0WA 4GEQB 4DUYE 1N34E 2JVAA 4BBYA 4L5NC 4OOGC 1T4OA 5AASA 2NA2A 2NUFA 1WHNA 3H09A 4X62E 1FJGE 5LMNE 1HNWE 5CFFE 4LF9E 3D55A 2L6MA 5IWAE 2JOBA 3JAMC 2DIXA 2L3CA 2UUBE 4Q28A 2VF1A 3G5OA 3OEIA 5F3WA 1IBME 3ADLA 2L92A 4B3RE 2V86A 3RMPA 3T1HE 1X48A 3VK6A 4YY3E 4LF6E 1DQ3A 2LRSA 4DUZE 3CTOA 4F9BB 3KH2E 2YT4A 3J80C 1T4NA 2L33A 4R8OA 5BR8E 4B3SE 4B3TE 3AV0A 5AE1A 4LF4E 1I94E 4KHPE 1IBKE 3T1YE 1DI2A 2FV4B 2V87A 4JI4E 2UXCE 1UHZA 2VQFE 4B3ME 4JI2E 4BS9A 1XNQE 1GZ6A 2A6QA 4F9CB 4JYAE 4WSPA 4JI8E 2E1MA 5A2QC 1XNRE 1YZ9A 1X49A 1RC7A 1J5EE 2FGGA 1PKPA 2B3TB 4L8NA 2V8QB 2ZM6E 4LF8E 4M2ZA 2ODRD 1HNZE 4OX9E 2FTXB 2L2MA 4DV4E 4M0VA 2M7QA 2JOXA 2V85A 4P7DA 2KHXA 1N36E 3JU0A 2WZOA 2B9DA 5IT9C 2JR1A 4DR6E 4ZM0A 4DV5E 2DMYA 1XMOE 1YYOA 1FKAE 4JI7E 1RQ0A 2HHHE 4DV0E 1N33E 1J26A 1YYKA 1ZBQA 4DV1E 5ADZA 2B7TA 1UILA 2UXBE 4LFCE 4DV7E 2IHR1 4TUGA 2MC5A 3K6QA 4X64E 3IWBA 1WXRA 3IWDA 4DV6E 2EWLA 2DB2A 2MDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6Q A;  4ZM0 A;  3OEI A;  4ZM2 A;  3CTO A;  2ODK A;  3OEI E;  3HS2 A;  3K6Q A;  3HRY A;  3K33 B;  3KH2 E;  3D55 A;  3G5O A;  4ZLX A; 
#chains in the Genus database with same CATH topology
 1YSA C;  4KZS A;  1QU6 A;  2EPR A;  4R2R A;  5KL7 A;  2EPL X;  1WHQ A;  4HLK C;  3THN A;  1IQO A;  4LF7 E;  4LFA E;  3MHH C;  2N8X A;  4R2C A;  4J8Z A;  2DGC A;  3HS2 A;  4WPY A;  4L34 C;  3C6M A;  2LMZ A;  1YYW A;  3IWC A;  2ENA A;  3ADJ A;  2KOU A;  2YRM A;  2WBU A;  3HPS A;  1DGC A;  2EMG A;  1X6E A;  2M1S A;  3KWR A;  5A6B A;  5DNY A;  1NEI A;  2UUA E;  4R2S A;  2RSM A;  2LE2 A;  2BBG A;  3HXL A;  3JTZ A;  4NZV A;  2EP3 A;  2ELZ A;  2JY9 A;  4BC9 A;  4DMI A;  5AC5 A;  2LTR A;  2YZT A;  5A69 A;  1WJP A;  2D9H A;  2N3G A;  5IXM B;  2LV2 A;  1QNT A;  3ECR A;  3VYX A;  2LT7 A;  4YHH E;  4AQY E;  1T39 A;  4L32 C;  1IMU A;  1EH6 A;  2EMH A;  3OTO E;  4WFT A;  2JPA A;  2EN2 A;  1PJQ A;  2EE8 A;  4BHC A;  3ADI A;  2EN7 A;  5C5Q C;  2V83 A;  1Z1B A;  4R2E A;  2MC6 A;  2EPO A;  4LU9 A;  4M9V C;  1O0W A;  1A1F A;  2JVA A;  5AAS A;  1FJG E;  1T4O A;  4HMH C;  2NUF A;  1WHN A;  3H09 A;  4X62 E;  5CFF E;  3UK3 C;  2JOB A;  2UUB E;  4L2F C;  2EOZ A;  4O4K A;  1IBM E;  3ADL A;  2PRT A;  4O43 A;  2V86 A;  2EOI A;  1X48 A;  2I9I A;  4NHR A;  5KL6 A;  4UI6 C;  2EL5 A;  3BID A;  2L33 A;  2R76 A;  4B3T E;  2RPC A;  1NCS A;  4L0V C;  2V87 A;  1JK2 A;  1YFH A;  4B3M E;  1GZ6 A;  2EOS A;  4JYA E;  4JI8 E;  2EQ1 A;  3K33 B;  2B3T B;  4L8N A;  4OX9 E;  1GTK A;  4DV4 E;  2EMZ A;  5IT9 C;  4ZM0 A;  1XMO E;  2ENH A;  1YYO A;  1FKA E;  4HLH C;  2EPA A;  1X3C A;  1RQ0 A;  5TSE A;  2YSO A;  1P47 A;  3VHT B;  4DV0 E;  5AC4 A;  5KL2 A;  1ZBQ A;  4DV1 E;  2CTD A;  2EN8 A;  2LCE A;  3TQM A;  1A1L A;  2B7T A;  2UXB E;  4LFC E;  2EOR A;  2EOH A;  4X64 E;  3BBG A;  3LML A;  2EMK A;  4HLM C;  4WXC A;  2GPI A;  2YTP A;  5LMU E;  5T6J A;  2LJU A;  4F54 A;  2EMC A;  3L00 A;  4DR1 E;  2L8T A;  3EPK A;  2MKD A;  2K4V A;  1N32 E;  2JXP A;  4ZYH A;  2EOO A;  4I8O A;  4WXD A;  4DR2 E;  2V88 A;  2L2N A;  2EMW A;  2L3J A;  2VRD A;  4X65 E;  3OEI E;  3J81 C;  2EPZ A;  3C4T A;  2WCC 3;  4DV3 E;  1PDA A;  4JI3 E;  2YRK A;  2EMF A;  2YRH A;  1A1H A;  1YUJ A;  1ZR9 A;  5AE3 A;  4HLF C;  4M30 A;  3DF6 A;  2F8B A;  2EOQ A;  5A6A A;  4HLG C;  3ADG A;  2ZIX B;  2EM5 A;  3HRY A;  5A6B D;  4WX9 A;  2JP9 A;  1X47 A;  2EPX A;  4F9A B;  4BCA A;  4TUI A;  3HTX A;  1A1K A;  1KYQ A;  1TN9 A;  3HPZ A;  2E5L E;  1XMQ E;  4DR3 E;  2EOJ A;  5FLX C;  3J7A G;  1MGT A;  1ZBT A;  4DV2 E;  1MEY C;  1KJK A;  4BBY A;  1HNW E;  2EM9 A;  3C6K A;  3D55 A;  2L3C A;  5F3W A;  1AH5 A;  2EMI A;  2YWQ A;  1N3G A;  4B3R E;  3RMP A;  4L0I C;  2LRS A;  2HJJ A;  1UN6 B;  2YU5 A;  2EQ0 A;  2EN6 A;  2EM4 A;  2YT4 A;  4LF4 E;  2EL6 A;  4KHP E;  1IBK E;  3T1Y E;  4JI4 E;  2EM2 A;  4GZN C;  1XNQ E;  4R2P A;  4WSP A;  2EM6 A;  4UI7 C;  1PKP A;  2EM0 A;  1ZAA C;  4N4R B;  4F6N A;  4M2Z A;  2FTX B;  1A1J A;  2JR1 A;  5A6K A;  4KZQ C;  4UVP B;  2EM8 A;  2HHH E;  1J26 A;  5ADQ B;  2NAB A;  4R2A A;  4TUG A;  2MC5 A;  1WXR A;  4DV6 E;  2EWL A;  2DB2 A;  4L10 C;  2YSP A;  2MKN A;  2YTI A;  2YU8 A;  4NXN E;  4BC7 A;  2ODK A;  1BBO A;  1EKZ A;  4K0K E;  2J7J A;  4WYQ B;  2NUE A;  4L0T C;  2R1F A;  1G2F C;  1A1I A;  4BMJ A;  3AUZ A;  3FIG A;  3KZY A;  4L0S C;  3BGH A;  1YUI A;  4DR5 E;  1T4L B;  4R03 A;  1EH8 A;  2RSI A;  2GLI A;  1G2D C;  2B7V A;  1HR0 E;  2DLQ A;  3F6H A;  2HGH A;  2WBS A;  3M99 B;  2HC5 A;  4L33 C;  1A1G A;  4JI1 E;  2NUG A;  1X6F A;  2EM7 A;  4R2Q A;  2JYA A;  4JI6 E;  2ODR C;  3HQ1 A;  2EPM X;  2LUP B;  3VYY A;  2UUC E;  3QG5 C;  5KL4 A;  2EPU A;  4LTY A;  4L09 C;  3HJ6 A;  1SR9 A;  2LUQ A;  3LLH A;  2EPN A;  2YTJ A;  3P1X A;  5FPF C;  5ADR B;  2LBS B;  2GHF A;  2EOY A;  4DR4 E;  4L2K C;  2A25 A;  2RTX A;  2EMY A;  2DMI A;  2H36 X;  4O24 A;  3ZOQ B;  2DSY A;  2YPN A;  2ELY A;  2EMX A;  4P78 A;  2CPN A;  4GEQ B;  2UXD E;  4UI5 C;  2DRP A;  4ZYE A;  4LF9 E;  2L6M A;  4FK5 C;  2DIX A;  2CT1 A;  2VF1 A;  5KL3 A;  2YTO A;  2ENC A;  2L92 A;  4IJD A;  4WSG A;  1DQ3 A;  4DUZ E;  2EMA A;  1X5W A;  1BBG A;  1SFE A;  2EL4 A;  5IV8 B;  3KH2 E;  3J80 C;  2M9A A;  1T4N A;  4R8O A;  5BR8 E;  4B3S E;  5AE1 A;  4R2D A;  1PJS A;  4ZYD A;  1DI2 A;  2FV4 B;  1UHZ A;  2EN1 A;  2VQF E;  5A6J A;  4F9C B;  3EPH A;  1J5E E;  2FGG A;  4ZYG A;  2V8Q B;  2ODR D;  1HNZ E;  1JK1 A;  2WBT A;  1T38 A;  4M0V A;  2M7Q A;  2JOX A;  2KHX A;  5LLQ A;  4HEI A;  2EN4 A;  4UI4 C;  2EPK X;  2EOF A;  2YTD A;  4DV5 E;  2DMY A;  4JI7 E;  2MDG A;  1YYK A;  1B69 A;  5ADZ A;  1UIL A;  4KWY A;  4DV7 E;  4F2J C;  5C5R C;  4KZU C;  4UI8 C;  3IWB A;  3IWD A;  1AAY A;  2YTF A;  2MDR A;  3C4B A;  2LTS A;  1IBL E;  4NXM E;  3OML A;  4F6M A;  2BB8 A;  2M4I A;  2EJ4 A;  2LVH A;  1WRJ A;  4X66 E;  2RQL A;  2K7I A;  2F4V E;  2LJH A;  3F6G A;  2EOX A;  3BF2 A;  4Q35 B;  2Q8U A;  2JWO A;  2V89 A;  2RS7 A;  2VE7 C;  2VQE E;  1F2I G;  4MLV A;  1HNX E;  4X8W A;  2EOE A;  4L2G C;  1L4S A;  5LL6 R;  4JV5 E;  4GKK E;  4MLQ A;  3MHS C;  4JI5 E;  1TF3 A;  3KZZ A;  5AE2 A;  1STU A;  4JI0 E;  2KON A;  1GQE A;  4X9J A;  5ADT B;  4ZM2 A;  4LFB E;  3MSW A;  3DJW A;  2YTE A;  2EZ6 A;  1ZU1 A;  1LLM C;  2L2K B;  4GKJ E;  2G7H A;  1EH7 A;  4KZL C;  3EPJ A;  3EPL A;  2RS6 A;  2UU9 E;  1UBD C;  1PJT A;  2N3H A;  4HKK B;  2EPP A;  3EQ1 A;  4LF5 E;  3J7Y p;  4DR7 E;  4ZLX A;  2YTN A;  2DLK A;  4DKK A;  5ADS B;  4DUY E;  1N34 E;  4L5N C;  4OOG C;  2NA2 A;  1BB8 A;  5LMN E;  5IWA E;  3JAM C;  1IQS A;  4Q28 A;  3OEI A;  2EN3 A;  1YPN A;  4UI3 C;  4HKI C;  4HKN C;  2EQ3 A;  2YTQ A;  3T1H E;  3VK6 A;  4YY3 E;  4LF6 E;  2YTG A;  1TF6 A;  3CTO A;  2CSH A;  4F9B B;  2EML A;  3AV0 A;  1I94 E;  2LO3 A;  4O5G A;  2UXC E;  4RH8 A;  4BHB A;  4JI2 E;  4BS9 A;  2A6Q A;  2EMB A;  2E1M A;  5A2Q C;  1XNR E;  1YZ9 A;  1X49 A;  1RC7 A;  2EM3 A;  2ZM6 E;  4LF8 E;  2E72 A;  4HTG A;  2L2M A;  1RMD A;  1N36 E;  4IS1 C;  2V85 A;  4P7D A;  4L0B C;  4HL5 C;  3THO B;  3JU0 A;  5KL5 A;  2WZO A;  2ADR A;  2B9D A;  4DR6 E;  5C5P C;  2EOM A;  4RHB B;  4L31 C;  2EPC A;  1N33 E;  1X6H A;  2IHR 1;  2I13 A;  3K6Q A;  3G5O A; 
#chains in the Genus database with same CATH homology
 4KZS A;  3C4B A;  1QU6 A;  2LTS A;  5LMU E;  1IBL E;  4NXM E;  5T6J A;  4F54 A;  4NXN E;  4BC7 A;  1WHQ A;  2ODK A;  3OML A;  4DR1 E;  1EKZ A;  4K0K E;  2L8T A;  1N32 E;  2K4V A;  4LF7 E;  4WYQ B;  4LFA E;  2NUE A;  2M4I A;  4J8Z A;  4I8O A;  4DR2 E;  3K33 B;  2V88 A;  2L2N A;  2UXD E;  2L3J A;  3HS2 A;  4BMJ A;  4X65 E;  3AUZ A;  3FIG A;  3J81 C;  4X66 E;  4WPY A;  4DR5 E;  1T4L B;  2F4V E;  4R03 A;  3C4T A;  2LJH A;  2LMZ A;  3F6G A;  1YYW A;  3IWC A;  4DV3 E;  2JWO A;  2B7V A;  4JI3 E;  2V89 A;  2RS7 A;  3ADJ A;  1HR0 E;  2VE7 C;  3F6H A;  2VQE E;  1HNX E;  5AE3 A;  2KOU A;  4X8W A;  4M30 A;  5LL6 R;  3DF6 A;  2F8B A;  4GKK E;  4JV5 E;  4JI1 E;  3HPS A;  2NUG A;  2M1S A;  3KWR A;  5DNY A;  4JI5 E;  3ADG A;  2ODR C;  2UUA E;  4JI6 E;  3OEI E;  2RSM A;  1STU A;  5AE2 A;  4JI0 E;  3HRY A;  2LE2 A;  2KON A;  3HQ1 A;  1GQE A;  3HXL A;  3VYY A;  3JTZ A;  2LUP B;  2UUC E;  4BC9 A;  2JY9 A;  4DMI A;  4LTY A;  4ZM2 A;  2LTR A;  2YZT A;  4LFB E;  3LML A;  1X47 A;  3MSW A;  2N3G A;  3DJW A;  4F9A B;  2EZ6 A;  1SR9 A;  2LUQ A;  3LLH A;  3VYX A;  2L2K B;  3P1X A;  4YHH E;  4GKJ E;  4BCA A;  2G7H A;  4TUI A;  4AQY E;  3HTX A;  2LBS B;  2RS6 A;  2UU9 E;  3OTO E;  4DR4 E;  4WFT A;  3HPZ A;  2N3H A;  2RTX A;  1XMQ E;  2E5L E;  4DR3 E;  2H36 X;  3ADI A;  5FLX C;  4LF5 E;  3ZOQ B;  3J7Y p;  3J7A G;  4DR7 E;  4ZLX A;  2V83 A;  2DSY A;  1ZBT A;  4DV2 E;  4P78 A;  2MC6 A;  2CPN A;  4DKK A;  4LU9 A;  1O0W A;  4GEQ B;  4DUY E;  1N34 E;  2JVA A;  4BBY A;  4L5N C;  4OOG C;  1T4O A;  5AAS A;  2NA2 A;  2NUF A;  1WHN A;  3H09 A;  4X62 E;  1FJG E;  5LMN E;  1HNW E;  5CFF E;  4LF9 E;  3D55 A;  2L6M A;  5IWA E;  2JOB A;  3JAM C;  2DIX A;  2L3C A;  2UUB E;  4Q28 A;  2VF1 A;  3G5O A;  3OEI A;  5F3W A;  1IBM E;  3ADL A;  2L92 A;  4B3R E;  2V86 A;  3RMP A;  3T1H E;  1X48 A;  3VK6 A;  4YY3 E;  4LF6 E;  1DQ3 A;  2LRS A;  4DUZ E;  3CTO A;  4F9B B;  3KH2 E;  2YT4 A;  3J80 C;  1T4N A;  2L33 A;  4R8O A;  5BR8 E;  4B3S E;  4B3T E;  3AV0 A;  5AE1 A;  4LF4 E;  1I94 E;  4KHP E;  1IBK E;  3T1Y E;  1DI2 A;  2FV4 B;  2V87 A;  4JI4 E;  2UXC E;  1UHZ A;  2VQF E;  4B3M E;  4JI2 E;  4BS9 A;  1XNQ E;  1GZ6 A;  2A6Q A;  4F9C B;  4JYA E;  4WSP A;  4JI8 E;  2E1M A;  5A2Q C;  1XNR E;  1YZ9 A;  1X49 A;  1RC7 A;  1J5E E;  2FGG A;  1PKP A;  2B3T B;  4L8N A;  2V8Q B;  2ZM6 E;  4LF8 E;  4M2Z A;  2ODR D;  1HNZ E;  4OX9 E;  2FTX B;  2L2M A;  4DV4 E;  4M0V A;  2M7Q A;  2JOX A;  2V85 A;  4P7D A;  2KHX A;  1N36 E;  3JU0 A;  2WZO A;  2B9D A;  5IT9 C;  2JR1 A;  4DR6 E;  4ZM0 A;  4DV5 E;  2DMY A;  1XMO E;  1YYO A;  1FKA E;  4JI7 E;  1RQ0 A;  2HHH E;  4DV0 E;  1N33 E;  1J26 A;  1YYK A;  1ZBQ A;  4DV1 E;  5ADZ A;  2B7T A;  1UIL A;  2UXB E;  4LFC E;  4DV7 E;  2IHR 1;  4TUG A;  2MC5 A;  3K6Q A;  4X64 E;  3IWB A;  1WXR A;  3IWD A;  4DV6 E;  2EWL A;  2DB2 A;  2MDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...