3K6QA

Crystal structure of an antitoxin part of a putative toxin/antitoxin system (swol_0700) from syntrophomonas wolfei subsp. wolfei at 1.80 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
139
structure length
139
Chain Sequence
GMQTINATEIRNNFSYYIDTVVRDKPIAVKRNRDVLLFFSEQIIKDLLQDLKIHAELSKEDGIIIGTIDGFDLVVSGESEQEVIQKLAEDLLEYAQDYMNDFKLFYNAPNRKTHYPYILKVLLSSNIDEVKGYIYAEMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ligand binding protein
publication title Crystal structure of Putative ligand binding protein (YP_753395.1) from Syntrophomonas wolfei str. Goettingen at 1.80 A resolution
rcsb
source organism Syntrophomonas wolfei subsp. wolfei
molecule tags Ligand binding protein
total genus 40
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12910 PHD_like Antitoxin of toxin-antitoxin, RelE / RelB, TA system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.620 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3k6qA02
3.40.1620.10 Alpha Beta 3-Layer(aba) Sandwich YefM-like fold YefM-like domain 3k6qA01
3D55A 3HRYA 3OEIA 3OEIE 2ODKA 2A6QA 3CTOA 3KH2E 4ZM2A 3K6QA 3HS2A 3K33B 3G5OA 4ZLXA 4ZM0A
chains in the Genus database with same CATH superfamily
2LRSA 4Q28A 2EM7A 3J7Yp 4HLHC 1RC7A 4DR5E 4KHPE 1PJSA 4LF5E 4NHRA 2H36X 2L8TA 3QG5C 1X5WA 1FKAE 2HHHE 4L09C 4ZYHA 5ADRB 2EMKA 3IWCA 5FPFC 2LCEA 2KOUA 4DV4E 1QU6A 2UUBE 2MDGA 3RMPA 5C5PC 4N4RB 2NUFA 3DJWA 4BBYA 2JP9A 1YYOA 2EMIA 4O4KA 2DIXA 4UI4C 3ZOQB 4WYQB 3VK6A 4R2CA 5LLQA 4X9JA 2EZ6A 4LF8E 4JI8E 2J7JA 1X49A 4DR2E 3EPKA 1A1HA 4JV5E 2EMXA 4WFTA 2EN1A 2EP3A 2LTSA 1JK1A 2JVAA 1ZBTA 4HLKC 2VF1A 2RTXA 1WRJA 4NXME 2EPOA 1WHQA 5KL3A 1A1KA 3ECRA 4F9AB 4L0TC 4L0VC 4LF7E 2B3TB 1XNRE 2L6MA 3THOB 2YTIA 4WX9A 2LTRA 2L2KB 4F9CB 1KJKA 2EQ3A 2L2NA 4DR1E 3ADIA 2NUEA 3BGHA 1ZU1A 2EOXA 3K6QA 2VRDA 1ZAAC 2NA2A 2HC5A 4AQYE 2EMGA 4X62E 1HNXE 4F54A 2YWQA 3T1YE 2EM5A 5A6JA 2DGCA 1NCSA 4L0IC 4LF6E 2EQ0A 1G2FC 4LFAE 1JK2A 4MLVA 5AC5A 2UXCE 1NEIA 4L2FC 2EOSA 3D55A 2UUCE 1RQ0A 2A6QA 2CTDA 2ELZA 5KL4A 4DV5E 2EM6A 4M0VA 4P7DA 2FV4B 1EH7A 2EN4A 4LTYA 2YTNA 2LV2A 2CT1A 1HNZE 4BHCA 3H09A 2I9IA 4B3ME 2YTGA 1X47A 2LJUA 3K33B 4DV6E 2JR1A 4J8ZA 4L31C 2EOHA 2WBUA 2DMYA 2EPKX 2CSHA 2V8QB 1SFEA 2M1SA 4BC9A 3AV0A 2ZM6E 1N36E 5LMUE 4L33C 2EPAA 5AE1A 4DR7E 4GKKE 2DLKA 4DV3E 2YRKA 4ZLXA 1LLMC 1DGCA 3KZYA 4X65E 2ODKA 2DSYA 2EOQA 2LO3A 2NABA 2R76A 3EPHA 3G5OA 5AASA 4L0SC 4YY3E 1A1IA 2EMAA 1XNQE 1EH6A 5ADQB 3T1HE 2LJHA 5F3WA 4KZLC 4HTGA 4UVPB 3MHHC 2EOOA 2L92A 5KL7A 2GLIA 1J26A 1QNTA 4HLFC 2UXDE 1XMOE 2EOYA 3L00A 2N3GA 3MHSC 2HGHA 4DV2E 2E72A 2IHR1 3OEIE 2Q8UA 2NUGA 1YPNA 2EMYA 4UI7C 3EPLA 2ODRC 4JI0E 2JY9A 1X6HA 2EJ4A 4JYAE 4JI7E 5LMNE 4DKKA 1AAYA 2VE7C 2K4VA 1A1FA 2CPNA 4DMIA 1IQOA 4O24A 1T4OA 1FJGE 5BR8E 2EOZA 2K7IA 2VQFE 5C5QC 3HS2A 2RSIA 4ZM0A 2EOFA 1IMUA 2DLQA 2YSPA 4R2EA 4TUGA 2E5LE 4HKNC 2EMFA 2EM9A 1X6FA 3BIDA 2ODRD 2EOJA 2EQ1A 4HMHC 5T6JA 2M7QA 2L3CA 4L2KC 3KWRA 2PRTA 4NXNE 4L10C 2V86A 3HXLA 5A6BA 3ADGA 1O0WA 2ENCA 2UUAE 4HKKB 2B7TA 2EN3A 4OOGC 4HKIC 1PJQA 4DV7E 2ENAA 5IV8B 4BHBA 4L32C 1DQ3A 1EH8A 2EMZA 2V87A 4P78A 5TSEA 2LT7A 1A1JA 1YUIA 2EPUA 4LF9E 4WSGA 3IWBA 2LBSB 4LF4E 3MSWA 4Q35B 2F4VE 1N33E 4R03A 2EM3A 1BB8A 4HL5C 1T38A 1XMQE 2EM8A 2ELYA 2EL5A 4DUYE 3VHTB 4O43A 3EQ1A 3VYYA 5IXMB 1UILA 3THNA 4O5GA 4K0KE 3HJ6A 2YTDA 2V89A 1YUJA 4HLMC 2ENHA 2VQEE 1B69A 1KYQA 2LUQA 2EOMA 3JAMC 4ZYEA 1UBDC 3F6GA 2E1MA 2WBSA 2YTFA 1T4LB 2JXPA 2MKNA 2YTQA 3JU0A 3C6MA 4YHHE 4L0BC 1EKZA 3HTXA 1G2DC 3AUZA 1N32E 2EM2A 4FK5C 2EPNA 2FTXB 3P1XA 5AE2A 2WCC3 4L5NC 3M99B 4DUZE 1ZR9A 2BB8A 5LL6R 4JI2E 2EMBA 2DB2A 4WXDA 4F6MA 2I13A 3HPZA 2EOEA 1MGTA 4UI8C 4R2AA 1WJPA 2UU9E 1AH5A 1STUA 1YYWA 2EPCA 3J7AG 2EN2A 2M4IA 2YTEA 4R2DA 3TQMA 4HLGC 1YSAC 3FIGA 5A6AA 2EPRA 1PKPA 2EMWA 2EMCA 4F9BB 5DNYA 4M9VC 1TN9A 2DMIA 1A1GA 2RQLA 2EOIA 2R1FA 2LUPB 3F6HA 1IBME 2YSOA 1MEYC 2JWOA 2LVHA 1YZ9A 2GHFA 1X3CA 1N34E 4R8OA 4BMJA 3BBGA 4DR4E 2DRPA 2ADRA 3VYXA 3OMLA 2LE2A 2EPXA 5ADSB 2KONA 5FLXC 2YZTA 5CFFE 2EWLA 2EL4A 4X66E 4DV0E 5KL5A 3EPJA 4UI5C 4JI3E 2MC5A 2EORA 2FGGA 2L2MA 5ADZA 4ZYDA 4F2JC 5C5RC 2RS6A 3HPSA 5A6KA 2YRMA 4KWYA 4ZYGA 4X64E 4JI1E 2V88A 3KZZA 5KL2A 3J81C 4BCAA 2B7VA 4IJDA 4JI6E 2N3HA 4UI3C 4DR6E 4R2SA 2YT4A 2LMZA 2GPIA 1PDAA 4R2QA 2JOXA 4NZVA 1BBGA 1SR9A 4L34C 2JYAA 4LFBE 4RHBB 3LMLA 2EN8A 5A6BD 4IS1C 1J5EE 3UK3C 4L8NA 2YU5A 5AE3A 2UXBE 2EM4A 2RPCA 3JTZA 1RMDA 2EMHA 5IWAE 2V85A 3ADJA 2WBTA 2EN7A 2RS7A 3J80C 2G7HA 5A2QC 4OX9E 4KZUC 2YPNA 1TF3A 2B9DA 4BC7A 3KH2E 2EPLX 4MLQA 2L3JA 2F8BA 2YRHA 1PJTA 2HJJA 3C6KA 3OTOE 5AC4A 1TF6A 4GZNC 1UN6B 4WSPA 5A69A 4KZQC 1L4SA 2RSMA 5ADTB 2YU8A 4LFCE 2L33A 4R2RA 3HRYA 3OEIA 1T39A 1Z1BA 4TUIA 3IWDA 1IBKE 1HR0E 1YYKA 2EL6A 4KZSA 1X6EA 4GKJE 2EN6A 4DR3E 2MDRA 4I8OA 2YTJA 2MC6A 1GTKA 2EE8A 4UI6C 1UHZA 1HNWE 1T4NA 2EM0A 4L2GC 1WHNA 2N8XA 2EPPA 1P47A 4JI4E 4LU9A 4B3SE 1WXRA 2BBGA 4JI5E 4BS9A 4R2PA 2V83A 1A1LA 1IQSA 4GEQB 5IT9C 2ZIXB 2A25A 2EPZA 3C4TA 1GZ6A 4M2ZA 4F6NA 2EMLA 3C4BA 1YFHA 3DF6A 2D9HA 2WZOA 4WPYA 4M30A 1GQEA 4ZM2A 3ADLA 1ZBQA 2MKDA 5KL6A 4HEIA 1IBLE 2JOBA 2JPAA 3HQ1A 4B3RE 1I94E 4X8WA 1DI2A 4DV1E 3BF2A 4WXCA 3LLHA 2YTPA 4B3TE 2EPMX 1F2IG 4RH8A 3CTOA 1N3GA 2YTOA 1BBOA 1X48A 2M9AA 2KHXA
chains in the Genus database with same CATH topology
4LF9E 3IWBA 2JR1A 4J8ZA 2LBSB 4JI1E 2LRSA 4Q28A 2V88A 3J7Yp 1RC7A 2DMYA 4DR5E 4LF4E 3MSWA 2F4VE 4LF5E 4KHPE 2V8QB 4R03A 1N33E 2H36X 2L8TA 2M1SA 3J81C 4BCAA 1FKAE 4BC9A 2HHHE 3AV0A 1XMQE 2B7VA 2ZM6E 1N36E 3IWCA 4JI6E 2N3HA 5LMUE 4DR6E 4DUYE 5AE1A 2YT4A 2LMZA 4DR7E 4GKKE 2KOUA 4DV4E 4DV3E 1QU6A 2JOXA 3VYYA 1SR9A 2UUBE 1UILA 4ZLXA 4LFBE 3LMLA 4X65E 2ODKA 3RMPA 4K0KE 2DSYA 1J5EE 2V89A 2NUFA 3G5OA 4L8NA 5AASA 3DJWA 5AE3A 2VQEE 2UXBE 4BBYA 4YY3E 3JTZA 1YYOA 2LUQA 5IWAE 2DIXA 1XNQE 2V85A 3JAMC 3ADJA 3F6GA 3T1HE 2E1MA 3ZOQB 4WYQB 3VK6A 2RS7A 1T4LB 3J80C 2G7HA 2LJHA 3JU0A 5F3WA 5A2QC 2EZ6A 4YHHE 4LF8E 4JI8E 1EKZA 4OX9E 3HTXA 2L92A 2B9DA 1X49A 3AUZA 4BC7A 4DR2E 1N32E 4JV5E 1J26A 3KH2E 4WFTA 2L3JA 2LTSA 2UXDE 1XMOE 2F8BA 2JVAA 1ZBTA 3OTOE 2N3GA 4DV2E 2VF1A 2IHR1 2RTXA 2FTXB 3OEIE 3P1XA 5AE2A 4NXME 2NUGA 1WHQA 4L5NC 4WSPA 4DUZE 2RSMA 2ODRC 5LL6R 4F9AB 4JI0E 2JY9A 2DB2A 4JI2E 4LFCE 2L33A 3HRYA 3OEIA 3HPZA 4JYAE 4TUIA 4LF7E 4JI7E 2B3TB 3IWDA 1IBKE 1HR0E 1XNRE 1YYKA 2L6MA 4KZSA 4GKJE 2LTRA 2L2KB 5LMNE 4DKKA 2UU9E 1STUA 2MDRA 2K4VA 2VE7C 2MC6A 4I8OA 2M4IA 4F9CB 4DR3E 2L2NA 1UHZA 1HNWE 3FIGA 1T4NA 4DR1E 3ADIA 3J7AG 1WHNA 2CPNA 1PKPA 4DMIA 2NUEA 1T4OA 4F9BB 5DNYA 5BR8E 4JI4E 1FJGE 4LU9A 2VQFE 3K6QA 4B3SE 3HS2A 1WXRA 4JI5E 4BS9A 4ZM0A 2V83A 2NA2A 2LUPB 3F6HA 4AQYE 1IBME 4GEQB 4X62E 5IT9C 1HNXE 4TUGA 4F54A 2JWOA 2E5LE 3C4TA 3T1YE 2ODRD 1GZ6A 4M2ZA 1YZ9A 4LF6E 5T6JA 2M7QA 4LFAE 3C4BA 2L3CA 1N34E 3DF6A 4R8OA 4WPYA 2WZOA 4M30A 4BMJA 2UXCE 4DR4E 1GQEA 3KWRA 4NXNE 3VYXA 3D55A 2UUCE 1RQ0A 2V86A 1ZBQA 3ADLA 2A6QA 3OMLA 2LE2A 3HXLA 1IBLE 4ZM2A 4DV5E 3ADGA 1O0WA 2JOBA 2KONA 2YZTA 4M0VA 2B7TA 2EWLA 5CFFE 5FLXC 2UUAE 4P7DA 3HQ1A 4X66E 1YYWA 2FV4B 4DV0E 4B3RE 4OOGC 1I94E 4X8WA 1DI2A 4DV1E 4DV7E 4LTYA 3LLHA 4JI3E 1HNZE 2MC5A 3H09A 4B3TE 2FGGA 3CTOA 4B3ME 2L2MA 1X47A 5ADZA 1DQ3A 2RS6A 3HPSA 3K33B 2V87A 4P78A 4DV6E 4X64E 1X48A 2KHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D55 A;  3HRY A;  3OEI A;  3OEI E;  2ODK A;  2A6Q A;  3CTO A;  3KH2 E;  4ZM2 A;  3K6Q A;  3HS2 A;  3K33 B;  3G5O A;  4ZLX A;  4ZM0 A; 
#chains in the Genus database with same CATH topology
 2LRS A;  4Q28 A;  2EM7 A;  3J7Y p;  4HLH C;  1RC7 A;  4DR5 E;  4KHP E;  1PJS A;  4LF5 E;  4NHR A;  2H36 X;  2L8T A;  3QG5 C;  1X5W A;  1FKA E;  2HHH E;  4L09 C;  4ZYH A;  5ADR B;  2EMK A;  3IWC A;  5FPF C;  2LCE A;  2KOU A;  4DV4 E;  1QU6 A;  2UUB E;  2MDG A;  3RMP A;  5C5P C;  4N4R B;  2NUF A;  3DJW A;  4BBY A;  2JP9 A;  1YYO A;  2EMI A;  4O4K A;  2DIX A;  4UI4 C;  3ZOQ B;  4WYQ B;  3VK6 A;  4R2C A;  5LLQ A;  4X9J A;  2EZ6 A;  4LF8 E;  4JI8 E;  2J7J A;  1X49 A;  4DR2 E;  3EPK A;  1A1H A;  4JV5 E;  2EMX A;  4WFT A;  2EN1 A;  2EP3 A;  2LTS A;  1JK1 A;  2JVA A;  1ZBT A;  4HLK C;  2VF1 A;  2RTX A;  1WRJ A;  4NXM E;  2EPO A;  1WHQ A;  5KL3 A;  1A1K A;  3ECR A;  4F9A B;  4L0T C;  4L0V C;  4LF7 E;  2B3T B;  1XNR E;  2L6M A;  3THO B;  2YTI A;  4WX9 A;  2LTR A;  2L2K B;  4F9C B;  1KJK A;  2EQ3 A;  2L2N A;  4DR1 E;  3ADI A;  2NUE A;  3BGH A;  1ZU1 A;  2EOX A;  3K6Q A;  2VRD A;  1ZAA C;  2NA2 A;  2HC5 A;  4AQY E;  2EMG A;  4X62 E;  1HNX E;  4F54 A;  2YWQ A;  3T1Y E;  2EM5 A;  5A6J A;  2DGC A;  1NCS A;  4L0I C;  4LF6 E;  2EQ0 A;  1G2F C;  4LFA E;  1JK2 A;  4MLV A;  5AC5 A;  2UXC E;  1NEI A;  4L2F C;  2EOS A;  3D55 A;  2UUC E;  1RQ0 A;  2A6Q A;  2CTD A;  2ELZ A;  5KL4 A;  4DV5 E;  2EM6 A;  4M0V A;  4P7D A;  2FV4 B;  1EH7 A;  2EN4 A;  4LTY A;  2YTN A;  2LV2 A;  2CT1 A;  1HNZ E;  4BHC A;  3H09 A;  2I9I A;  4B3M E;  2YTG A;  1X47 A;  2LJU A;  3K33 B;  4DV6 E;  2JR1 A;  4J8Z A;  4L31 C;  2EOH A;  2WBU A;  2DMY A;  2EPK X;  2CSH A;  2V8Q B;  1SFE A;  2M1S A;  4BC9 A;  3AV0 A;  2ZM6 E;  1N36 E;  5LMU E;  4L33 C;  2EPA A;  5AE1 A;  4DR7 E;  4GKK E;  2DLK A;  4DV3 E;  2YRK A;  4ZLX A;  1LLM C;  1DGC A;  3KZY A;  4X65 E;  2ODK A;  2DSY A;  2EOQ A;  2LO3 A;  2NAB A;  2R76 A;  3EPH A;  3G5O A;  5AAS A;  4L0S C;  4YY3 E;  1A1I A;  2EMA A;  1XNQ E;  1EH6 A;  5ADQ B;  3T1H E;  2LJH A;  5F3W A;  4KZL C;  4HTG A;  4UVP B;  3MHH C;  2EOO A;  2L92 A;  5KL7 A;  2GLI A;  1J26 A;  1QNT A;  4HLF C;  2UXD E;  1XMO E;  2EOY A;  3L00 A;  2N3G A;  3MHS C;  2HGH A;  4DV2 E;  2E72 A;  2IHR 1;  3OEI E;  2Q8U A;  2NUG A;  1YPN A;  2EMY A;  4UI7 C;  3EPL A;  2ODR C;  4JI0 E;  2JY9 A;  1X6H A;  2EJ4 A;  4JYA E;  4JI7 E;  5LMN E;  4DKK A;  1AAY A;  2VE7 C;  2K4V A;  1A1F A;  2CPN A;  4DMI A;  1IQO A;  4O24 A;  1T4O A;  1FJG E;  5BR8 E;  2EOZ A;  2K7I A;  2VQF E;  5C5Q C;  3HS2 A;  2RSI A;  4ZM0 A;  2EOF A;  1IMU A;  2DLQ A;  2YSP A;  4R2E A;  4TUG A;  2E5L E;  4HKN C;  2EMF A;  2EM9 A;  1X6F A;  3BID A;  2ODR D;  2EOJ A;  2EQ1 A;  4HMH C;  5T6J A;  2M7Q A;  2L3C A;  4L2K C;  3KWR A;  2PRT A;  4NXN E;  4L10 C;  2V86 A;  3HXL A;  5A6B A;  3ADG A;  1O0W A;  2ENC A;  2UUA E;  4HKK B;  2B7T A;  2EN3 A;  4OOG C;  4HKI C;  1PJQ A;  4DV7 E;  2ENA A;  5IV8 B;  4BHB A;  4L32 C;  1DQ3 A;  1EH8 A;  2EMZ A;  2V87 A;  4P78 A;  5TSE A;  2LT7 A;  1A1J A;  1YUI A;  2EPU A;  4LF9 E;  4WSG A;  3IWB A;  2LBS B;  4LF4 E;  3MSW A;  4Q35 B;  2F4V E;  1N33 E;  4R03 A;  2EM3 A;  1BB8 A;  4HL5 C;  1T38 A;  1XMQ E;  2EM8 A;  2ELY A;  2EL5 A;  4DUY E;  3VHT B;  4O43 A;  3EQ1 A;  3VYY A;  5IXM B;  1UIL A;  3THN A;  4O5G A;  4K0K E;  3HJ6 A;  2YTD A;  2V89 A;  1YUJ A;  4HLM C;  2ENH A;  2VQE E;  1B69 A;  1KYQ A;  2LUQ A;  2EOM A;  3JAM C;  4ZYE A;  1UBD C;  3F6G A;  2E1M A;  2WBS A;  2YTF A;  1T4L B;  2JXP A;  2MKN A;  2YTQ A;  3JU0 A;  3C6M A;  4YHH E;  4L0B C;  1EKZ A;  3HTX A;  1G2D C;  3AUZ A;  1N32 E;  2EM2 A;  4FK5 C;  2EPN A;  2FTX B;  3P1X A;  5AE2 A;  2WCC 3;  4L5N C;  3M99 B;  4DUZ E;  1ZR9 A;  2BB8 A;  5LL6 R;  4JI2 E;  2EMB A;  2DB2 A;  4WXD A;  4F6M A;  2I13 A;  3HPZ A;  2EOE A;  1MGT A;  4UI8 C;  4R2A A;  1WJP A;  2UU9 E;  1AH5 A;  1STU A;  1YYW A;  2EPC A;  3J7A G;  2EN2 A;  2M4I A;  2YTE A;  4R2D A;  3TQM A;  4HLG C;  1YSA C;  3FIG A;  5A6A A;  2EPR A;  1PKP A;  2EMW A;  2EMC A;  4F9B B;  5DNY A;  4M9V C;  1TN9 A;  2DMI A;  1A1G A;  2RQL A;  2EOI A;  2R1F A;  2LUP B;  3F6H A;  1IBM E;  2YSO A;  1MEY C;  2JWO A;  2LVH A;  1YZ9 A;  2GHF A;  1X3C A;  1N34 E;  4R8O A;  4BMJ A;  3BBG A;  4DR4 E;  2DRP A;  2ADR A;  3VYX A;  3OML A;  2LE2 A;  2EPX A;  5ADS B;  2KON A;  5FLX C;  2YZT A;  5CFF E;  2EWL A;  2EL4 A;  4X66 E;  4DV0 E;  5KL5 A;  3EPJ A;  4UI5 C;  4JI3 E;  2MC5 A;  2EOR A;  2FGG A;  2L2M A;  5ADZ A;  4ZYD A;  4F2J C;  5C5R C;  2RS6 A;  3HPS A;  5A6K A;  2YRM A;  4KWY A;  4ZYG A;  4X64 E;  4JI1 E;  2V88 A;  3KZZ A;  5KL2 A;  3J81 C;  4BCA A;  2B7V A;  4IJD A;  4JI6 E;  2N3H A;  4UI3 C;  4DR6 E;  4R2S A;  2YT4 A;  2LMZ A;  2GPI A;  1PDA A;  4R2Q A;  2JOX A;  4NZV A;  1BBG A;  1SR9 A;  4L34 C;  2JYA A;  4LFB E;  4RHB B;  3LML A;  2EN8 A;  5A6B D;  4IS1 C;  1J5E E;  3UK3 C;  4L8N A;  2YU5 A;  5AE3 A;  2UXB E;  2EM4 A;  2RPC A;  3JTZ A;  1RMD A;  2EMH A;  5IWA E;  2V85 A;  3ADJ A;  2WBT A;  2EN7 A;  2RS7 A;  3J80 C;  2G7H A;  5A2Q C;  4OX9 E;  4KZU C;  2YPN A;  1TF3 A;  2B9D A;  4BC7 A;  3KH2 E;  2EPL X;  4MLQ A;  2L3J A;  2F8B A;  2YRH A;  1PJT A;  2HJJ A;  3C6K A;  3OTO E;  5AC4 A;  1TF6 A;  4GZN C;  1UN6 B;  4WSP A;  5A69 A;  4KZQ C;  1L4S A;  2RSM A;  5ADT B;  2YU8 A;  4LFC E;  2L33 A;  4R2R A;  3HRY A;  3OEI A;  1T39 A;  1Z1B A;  4TUI A;  3IWD A;  1IBK E;  1HR0 E;  1YYK A;  2EL6 A;  4KZS A;  1X6E A;  4GKJ E;  2EN6 A;  4DR3 E;  2MDR A;  4I8O A;  2YTJ A;  2MC6 A;  1GTK A;  2EE8 A;  4UI6 C;  1UHZ A;  1HNW E;  1T4N A;  2EM0 A;  4L2G C;  1WHN A;  2N8X A;  2EPP A;  1P47 A;  4JI4 E;  4LU9 A;  4B3S E;  1WXR A;  2BBG A;  4JI5 E;  4BS9 A;  4R2P A;  2V83 A;  1A1L A;  1IQS A;  4GEQ B;  5IT9 C;  2ZIX B;  2A25 A;  2EPZ A;  3C4T A;  1GZ6 A;  4M2Z A;  4F6N A;  2EML A;  3C4B A;  1YFH A;  3DF6 A;  2D9H A;  2WZO A;  4WPY A;  4M30 A;  1GQE A;  4ZM2 A;  3ADL A;  1ZBQ A;  2MKD A;  5KL6 A;  4HEI A;  1IBL E;  2JOB A;  2JPA A;  3HQ1 A;  4B3R E;  1I94 E;  4X8W A;  1DI2 A;  4DV1 E;  3BF2 A;  4WXC A;  3LLH A;  2YTP A;  4B3T E;  2EPM X;  1F2I G;  4RH8 A;  3CTO A;  1N3G A;  2YTO A;  1BBO A;  1X48 A;  2M9A A;  2KHX A; 
#chains in the Genus database with same CATH homology
 4LF9 E;  3IWB A;  2JR1 A;  4J8Z A;  2LBS B;  4JI1 E;  2LRS A;  4Q28 A;  2V88 A;  3J7Y p;  1RC7 A;  2DMY A;  4DR5 E;  4LF4 E;  3MSW A;  2F4V E;  4LF5 E;  4KHP E;  2V8Q B;  4R03 A;  1N33 E;  2H36 X;  2L8T A;  2M1S A;  3J81 C;  4BCA A;  1FKA E;  4BC9 A;  2HHH E;  3AV0 A;  1XMQ E;  2B7V A;  2ZM6 E;  1N36 E;  3IWC A;  4JI6 E;  2N3H A;  5LMU E;  4DR6 E;  4DUY E;  5AE1 A;  2YT4 A;  2LMZ A;  4DR7 E;  4GKK E;  2KOU A;  4DV4 E;  4DV3 E;  1QU6 A;  2JOX A;  3VYY A;  1SR9 A;  2UUB E;  1UIL A;  4ZLX A;  4LFB E;  3LML A;  4X65 E;  2ODK A;  3RMP A;  4K0K E;  2DSY A;  1J5E E;  2V89 A;  2NUF A;  3G5O A;  4L8N A;  5AAS A;  3DJW A;  5AE3 A;  2VQE E;  2UXB E;  4BBY A;  4YY3 E;  3JTZ A;  1YYO A;  2LUQ A;  5IWA E;  2DIX A;  1XNQ E;  2V85 A;  3JAM C;  3ADJ A;  3F6G A;  3T1H E;  2E1M A;  3ZOQ B;  4WYQ B;  3VK6 A;  2RS7 A;  1T4L B;  3J80 C;  2G7H A;  2LJH A;  3JU0 A;  5F3W A;  5A2Q C;  2EZ6 A;  4YHH E;  4LF8 E;  4JI8 E;  1EKZ A;  4OX9 E;  3HTX A;  2L92 A;  2B9D A;  1X49 A;  3AUZ A;  4BC7 A;  4DR2 E;  1N32 E;  4JV5 E;  1J26 A;  3KH2 E;  4WFT A;  2L3J A;  2LTS A;  2UXD E;  1XMO E;  2F8B A;  2JVA A;  1ZBT A;  3OTO E;  2N3G A;  4DV2 E;  2VF1 A;  2IHR 1;  2RTX A;  2FTX B;  3OEI E;  3P1X A;  5AE2 A;  4NXM E;  2NUG A;  1WHQ A;  4L5N C;  4WSP A;  4DUZ E;  2RSM A;  2ODR C;  5LL6 R;  4F9A B;  4JI0 E;  2JY9 A;  2DB2 A;  4JI2 E;  4LFC E;  2L33 A;  3HRY A;  3OEI A;  3HPZ A;  4JYA E;  4TUI A;  4LF7 E;  4JI7 E;  2B3T B;  3IWD A;  1IBK E;  1HR0 E;  1XNR E;  1YYK A;  2L6M A;  4KZS A;  4GKJ E;  2LTR A;  2L2K B;  5LMN E;  4DKK A;  2UU9 E;  1STU A;  2MDR A;  2K4V A;  2VE7 C;  2MC6 A;  4I8O A;  2M4I A;  4F9C B;  4DR3 E;  2L2N A;  1UHZ A;  1HNW E;  3FIG A;  1T4N A;  4DR1 E;  3ADI A;  3J7A G;  1WHN A;  2CPN A;  1PKP A;  4DMI A;  2NUE A;  1T4O A;  4F9B B;  5DNY A;  5BR8 E;  4JI4 E;  1FJG E;  4LU9 A;  2VQF E;  3K6Q A;  4B3S E;  3HS2 A;  1WXR A;  4JI5 E;  4BS9 A;  4ZM0 A;  2V83 A;  2NA2 A;  2LUP B;  3F6H A;  4AQY E;  1IBM E;  4GEQ B;  4X62 E;  5IT9 C;  1HNX E;  4TUG A;  4F54 A;  2JWO A;  2E5L E;  3C4T A;  3T1Y E;  2ODR D;  1GZ6 A;  4M2Z A;  1YZ9 A;  4LF6 E;  5T6J A;  2M7Q A;  4LFA E;  3C4B A;  2L3C A;  1N34 E;  3DF6 A;  4R8O A;  4WPY A;  2WZO A;  4M30 A;  4BMJ A;  2UXC E;  4DR4 E;  1GQE A;  3KWR A;  4NXN E;  3VYX A;  3D55 A;  2UUC E;  1RQ0 A;  2V86 A;  1ZBQ A;  3ADL A;  2A6Q A;  3OML A;  2LE2 A;  3HXL A;  1IBL E;  4ZM2 A;  4DV5 E;  3ADG A;  1O0W A;  2JOB A;  2KON A;  2YZT A;  4M0V A;  2B7T A;  2EWL A;  5CFF E;  5FLX C;  2UUA E;  4P7D A;  3HQ1 A;  4X66 E;  1YYW A;  2FV4 B;  4DV0 E;  4B3R E;  4OOG C;  1I94 E;  4X8W A;  1DI2 A;  4DV1 E;  4DV7 E;  4LTY A;  3LLH A;  4JI3 E;  1HNZ E;  2MC5 A;  3H09 A;  4B3T E;  2FGG A;  3CTO A;  4B3M E;  2L2M A;  1X47 A;  5ADZ A;  1DQ3 A;  2RS6 A;  3HPS A;  3K33 B;  2V87 A;  4P78 A;  4DV6 E;  4X64 E;  1X48 A;  2KHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...