3K6QA

Crystal structure of an antitoxin part of a putative toxin/antitoxin system (swol_0700) from syntrophomonas wolfei subsp. wolfei at 1.80 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
139
structure length
139
Chain Sequence
b'GMQTINATEIRNNFSYYIDTVVRDKPIAVKRNRDVLLFFSEQIIKDLLQDLKIHAELSKEDGIIIGTIDGFDLVVSGESEQEVIQKLAEDLLEYAQDYMNDFKLFYNAPNRKTHYPYILKVLLSSNIDEVKGYIYAEMV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ligand binding protein
publication title Crystal structure of Putative ligand binding protein (YP_753395.1) from Syntrophomonas wolfei str. Goettingen at 1.80 A resolution
rcsb
source organism Syntrophomonas wolfei subsp. wolfei
molecule tags Ligand binding protein
total genus 40
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12910 PHD_like Antitoxin of toxin-antitoxin, RelE / RelB, TA system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.620 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3k6qA02
3.40.1620.10 Alpha Beta 3-Layer(aba) Sandwich YefM-like fold YefM-like domain 3k6qA01
3HS2A 3K33B 4ZM2A 3OEIA 4ZM0A 4ZLXA 3CTOA 2A6QA 3G5OA 3D55A 3KH2E 3HRYA 3OEIE 3K6QA 2ODKA
chains in the Genus database with same CATH superfamily
2EPMX 2EM9A 2EOEA 3LMLA 4I8OA 2L3CA 1YZ9A 3HQ1A 2EPAA 2EM8A 2EL5A 2EMCA 2JOXA 4DKKA 3ZOQB 5A6BD 2V83A 2EPPA 4F54A 1ZU1A 5AASA 4DR7E 4R2DA 2MC6A 4MLQA 2EM7A 1LLMC 2EOFA 3CTOA 5AE1A 2LMZA 1B69A 1HNZE 2MKNA 2YTOA 2YWQA 2ELYA 2EZ6A 4R2AA 2HJJA 5LL6R 2K7IA 4GKJE 2CT1A 2NA2A 5BR8E 2HC5A 4WXCA 5IV8B 2EM2A 2EMWA 4UI6C 1XNQE 3MHHC 5KL4A 2L6MA 2ENAA 2M4IA 1YUIA 1X6FA 4JI0E 2NABA 3KZZA 4JI8E 4L5NC 2EPOA 1T4LB 2B7VA 1JK2A 2BB8A 1YYOA 2ODRD 1YUJA 3HS2A 4HLMC 4DR5E 1SFEA 4F9CB 4RH8A 3IWCA 4NZVA 2EN2A 2YTJA 2GLIA 1IQSA 2DLQA 3EPJA 1RQ0A 2LO3A 5KL3A 2EPCA 4DUZE 1PJQA 2ELZA 1NEIA 5KL2A 2EPZA 2LE2A 2NUFA 1A1KA 1X48A 5AE3A 3JTZA 2HHHE 4Q35B 2EPLX 2EWLA 1IBME 2YT4A 4MLVA 1XMOE 4DR6E 1YYWA 3EPKA 1N3GA 1FJGE 4DV7E 3ECRA 3VYXA 3HPZA 4JI3E 4HLKC 2DIXA 2M7QA 1EH6A 3AUZA 2JXPA 4BBYA 1A1JA 4DMIA 2EQ3A 2NUEA 2YTNA 2YTDA 3C4TA 2EOQA 3DF6A 2YTFA 2F4VE 4WFTA 1N36E 1KYQA 5C5QC 1STUA 4IS1C 3UK3C 2EMXA 1MEYC 2EOMA 5FPFC 4X64E 2EPKX 5ADSB 4B3TE 4DR1E 5AC5A 3J81C 1EH8A 2RPCA 2LVHA 2H36X 1Z1BA 4WSPA 4R2SA 1J5EE 2YRMA 4KZLC 4UI7C 2RSIA 4R2RA 1TN9A 2DLKA 5F3WA 5C5RC 1PJTA 4Q28A 5A2QC 2YTPA 1PDAA 4DV6E 4LTYA 2LCEA 2ENCA 1T38A 4ZYHA 2KONA 3VYYA 4L0SC 4ZYGA 4HKNC 2LV2A 4B3ME 3QG5C 5LMUE 2JWOA 4ZLXA 2YRHA 4JI4E 2EMAA 2EMIA 2EMLA 3IWBA 3JU0A 2VQFE 1QNTA 2WZOA 2GHFA 2V8QB 3EPLA 3G5OA 1X3CA 2B7TA 2L2NA 4UI5C 2VF1A 2YZTA 4DV1E 4JI5E 2FTXB 2Q8UA 1O0WA 3TQMA 5ADZA 3ADGA 1I94E 4HL5C 4L0VC 2EMBA 2F8BA 4ZM2A 1X6HA 1KJKA 2LTRA 4UI8C 1G2FC 1PJSA 1N34E 5IXMB 2WBUA 4LF5E 1X47A 2L3JA 4OOGC 3C6MA 4DV2E 2KHXA 4F9AB 1IBKE 2EPNA 2FGGA 2EPUA 3H09A 4WXDA 1N32E 4R2EA 1A1LA 1PKPA 4L2KC 2RS6A 4GKKE 3K6QA 2NUGA 1AAYA 2EJ4A 2EL4A 3M99B 1A1IA 3OMLA 1T4NA 3JAMC 3THOB 2JPAA 5A69A 2CSHA 3ADIA 2E72A 4B3SE 1WJPA 4ZYEA 2E5LE 2VQEE 4O43A 2YTGA 2EN3A 2DMYA 4UVPB 2ADRA 1RMDA 2FV4B 1UBDC 2RTXA 2LJHA 2MDRA 1AH5A 4BCAA 2LT7A 4HLGC 4L09C 2MC5A 2EM4A 3J80C 4M2ZA 4KHPE 2WCC3 4NHRA 4J8ZA 5A6KA 5ADQB 4BMJA 3C6KA 1IQOA 1WHNA 2N3HA 2LBSB 1HNXE 2M1SA 2RSMA 1BBOA 5DNYA 2YTQA 4LF4E 3F6GA 3EQ1A 4DUYE 2V85A 1X49A 2A6QA 2B3TB 2GPIA 4K0KE 4L0BC 4BHCA 2EMGA 4JV5E 4L2GC 2EMYA 4M0VA 4X66E 1EH7A 4HKKB 2PRTA 1YPNA 1WRJA 2LJUA 1TF3A 4DV5E 2EORA 2K4VA 4P7DA 2BBGA 1MGTA 2EM0A 2JOBA 5AE2A 4R2QA 1RC7A 2YRKA 2LUPB 2L8TA 2J7JA 2ODRC 4DR3E 5KL7A 4L0IC 1GQEA 2ENHA 4HLHC 4O24A 2R76A 2YU8A 4OX9E 2UUBE 1GTKA 3OEIA 4X8WA 2LUQA 2D9HA 5KL6A 4DV4E 1G2DC 2JYAA 2UXCE 2DRPA 1GZ6A 5T6JA 4WSGA 4KWYA 1IBLE 1DQ3A 5TSEA 4JI6E 3KZYA 3OEIE 2EL6A 3THNA 2EOSA 3L00A 2UUAE 4LF8E 2EQ0A 4X62E 4LFAE 1YYKA 4KZQC 4KZUC 4BC9A 4HEIA 3KH2E 2L33A 4LF6E 5CFFE 2YU5A 2ODKA 2CPNA 3K33B 4WPYA 3BBGA 4TUIA 2HGHA 1L4SA 3ADLA 1UILA 4P78A 1T4OA 4F2JC 5KL5A 2V86A 1J26A 5LLQA 4ZYDA 5A6AA 2EN6A 2V88A 4RHBB 5AC4A 2I9IA 2ZIXB 4O5GA 4GEQB 1P47A 1EKZA 3MHSC 3C4BA 3HXLA 1F2IG 2UXDE 2IHR1 2WBTA 4B3RE 1IMUA 2DSYA 2EOYA 2M9AA 2VE7C 2EN7A 4LU9A 2EP3A 4NXNE 4NXME 3BGHA 2EE8A 4LF7E 3HTXA 1WHQA 2EMFA 4L2FC 2LRSA 4UI3C 2EM5A 1NCSA 3T1YE 2V87A 4DV0E 2EMHA 4DR4E 1ZBTA 2EMKA 2LTSA 4F9BB 1N33E 3VK6A 2MDGA 2B9DA 4F6MA 3P1XA 4TUGA 2I13A 5ADRB 2A25A 3IWDA 2YTIA 4X65E 1ZBQA 1ZR9A 4M30A 3DJWA 4GZNC 4HKIC 2YSOA 4HLFC 2EOIA 4M9VC 1YFHA 5ADTB 1TF6A 2KOUA 3HJ6A 4LFBE 1ZAAC 3HPSA 4JYAE 2G7HA 4HMHC 4LFCE 2EOOA 2DMIA 3F6HA 1BBGA 4L32C 4ZM0A 4R8OA 1X5WA 2YTEA 4O4KA 2MKDA 3AV0A 3BF2A 2EPRA 4L0TC 4R2CA 1A1HA 4F6NA 4JI7E 2RQLA 4DR2E 4L10C 4L8NA 2JR1A 1A1FA 1XMQE 2JY9A 2EM3A 4HTGA 2DGCA 3EPHA 2EPXA 4R2PA 2UUCE 2EN4A 2V89A 5FLXC 1UN6B 4DV3E 2N3GA 1X6EA 4WX9A 3J7AG 3RMPA 5IT9C 4R03A 5LMNE 4WYQB 2UXBE 3FIGA 1A1GA 2EM6A 4AQYE 1JK1A 1HNWE 4UI4C 3LLHA 2YPNA 5C5PC 2CTDA 2L2KB 1BB8A 4L31C 3J7Yp 4BHBA 2EOXA 3HRYA 4BC7A 3T1HE 1T39A 2L92A 4JI2E 4KZSA 2EOZA 4L33C 2EQ1A 2E1MA 4IJDA 1WXRA 1YSAC 3D55A 1HR0E 1QU6A 2JP9A 4X9JA 2UU9E 4N4RB 3KWRA 1SR9A 1DGCA 1XNRE 2EOJA 2EN8A 3BIDA 3ADJA 4YY3E 1UHZA 2RS7A 2EOHA 2L2MA 5IWAE 4LF9E 4JI1E 2EN1A 5A6BA 4BS9A 4YHHE 2WBSA 2ZM6E 2YSPA 2N8XA 3OTOE 2DB2A 3VHTB 2JVAA 2EMZA 4FK5C 2VRDA 1FKAE 3MSWA 4L34C 1DI2A 2R1FA 5A6JA
chains in the Genus database with same CATH topology
2M1SA 3P1XA 2F4VE 2L3CA 2RSMA 3LMLA 4I8OA 4WFTA 1N36E 4TUGA 1YZ9A 1STUA 5DNYA 3HQ1A 4LF4E 3F6GA 3IWDA 4X65E 1ZBQA 4DUYE 4M30A 2V85A 3DJWA 1X49A 4X64E 2A6QA 2JOXA 4DKKA 2B3TB 3ZOQB 4B3TE 4DR1E 3J81C 2V83A 4K0KE 2KOUA 4F54A 4JV5E 5AASA 4DR7E 4LFBE 4JYAE 3HPSA 2G7HA 4M0VA 2H36X 4X66E 4LFCE 2MC6A 4WSPA 1J5EE 3F6HA 3CTOA 4DV5E 5AE1A 5F3WA 2LMZA 2K4VA 4Q28A 5A2QC 4ZM0A 4P7DA 4R8OA 2JOBA 5AE2A 4DV6E 4LTYA 1RC7A 1HNZE 3AV0A 2LUPB 2KONA 2L8TA 2ODRC 4DR3E 3VYYA 1GQEA 4B3ME 4JI7E 2EZ6A 4DR2E 5LMUE 4L8NA 4OX9E 2JR1A 2JWOA 2UUBE 3OEIA 4X8WA 2LUQA 1XMQE 2JY9A 5LL6R 4DV4E 4JI4E 4ZLXA 2UXCE 1GZ6A 5T6JA 4GKJE 2UUCE 2NA2A 2V89A 5BR8E 1DQ3A 5FLXC 1IBLE 1HNXE 3IWBA 4JI6E 4DV3E 2N3GA 3JU0A 2VQFE 3OEIE 3J7AG 2WZOA 3RMPA 5IT9C 4R03A 5LMNE 1XNQE 2V8QB 4WYQB 2UXBE 2UUAE 3FIGA 3G5OA 2L6MA 2M4IA 4LF8E 4AQYE 4JI0E 2B7TA 2L2NA 4X62E 4LFAE 2VF1A 1YYKA 1HNWE 2YZTA 3LLHA 4JI8E 4DV1E 4JI5E 2FTXB 3DF6A 1O0WA 4BC9A 5ADZA 3ADGA 4L5NC 1I94E 3KH2E 2L33A 1T4LB 2L2KB 4LF6E 2B7VA 5CFFE 1YYOA 2ODRD 2ODKA 3HS2A 2CPNA 2F8BA 3J7Yp 3K33B 4WPYA 4ZM2A 2LTRA 4DR5E 4F9CB 4TUIA 3IWCA 3ADLA 3HRYA 1UILA 4P78A 1N34E 1T4OA 4LF5E 4BC7A 3T1HE 2L92A 4JI2E 4KZSA 1X47A 2V86A 2L3JA 4OOGC 2E1MA 1RQ0A 1WXRA 1J26A 4DV2E 2KHXA 3D55A 1HR0E 4F9AB 1QU6A 4DUZE 2V88A 1IBKE 2UU9E 2FGGA 3H09A 3KWRA 1SR9A 4GEQB 1EKZA 1N32E 3C4BA 3HXLA 2UXDE 1PKPA 2IHR1 2RS6A 4GKKE 3K6QA 2NUGA 4B3RE 1XNRE 2DSYA 2LE2A 2NUFA 2VE7C 1X48A 1T4NA 3ADJA 1UHZA 3OMLA 2RS7A 3JTZA 4LU9A 3JAMC 5AE3A 4YY3E 2L2MA 2HHHE 3ADIA 5IWAE 4LF9E 2EWLA 1IBME 4B3SE 2YT4A 4NXME 4NXNE 1XMOE 3HTXA 2E5LE 2VQEE 4JI1E 4LF7E 1YYWA 4DR6E 2DMYA 1WHQA 2LRSA 4BS9A 4YHHE 2ZM6E 4DV7E 1FJGE 2FV4B 2RTXA 3OTOE 2DB2A 2LJHA 2MDRA 3HPZA 4JI3E 3T1YE 3VYXA 2V87A 4BCAA 2JVAA 2DIXA 2M7QA 4DV0E 3AUZA 1FKAE 3MSWA 2MC5A 4DR4E 1DI2A 3J80C 4M2ZA 4KHPE 1ZBTA 2LTSA 4BBYA 4F9BB 1N33E 4J8ZA 3VK6A 4DMIA 4BMJA 2NUEA 1WHNA 2N3HA 2LBSB 3C4TA 2B9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HS2 A;  3K33 B;  4ZM2 A;  3OEI A;  4ZM0 A;  4ZLX A;  3CTO A;  2A6Q A;  3G5O A;  3D55 A;  3KH2 E;  3HRY A;  3OEI E;  3K6Q A;  2ODK A; 
#chains in the Genus database with same CATH topology
 2EPM X;  2EM9 A;  2EOE A;  3LML A;  4I8O A;  2L3C A;  1YZ9 A;  3HQ1 A;  2EPA A;  2EM8 A;  2EL5 A;  2EMC A;  2JOX A;  4DKK A;  3ZOQ B;  5A6B D;  2V83 A;  2EPP A;  4F54 A;  1ZU1 A;  5AAS A;  4DR7 E;  4R2D A;  2MC6 A;  4MLQ A;  2EM7 A;  1LLM C;  2EOF A;  3CTO A;  5AE1 A;  2LMZ A;  1B69 A;  1HNZ E;  2MKN A;  2YTO A;  2YWQ A;  2ELY A;  2EZ6 A;  4R2A A;  2HJJ A;  5LL6 R;  2K7I A;  4GKJ E;  2CT1 A;  2NA2 A;  5BR8 E;  2HC5 A;  4WXC A;  5IV8 B;  2EM2 A;  2EMW A;  4UI6 C;  1XNQ E;  3MHH C;  5KL4 A;  2L6M A;  2ENA A;  2M4I A;  1YUI A;  1X6F A;  4JI0 E;  2NAB A;  3KZZ A;  4JI8 E;  4L5N C;  2EPO A;  1T4L B;  2B7V A;  1JK2 A;  2BB8 A;  1YYO A;  2ODR D;  1YUJ A;  3HS2 A;  4HLM C;  4DR5 E;  1SFE A;  4F9C B;  4RH8 A;  3IWC A;  4NZV A;  2EN2 A;  2YTJ A;  2GLI A;  1IQS A;  2DLQ A;  3EPJ A;  1RQ0 A;  2LO3 A;  5KL3 A;  2EPC A;  4DUZ E;  1PJQ A;  2ELZ A;  1NEI A;  5KL2 A;  2EPZ A;  2LE2 A;  2NUF A;  1A1K A;  1X48 A;  5AE3 A;  3JTZ A;  2HHH E;  4Q35 B;  2EPL X;  2EWL A;  1IBM E;  2YT4 A;  4MLV A;  1XMO E;  4DR6 E;  1YYW A;  3EPK A;  1N3G A;  1FJG E;  4DV7 E;  3ECR A;  3VYX A;  3HPZ A;  4JI3 E;  4HLK C;  2DIX A;  2M7Q A;  1EH6 A;  3AUZ A;  2JXP A;  4BBY A;  1A1J A;  4DMI A;  2EQ3 A;  2NUE A;  2YTN A;  2YTD A;  3C4T A;  2EOQ A;  3DF6 A;  2YTF A;  2F4V E;  4WFT A;  1N36 E;  1KYQ A;  5C5Q C;  1STU A;  4IS1 C;  3UK3 C;  2EMX A;  1MEY C;  2EOM A;  5FPF C;  4X64 E;  2EPK X;  5ADS B;  4B3T E;  4DR1 E;  5AC5 A;  3J81 C;  1EH8 A;  2RPC A;  2LVH A;  2H36 X;  1Z1B A;  4WSP A;  4R2S A;  1J5E E;  2YRM A;  4KZL C;  4UI7 C;  2RSI A;  4R2R A;  1TN9 A;  2DLK A;  5F3W A;  5C5R C;  1PJT A;  4Q28 A;  5A2Q C;  2YTP A;  1PDA A;  4DV6 E;  4LTY A;  2LCE A;  2ENC A;  1T38 A;  4ZYH A;  2KON A;  3VYY A;  4L0S C;  4ZYG A;  4HKN C;  2LV2 A;  4B3M E;  3QG5 C;  5LMU E;  2JWO A;  4ZLX A;  2YRH A;  4JI4 E;  2EMA A;  2EMI A;  2EML A;  3IWB A;  3JU0 A;  2VQF E;  1QNT A;  2WZO A;  2GHF A;  2V8Q B;  3EPL A;  3G5O A;  1X3C A;  2B7T A;  2L2N A;  4UI5 C;  2VF1 A;  2YZT A;  4DV1 E;  4JI5 E;  2FTX B;  2Q8U A;  1O0W A;  3TQM A;  5ADZ A;  3ADG A;  1I94 E;  4HL5 C;  4L0V C;  2EMB A;  2F8B A;  4ZM2 A;  1X6H A;  1KJK A;  2LTR A;  4UI8 C;  1G2F C;  1PJS A;  1N34 E;  5IXM B;  2WBU A;  4LF5 E;  1X47 A;  2L3J A;  4OOG C;  3C6M A;  4DV2 E;  2KHX A;  4F9A B;  1IBK E;  2EPN A;  2FGG A;  2EPU A;  3H09 A;  4WXD A;  1N32 E;  4R2E A;  1A1L A;  1PKP A;  4L2K C;  2RS6 A;  4GKK E;  3K6Q A;  2NUG A;  1AAY A;  2EJ4 A;  2EL4 A;  3M99 B;  1A1I A;  3OML A;  1T4N A;  3JAM C;  3THO B;  2JPA A;  5A69 A;  2CSH A;  3ADI A;  2E72 A;  4B3S E;  1WJP A;  4ZYE A;  2E5L E;  2VQE E;  4O43 A;  2YTG A;  2EN3 A;  2DMY A;  4UVP B;  2ADR A;  1RMD A;  2FV4 B;  1UBD C;  2RTX A;  2LJH A;  2MDR A;  1AH5 A;  4BCA A;  2LT7 A;  4HLG C;  4L09 C;  2MC5 A;  2EM4 A;  3J80 C;  4M2Z A;  4KHP E;  2WCC 3;  4NHR A;  4J8Z A;  5A6K A;  5ADQ B;  4BMJ A;  3C6K A;  1IQO A;  1WHN A;  2N3H A;  2LBS B;  1HNX E;  2M1S A;  2RSM A;  1BBO A;  5DNY A;  2YTQ A;  4LF4 E;  3F6G A;  3EQ1 A;  4DUY E;  2V85 A;  1X49 A;  2A6Q A;  2B3T B;  2GPI A;  4K0K E;  4L0B C;  4BHC A;  2EMG A;  4JV5 E;  4L2G C;  2EMY A;  4M0V A;  4X66 E;  1EH7 A;  4HKK B;  2PRT A;  1YPN A;  1WRJ A;  2LJU A;  1TF3 A;  4DV5 E;  2EOR A;  2K4V A;  4P7D A;  2BBG A;  1MGT A;  2EM0 A;  2JOB A;  5AE2 A;  4R2Q A;  1RC7 A;  2YRK A;  2LUP B;  2L8T A;  2J7J A;  2ODR C;  4DR3 E;  5KL7 A;  4L0I C;  1GQE A;  2ENH A;  4HLH C;  4O24 A;  2R76 A;  2YU8 A;  4OX9 E;  2UUB E;  1GTK A;  3OEI A;  4X8W A;  2LUQ A;  2D9H A;  5KL6 A;  4DV4 E;  1G2D C;  2JYA A;  2UXC E;  2DRP A;  1GZ6 A;  5T6J A;  4WSG A;  4KWY A;  1IBL E;  1DQ3 A;  5TSE A;  4JI6 E;  3KZY A;  3OEI E;  2EL6 A;  3THN A;  2EOS A;  3L00 A;  2UUA E;  4LF8 E;  2EQ0 A;  4X62 E;  4LFA E;  1YYK A;  4KZQ C;  4KZU C;  4BC9 A;  4HEI A;  3KH2 E;  2L33 A;  4LF6 E;  5CFF E;  2YU5 A;  2ODK A;  2CPN A;  3K33 B;  4WPY A;  3BBG A;  4TUI A;  2HGH A;  1L4S A;  3ADL A;  1UIL A;  4P78 A;  1T4O A;  4F2J C;  5KL5 A;  2V86 A;  1J26 A;  5LLQ A;  4ZYD A;  5A6A A;  2EN6 A;  2V88 A;  4RHB B;  5AC4 A;  2I9I A;  2ZIX B;  4O5G A;  4GEQ B;  1P47 A;  1EKZ A;  3MHS C;  3C4B A;  3HXL A;  1F2I G;  2UXD E;  2IHR 1;  2WBT A;  4B3R E;  1IMU A;  2DSY A;  2EOY A;  2M9A A;  2VE7 C;  2EN7 A;  4LU9 A;  2EP3 A;  4NXN E;  4NXM E;  3BGH A;  2EE8 A;  4LF7 E;  3HTX A;  1WHQ A;  2EMF A;  4L2F C;  2LRS A;  4UI3 C;  2EM5 A;  1NCS A;  3T1Y E;  2V87 A;  4DV0 E;  2EMH A;  4DR4 E;  1ZBT A;  2EMK A;  2LTS A;  4F9B B;  1N33 E;  3VK6 A;  2MDG A;  2B9D A;  4F6M A;  3P1X A;  4TUG A;  2I13 A;  5ADR B;  2A25 A;  3IWD A;  2YTI A;  4X65 E;  1ZBQ A;  1ZR9 A;  4M30 A;  3DJW A;  4GZN C;  4HKI C;  2YSO A;  4HLF C;  2EOI A;  4M9V C;  1YFH A;  5ADT B;  1TF6 A;  2KOU A;  3HJ6 A;  4LFB E;  1ZAA C;  3HPS A;  4JYA E;  2G7H A;  4HMH C;  4LFC E;  2EOO A;  2DMI A;  3F6H A;  1BBG A;  4L32 C;  4ZM0 A;  4R8O A;  1X5W A;  2YTE A;  4O4K A;  2MKD A;  3AV0 A;  3BF2 A;  2EPR A;  4L0T C;  4R2C A;  1A1H A;  4F6N A;  4JI7 E;  2RQL A;  4DR2 E;  4L10 C;  4L8N A;  2JR1 A;  1A1F A;  1XMQ E;  2JY9 A;  2EM3 A;  4HTG A;  2DGC A;  3EPH A;  2EPX A;  4R2P A;  2UUC E;  2EN4 A;  2V89 A;  5FLX C;  1UN6 B;  4DV3 E;  2N3G A;  1X6E A;  4WX9 A;  3J7A G;  3RMP A;  5IT9 C;  4R03 A;  5LMN E;  4WYQ B;  2UXB E;  3FIG A;  1A1G A;  2EM6 A;  4AQY E;  1JK1 A;  1HNW E;  4UI4 C;  3LLH A;  2YPN A;  5C5P C;  2CTD A;  2L2K B;  1BB8 A;  4L31 C;  3J7Y p;  4BHB A;  2EOX A;  3HRY A;  4BC7 A;  3T1H E;  1T39 A;  2L92 A;  4JI2 E;  4KZS A;  2EOZ A;  4L33 C;  2EQ1 A;  2E1M A;  4IJD A;  1WXR A;  1YSA C;  3D55 A;  1HR0 E;  1QU6 A;  2JP9 A;  4X9J A;  2UU9 E;  4N4R B;  3KWR A;  1SR9 A;  1DGC A;  1XNR E;  2EOJ A;  2EN8 A;  3BID A;  3ADJ A;  4YY3 E;  1UHZ A;  2RS7 A;  2EOH A;  2L2M A;  5IWA E;  4LF9 E;  4JI1 E;  2EN1 A;  5A6B A;  4BS9 A;  4YHH E;  2WBS A;  2ZM6 E;  2YSP A;  2N8X A;  3OTO E;  2DB2 A;  3VHT B;  2JVA A;  2EMZ A;  4FK5 C;  2VRD A;  1FKA E;  3MSW A;  4L34 C;  1DI2 A;  2R1F A;  5A6J A; 
#chains in the Genus database with same CATH homology
 2M1S A;  3P1X A;  2F4V E;  2L3C A;  2RSM A;  3LML A;  4I8O A;  4WFT A;  1N36 E;  4TUG A;  1YZ9 A;  1STU A;  5DNY A;  3HQ1 A;  4LF4 E;  3F6G A;  3IWD A;  4X65 E;  1ZBQ A;  4DUY E;  4M30 A;  2V85 A;  3DJW A;  1X49 A;  4X64 E;  2A6Q A;  2JOX A;  4DKK A;  2B3T B;  3ZOQ B;  4B3T E;  4DR1 E;  3J81 C;  2V83 A;  4K0K E;  2KOU A;  4F54 A;  4JV5 E;  5AAS A;  4DR7 E;  4LFB E;  4JYA E;  3HPS A;  2G7H A;  4M0V A;  2H36 X;  4X66 E;  4LFC E;  2MC6 A;  4WSP A;  1J5E E;  3F6H A;  3CTO A;  4DV5 E;  5AE1 A;  5F3W A;  2LMZ A;  2K4V A;  4Q28 A;  5A2Q C;  4ZM0 A;  4P7D A;  4R8O A;  2JOB A;  5AE2 A;  4DV6 E;  4LTY A;  1RC7 A;  1HNZ E;  3AV0 A;  2LUP B;  2KON A;  2L8T A;  2ODR C;  4DR3 E;  3VYY A;  1GQE A;  4B3M E;  4JI7 E;  2EZ6 A;  4DR2 E;  5LMU E;  4L8N A;  4OX9 E;  2JR1 A;  2JWO A;  2UUB E;  3OEI A;  4X8W A;  2LUQ A;  1XMQ E;  2JY9 A;  5LL6 R;  4DV4 E;  4JI4 E;  4ZLX A;  2UXC E;  1GZ6 A;  5T6J A;  4GKJ E;  2UUC E;  2NA2 A;  2V89 A;  5BR8 E;  1DQ3 A;  5FLX C;  1IBL E;  1HNX E;  3IWB A;  4JI6 E;  4DV3 E;  2N3G A;  3JU0 A;  2VQF E;  3OEI E;  3J7A G;  2WZO A;  3RMP A;  5IT9 C;  4R03 A;  5LMN E;  1XNQ E;  2V8Q B;  4WYQ B;  2UXB E;  2UUA E;  3FIG A;  3G5O A;  2L6M A;  2M4I A;  4LF8 E;  4AQY E;  4JI0 E;  2B7T A;  2L2N A;  4X62 E;  4LFA E;  2VF1 A;  1YYK A;  1HNW E;  2YZT A;  3LLH A;  4JI8 E;  4DV1 E;  4JI5 E;  2FTX B;  3DF6 A;  1O0W A;  4BC9 A;  5ADZ A;  3ADG A;  4L5N C;  1I94 E;  3KH2 E;  2L33 A;  1T4L B;  2L2K B;  4LF6 E;  2B7V A;  5CFF E;  1YYO A;  2ODR D;  2ODK A;  3HS2 A;  2CPN A;  2F8B A;  3J7Y p;  3K33 B;  4WPY A;  4ZM2 A;  2LTR A;  4DR5 E;  4F9C B;  4TUI A;  3IWC A;  3ADL A;  3HRY A;  1UIL A;  4P78 A;  1N34 E;  1T4O A;  4LF5 E;  4BC7 A;  3T1H E;  2L92 A;  4JI2 E;  4KZS A;  1X47 A;  2V86 A;  2L3J A;  4OOG C;  2E1M A;  1RQ0 A;  1WXR A;  1J26 A;  4DV2 E;  2KHX A;  3D55 A;  1HR0 E;  4F9A B;  1QU6 A;  4DUZ E;  2V88 A;  1IBK E;  2UU9 E;  2FGG A;  3H09 A;  3KWR A;  1SR9 A;  4GEQ B;  1EKZ A;  1N32 E;  3C4B A;  3HXL A;  2UXD E;  1PKP A;  2IHR 1;  2RS6 A;  4GKK E;  3K6Q A;  2NUG A;  4B3R E;  1XNR E;  2DSY A;  2LE2 A;  2NUF A;  2VE7 C;  1X48 A;  1T4N A;  3ADJ A;  1UHZ A;  3OML A;  2RS7 A;  3JTZ A;  4LU9 A;  3JAM C;  5AE3 A;  4YY3 E;  2L2M A;  2HHH E;  3ADI A;  5IWA E;  4LF9 E;  2EWL A;  1IBM E;  4B3S E;  2YT4 A;  4NXM E;  4NXN E;  1XMO E;  3HTX A;  2E5L E;  2VQE E;  4JI1 E;  4LF7 E;  1YYW A;  4DR6 E;  2DMY A;  1WHQ A;  2LRS A;  4BS9 A;  4YHH E;  2ZM6 E;  4DV7 E;  1FJG E;  2FV4 B;  2RTX A;  3OTO E;  2DB2 A;  2LJH A;  2MDR A;  3HPZ A;  4JI3 E;  3T1Y E;  3VYX A;  2V87 A;  4BCA A;  2JVA A;  2DIX A;  2M7Q A;  4DV0 E;  3AUZ A;  1FKA E;  3MSW A;  2MC5 A;  4DR4 E;  1DI2 A;  3J80 C;  4M2Z A;  4KHP E;  1ZBT A;  2LTS A;  4BBY A;  4F9B B;  1N33 E;  4J8Z A;  3VK6 A;  4DMI A;  4BMJ A;  2NUE A;  1WHN A;  2N3H A;  2LBS B;  3C4T A;  2B9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...