2ZIXB

Crystal structure of the mus81-eme1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
322
structure length
259
Chain Sequence
ECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQESRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGETSRRIGPELSRRIYLQMTTLQPHLSLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crossover junction endonuclease MUS81
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 21
structure length 259
sequence length 322
ec nomenclature ec 3.1.22.-:
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zixB03
3.40.50.11760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zixB02
3.40.1620.30 Alpha Beta 3-Layer(aba) Sandwich YefM-like fold YefM-like fold 2zixB01
4P0PB 2ZIVB 4P0PA 2ZIVA 2ZIWA 2ZIXB 2ZIWB 2ZIXA 2ZIUA 2ZIUB 4P0QA 4P0QB
chains in the Genus database with same CATH superfamily
2VHZA 2HBZA 1JL3A 3GA5A 5J5CA 3QG5A 3SR6A 1EWYA 2Q1WA 3HHPA 4FP9A 4P92A 4YRTA 2XI4A 3U4QA 2DSTA 4LXIA 1Y4SA 3M6ZA 2PKQO 2Q27A 3ZD9A 3GAAA 3RB8A 5E1OA 4I9NA 3TB4A 3GP8A 4LXTA 1JR3D 1Q1NA 2XVYA 2EZYA 3EQ2A 5CLLA 4AJ2A 1Q15A 1G2IA 4RDHA 3T94A 3PKZA 4W1SA 5D5HA 3ED1A 3FOZA 4CEIB 4YC7A 1V0JA 4D0NA 4MWGA 4HGRA 4I1YA 1P31A 1R5BA 5AM2A 1H2RS 4NJEB 5JZMA 4F72A 4UTXA 4OK3A 4EHFA 2CCKA 2C8VA 2FMHA 3P9YA 3KE8A 3WTBA 4PJ0U 2P6OA 1QIKA 3AUTA 2JD2A 4EB6A 2FWAA 3RR7A 2ACVA 4IIBA 1KYZA 1TQHA 3TQCA 1X7ZA 4NCNA 3DONA 2OUIA 3ZUGA 2JHCA 2NW6A 4F4KA 2NVUA 4KN9S 3VSCA 1RYNA 2XNSA 5K99A 4HLGC 3CEMA 4GXJA 2VNKA 4IJUA 1V8DA 2I29A 2XRFA 2A1IA 3U7QA 3ZDDA 4JIGA 5DBEX 3VM6A 3QWBA 3FUVA 4CV3A 3WS7A 3PCXA 1HOXA 1KIFA 4CFZA 4WXHA 4JDUA 3CV3A 2CD7A 4EFDA 3MBOA 2N9UA 2O3UA 4IIJB 2QZSA 3A9CA 4UB3A 3RD5A 1LF0A 1FZTA 4X7BA 1FSPA 1JKJB 3DNFA 1TUIA 4PZZA 1MEJA 1U04A 2JZNA 4BFYA 5HKLA 4P0TA 2DWPA 3UJHA 3ESRA 4Q3NA 3TLGB 4D92A 4EEZA 1PFKA 2VRNA 4PCVA 5KQGA 4XYLA 2PD3A 4E2XA 2HZ7A 4OX9Y 3H9JA 3PD7A 4RV4A 4NR0A 3S70A 4XD7D 4MPPA 3N86A 4ACBA 1G66A 4KRXA 4UNPA 5KNBA 1XFDA 1O96A 3OX2A 4Y18A 3BK7A 1AKRA 5KPJA 4R1OA 4TMVA 4ZC8A 4YRAA 9GPBA 4RIGA 1VBFA 2O4CA 9ICOA 4P93A 3BFXA 1PR9A 4ECEA 4MZXA 1PEYA 4ZARA 4MSUA 4CQMD 4RQ6A 3LCRA 1NOJA 1GTJ1 3R74A 4PL2A 3E03A 4XIYA 3KTDA 3GO4A 3BDVA 1JU4A 1M8KA 2H5IA 2ZYIA 1F60A 5B4TA 4QXAA 4YHBA 2PGNA 3C23A 3RSQA 5KFHA 1P60A 3H0MB 6LDHA 4F86A 4P7KA 1ZK4A 4GM0A 5K3BA 3I72A 3QSYA 3ENWA 4OGLA 5H68A 4QODA 5IC6A 5T14A 4AYTA 2WJ4A 1DBQA 3B8EA 3AK4A 3FRJA 3O4IA 4LK3A 1I1HA 1NI4A 1KEEA 2A57A 4OJOA 2ZSIA 1ZUHA 1ZHHA 2NU9B 3MWDA 3U7HB 3AZQA 4RTJA 1JHYA 5AKXA 4Y6GB 9ICXA 1KBQA 2BDPA 3M1IA 5DI3A 4IY1A 3C5FA 2FE9A 2QR5A 3IKVA 4C3ZA 3ZEAA 1IUNA 1RXCA 1PWYE 4ZO8A 5IIMA 2CXSA 3Q3GE 1Y9EA 3C1UA 4KP7A 4GX0A 4C9BA 4H3SA 5AOCA 1E8NA 2ZYRA 4MVJF 2IXGA 3MJHA 2B94A 1LPAB 1FVXA 4CG0A 2OMEA 4RD3A 1IH8A 3VO1A 2J33A 1IEXA 1NAHA 1OREA 3IVXA 2BVNA 4RVHA 4KBFA 1XD8A 3UFBA 1CF9A 1BXZA 3AF4A 1E2NA 5CW1A 2PX3A 5HX7A 4HDCA 5JVDB 4MUIA 1NMSA 1IBLB 1YS6A 2H5EA 1UBMS 2JL1A 3CTOA 4MLPA 4KFRA 1EFDN 2GBLA 5FOTA 4TUQA 2BHTA 1V48A 1MFZA 1Q12A 3A9UA 2FZ5A 1YCFA 2WKSA 1ESMA 4QDTA 1JE1A 1T3QA 5BV8A 3AM3A 1NN1A 1MVOA 2EG9A 5BYJA 2IGTA 3IAAA 4DSNA 1YC2A 1O8BA 2IW3A 1AS2A 2H8KA 2XZDA 4MULA 2KMDA 3CUTA 2H4HA 1A9TA 4ZVSA 2O5EA 3KUUA 2YZ7A 5JAHA 2C59A 3ITKA 2IXFA 1XZ8A 1ZN2A 3M6WA 3I28A 5IIKA 3B6EA 4G2TA 2YTZA 5E1BA 5KVSA 1BW9A 1XHLA 4NENB 4YONB 2BFCB 1DWOA 1KOLA 2JFYA 5EIHA 2JIDA 2JZBB 3EN0A 2VDLB 3ROZA 1CUUA 2Q07A 5BP7A 4IDBA 4BTEA 3ZCQA 3KDPA 1L3BA 1O6ZA 3N05A 2JFOA 3FBTA 1QQ7A 2P4SA 2ISPA 1YXMA 1O89A 2XCLA 5L3QA 1D8YA 1T5BA 1CUDA 2J6HA 4KVGA 3KAQA 5COQA 2QRQA 2YQ5A 2Z6UA 2WSSA 3TNDA 1R9NA 2OH2A 1P5ZB 1SD1A 3KUXA 1WXXA 1VCMA 4DL5A 2GCPA 4Y1EA 4OL9A 5ALPA 4ZCQA 4G4IA 4QUAA 3NX4A 5JNLA 4QQFA 5I3ZA 3DFUA 5CM2Z 1IXZA 1EFRA 5HFJA 2RK4A 4HWRA 2PMZC 4CT0A 2WIFA 3EMVA 4A10A 1D1TA 4BBZA 4E70A 4JK3A 5IKXA 2YDYA 3QVLA 5THQA 3GVCA 4O3OA 1QX3A 4D46A 2ZAIA 3B9RA 3NORA 4G56A 4O2AF 3V8VA 2N47A 1TNDA 3TVYA 4OLBA 2CLFB 1ZLYA 3EGEA 2W9MA 4RH3A 1QTIA 4GYKA 4D7AA 2ZJ1A 2HHCA 2YFYA 3V9PA 1V7PC 2PZFA 3N2KA 4AG5A 1VBKA 1D2MA 1ZC3A 1YVRA 1T0JB 3S2SA 4F4CA 1YQWA 4YBZA 5BVHB 3SHWA 4DA4A 1JLRA 1W52X 3WLQA 4HYTA 4Q15A 4CKEB 4CMKA 1ZM2A 2XNJA 2J3DA 2RCYA 1E7QA 2VPPA 3S2UA 1MO2A 1TE2A 5C2JB 3AYXB 1S89A 4HNAA 4AG3A 1XCPA 3TDNA 3EZLA 2CE7A 1F51E 4YJFB 2WUDA 2ZU0C 4KKXB 4PAOA 1SQ0A 1XVTA 4NL9A 2VHXA 3HLTA 4AS2A 2JARA 4PCLA 4B3IA 1XALA 3JQAD 2EOAA 3KZMA 8ADHA 2VJCA 2WMNB 2WIKA 1OYOA 1JLKA 1V2GA 1RZ3A 4W9RA 4D9IA 2QTAA 1R6XA 2PR7A 2F44A 1PSZA 1YSCA 2CL6X 3QNWA 4UULA 3FYHA 3QY9A 1EVJA 3PDUA 3HMQA 1AUXA 2FFAA 4ZCTA 5JAOA 4HXEB 1GTMA 1MQ2A 2NSHA 1UMBA 5DLQC 2BGGA 1N62A 2WLSA 5EJ8A 1ML4A 3N07A 4QWBA 3BB4A 2MYTA 1JG2A 2ZXUA 2GCNA 5GJVC 1J0AA 5ICMA 2E85A 5T6BA 3OY2A 2X4LA 4MKRA 1Q1ZA 4D45A 3EGCA 5AH0A 4EG7A 1OU4A 2DT5A 3BWMA 3FF4A 3HCPA 1F5NA 3ETLA 4I9GA 4E08A 3UPDA 4CKWB 2LDXA 2I67A 4FKBA 2X76A 4B3GA 3DJFA 1JIXA 4HQ0A 3ROEA 2ZT5A 1G8YA 1A2QA 4QBFA 2O0JA 3RANA 2PZAA 4LF9B 3TOZA 4NONA 2AEJA 3MCVA 5KYGA 1ENOA 3VHXB 2FLNA 2NPIA 4WOKA 3M4YA 2QJTA 3P2JA 1UP4A 3CUVA 5HZMA 3NETA 4O02B 1ZQSA 7ICUA 1NC3A 2CL0X 4G0PA 3VYVA 3ABQB 5JTIA 2RHOA 1H23A 4HMPA 1U8AA 3RVSA 4RPXA 3IKMB 1I1OA 3EX7C 2GPSA 2EZ4A 4PO8A 1K4MA 3UBTA 1DRUA 4II3A 1OVMA 3EEFA 2ZR7A 2ZYGA 1ZGJA 3HACA 2B7BA 2J32A 3AQIA 4Z86A 1UZLA 5B7PA 2AW5A 2IX3A 3P0RA 3QLTA 4TXNA 3SV4A 2Q4TA 3LQKA 4W1QA 2JBWA 2CJYA 3KOMA 1MH9A 5DLFA 4XDYA 1NUPA 3KHLA 4XUSA 1LV7A 1TFRA 1COZA 3G8CA 3HXOA 3NR2A 3QNUA 2W4MA 5L3SB 3HA2A 3LY7A 3OIGA 4YUYA 1HE1C 4QOHA 1XIVA 4RNMA 2DOKA 4H6PA 1D6JA 8ICGA 3QOWA 2BGJA 1Z7EA 4RS4A 3Q7RA 5CB6A 3EF1A 3G9TA 1PFYA 1YL7A 3T4PA 1OYWA 2P9FA 1RLIA 3IQIX 3U3ZA 3L0BA 3USZA 1RCTE 4L6CA 4E0BA 5BRJA 2DZDA 4CR6A 3VFDA 4D2IA 5F9FA 5GY7A 3VTZA 1KZ6A 2E5LB 2HJHA 3GJYA 2VSNA 4O4LF 1E1DA 1K7FB 3SR4A 3RAXA 1HZJA 5A6VA 3GUYA 3SSAA 2TRSB 3UAOA 5CBPB 5BOSB 2YW9A 4AKHA 3MLBA 4RJKA 3G9XA 1N4DA 1EJ0A 2PJDA 4QLAA 3FGOA 2VXCA 3RKSA 2I1WA 3T52A 4LZWA 3U3MA 2VPZA 3VCBA 3AHHA 9ICMA 3ZE8A 1GPMA 2PFQA 3DMYA 1ZPDA 5EJGA 2ZBDA 1U2RA 2VYND 4JKYA 4BN5A 1QB8A 1KVSA 4ASUA 2XQKA 1Y5RA 4DLXA 2JKVA 3WRXC 4U7FA 2FN4A 4K9LA 1CP3A 4YDQA 1SAYA 1ANKA 4P5EA 5DBOA 3I39X 1D5WA 1O95A 5LOVF 5CDGA 4MWEA 2DB3A 3PYLA 1ZI9A 4D4GA 4HLQB 5B7GA 4OHBA 1LV8A 1TADA 2JANA 3QKWA 2H2HA 5EIWA 4D97A 4ETMA 2DH6A 9ICNA 1HZZC 3JD1A 1L4NA 4B9AA 2O0LA 4F11A 1DXOA 1XVAA 2IIBA 1JZTA 1CY0A 5FOXA 4NJMA 4P84A 3CLKA 1P3DA 3WK9A 3TIFA 3BS4A 4NZYA 2YVAA 3TQIA 3TQQA 1Z7GA 2CV2A 4QOIA 1DV2A 1L4GA 2CFCA 3QYAA 4E5PA 4ZCRA 1HQYE 4JOCA 3ZZ0A 2VDPB 4A0GA 5LXTA 1DS6A 1ORIA 3NEYA 5J2FA 1EDZA 4DZTA 3PC8A 2XCQA 4EMUA 1XLVA 2W2XA 4U5QA 4HLCA 5T4FA 1R6BX 2R6HA 2LTAA 3OHBA 2PWPA 3P0IA 1XKXA 4ZHQF 1GPKA 1R4ZA 5SYAA 4BWMA 4RF4A 4X71A 5L9AA 2ILVA 2OV2A 4JI8B 3BERA 3H5RA 1J2UA 4HKKB 2JFHA 3BCHA 8ICWA 1FFSA 3C6YA 3HXKA 1AQUA 1T10A 5C7IO 4M0KA 3CBQA 5FIUA 4ZXFA 1EMDA 3NC0C 1AZSC 4L2KC 3OLWA 2WW8A 3R41A 4AULA 3M2PA 4R2XA 4ZALA 4X7RA 4V3BA 1VSVA 4RY2A 4UCFA 2JIBA 4M9JA 4ZOAA 3UVEA 1SCAA 4NOKA 5FL3A 2ZTEA 1L5UA 3NVVA 1JHUA 1H42A 2BF7A 1WWUA 4TKLA 3M0EA 1YT5A 4CF4A 5A5GA 3WMRA 3EPIA 2GFQA 5H80A 3KOYA 4FZ3A 2HWUA 1CQPA 4UHCA 4TTSA 4ZJYA 3AG6A 1W9HA 3VZBA 2QRGA 3BMCA 2F1RA 5CVJA 3OPXA 4US0R 4RT3A 2WQ7A 2A1JA 4V1CB 2C7QA 1BXKA 2ADFA 1MABB 5ADRB 2OV6A 4XDHA 4UBJA 1A9SA 4DLPA 1RI3A 1APBA 3QXXA 4TLDA 2GZHA 4IMPA 3P52A 1YR2A 2FPKA 4P3XA 4EQZA 4CT5A 4C4TA 2AXQA 1D0VA 4IDOA 3RSCA 2BFWA 2RH5A 5A3JA 3W1VA 1V6AA 4Q00A 4GEKA 5JCPA 3BCSA 3DM5A 3K9CA 4CMBA 2HUNA 2IIVA 3D5TA 5CDFA 4F71A 3SKVA 2XXJA 4QYIB 5GAJA 1U3DA 1WKVA 2WAYA 3V7WA 4Y3UA 4UTPA 2ZYHA 2FSSA 4JOSA 2EL7A 3A6ZA 5BQFA 4H18A 1RWXA 1N3IA 3LWZA 2ZB3A 1JT2A 1CY4A 4H1UA 3EBPA 3R0QA 5HHTA 1KPIA 4DPKA 1T2NA 2CVPA 4A73A 2B36A 2VCHA 1HT0A 4LSZA 5CRXA 1NVXQ 2YQEA 4IDGA 2R7AA 3M6AA 1RJ9B 3BMOB 2QAGC 2QMQA 1E2IA 1T5SA 5AVVA 3ASYA 3P32A 4NLNA 1A4IA 2HXGA 4BMZA 1JTFA 4D4JA 1YULA 3P97A 2P4EA 3RUCA 4I2AA 4I5FA 2P9EA 2XWBF 5E6RB 5ECWA 5KYYB 4Z8XA 1RIIA 4IX9A 1VI5A 2XA9A 5FPSA 4ALIA 5DRTA 2Q2NA 1I2BA 5AO9A 2G9RA 5GTIU 3ESBA 4XCXA 4XOUA 3OJXA 3RW9A 2YJ4A 4DL6A 3PHJA 2E18A 2Q7XA 1DV1A 3UKDA 2KZ3A 1SC1A 4HVLA 4I3FA 4D9EA 1ZSNA 4FGSA 3ZW9A 3HYTA 4RPGA 1ULUA 4D9JA 3S7ZA 2D1QA 3ODGA 1ZQEA 1NURA 1V3QE 1EZ4A 3PXDA 1MPXA 1N25A 3MJDA 5GM2A 3OQPA 2ESEA 1MC1A 5L7TA 1UBRS 9ATCA 3L7CA 1G5PA 3RH6A 4BQOA 5IANA 4KU4A 3RVRA 1IN1A 2B5VA 3A9VA 3S8MA 2IPMA 2MR5A 1SH7A 3OQMA 3LKBA 4ED0A 1JP7A 7MDHA 4HXYA 5T5QA 4L22A 2EW2A 4TQGA 4DJAA 4C4RA 5IJXA 3AJEA 2C42A 4E22A 2QSUA 3WL8A 1UMCA 3LQ2A 1L7OA 6AT1A 4MDFA 1M1YE 5K6AA 5DG8A 1IQUA 4J07A 1M3SA 5LB4A 3ICCA 9ICKA 1E6WA 4KPFC 1MFPA 1P4AA 3AM4A 4NZOA 4QZAA 3FHTA 2DKFA 5HGXA 2KW5A 2WTMA 3EYAA 1XZNA 3AN1A 1KDPA 3IDOA 4BRUA 4M9QA 3PT9A 4ZVTA 4A7PA 5BSHA 2VAPA 1XZAA 5G4KA 1QHSA 4JUCA 1NY6A 2Z3VA 3WGIA 4TV9B 3W2TA 1ZSYA 5DB8A 1TT5B 1YQ9A 5KX5F 3VGPA 3OT4A 1ZOOA 3CSDA 3W1EA 3AFNA 5BOMA 5KT2A 2E4ZA 4CI0B 4PYIA 4KFSA 1D9ZA 2QL7A 2IZ7A 1SGGA 3HB9A 3CW2C 3E18A 4PPFA 2XY4A 2HZBA 4PZCA 1FJHA 3HNOA 2ZFUA 4W5TA 3CLSD 3ZGYA 2EHJA 2Q3CA 3OO0A 4B09A 5EVJA 4UNRA 2RC5A 4QUBA 1ECJA 4R7GA 2Z2ZA 4Y2TA 2UXDB 4C0WA 1B6GA 4RLSA 2W9CA 4HWPA 1ABBA 4Z0PA 3CUSA 4I50A 2XO7A 3EJWA 4MKZA 4CCSA 2X8JA 3IP5A 1S4MA 2LMRA 3OX4A 3FRIA 2DKZA 1UDCA 4JNCA 3V00A 2FLVA 2I9PA 1A98A 3RC7A 2XUIA 1G5TA 1ZS9A 2LE0A 3I45A 1GZDA 1RP1A 3NS7A 3P5BA 5KJ1A 3CB4A 4QRIA 3UJBA 4RF2A 2IH2A 2H1CA 4TUSA 5DNWA 5H7XA 4F9GA 1MHPA 1W0JA 4TSFD 4ZEMA 4MVJA 2BPFA 4P33A 1HL7A 2XLCA 3ZJ5A 3IFSA 1I80A 3AV0B 2H2WA 3PNYA 1KAHA 4KLDA 3OTGA 4N82A 3DGEC 5GZ1A 1LNQA 2X1VA 4TV8A 2IBMA 1CEXA 1ECPA 3KYIB 1FDRA 2G04A 1D04A 4GU5A 4I08A 4D56A 4AY2A 1BGVA 3EDMA 3H16A 1GNPA 2GD6A 3WLKX 4S0ZA 3TGLA 3G1TA 4MPJA 3OZGA 4FDVA 9ABPA 3KR0A 1Y3AA 1MHTA 5IP5A 1ZZEA 4M1QA 2VJNA 1PDOA 1GQRA 4QD3A 1E3WA 4IGIA 2GTHA 1Z19A 1U9JA 1V5WA 1NXPA 3PL1A 1L9KA 2FN3A 2R68A 4RXMA 4IV0A 1AQ6A 5ALXA 4EB6B 4DMHA 2CHQA 5F2OA 1X7ZB 3DEZA 2XUDA 1ABFA 1JHAA 2NTNA 3HDYA 4LJAA 3RVJA 2FPMA 1UDWA 4KYVA 4CCHA 2ALZA 1ZVJA 2XC9A 1BWSA 1GNQA 3K0HA 1DAFA 2H2DA 3FVTA 1WU7A 1JPUA 4NPCA 4Q7QA 3SJCA 4J9SA 1G8FA 2H3IA 1LBQA 4TM7A 3UMRA 3HEMA 2GZDA 2XQGA 5LNK1 1OLUA 2QZZA 1RCUA 1WUTA 2IYFA 2LKCA 1N56A 4L0VC 1AY0A 2EBHX 2VQSA 2NZUG 3DXFA 4Z4CA 1H0KA 4MR9A 9ICRA 4ZJUA 3C3AA 4EYHB 3CBGA 5F51A 5HR6A 3BA1A 4RC9A 2VDJA 1KVQA 3AY3A 5EG5A 1D6SA 5F9HA 4MVJG 3FW1A 4BMPB 4F5PA 3RRBA 4DLBA 4YJ3B 5F4ZA 4D41A 1V47A 1TZKA 4XIIA 3NDIA 2D74A 1QFJA 1CI4A 5KVAA 5H16A 1O96B 4HFRA 3EH2A 3GZTB 2IWHA 3QXHA 5LQDA 4NL4H 1M1NA 1Q6YA 2HWKA 3QF4A 4TTRA 2WIAA 4ZQCB 4KLRA 3LPLA 5CIQA 2FB9A 2HYDA 4UPVA 1WKCA 3DDOA 5T8KC 1FP7A 4KACA 1TDJA 4H7HA 2EF1A 5K8IA 3D4OA 2MUTA 3KHGA 5IRCD 1Q3UA 4BECA 2PX8A 4BO0A 4BVFA 1RRMA 5EZSA 1YOVA 4KKVA 1Y81A 4QWWA 2R6FA 2E4XA 4UM9B 1TEXA 4UXHA 3T34A 4Q1FA 3HUTA 4AIRA 1Z07A 3L0CA 1PLLA 1LFDB 1L7RA 2VI5A 3EGXA 4CL3A 4BO1A 4EPRA 5IVIA 1KQPA 4W8GA 1MORA 5AI6A 2I4NA 3NOOA 1L6RA 1QE3A 1NI4B 1KEEB 4BEBA 5L3RA 5FORA 4DDMA 3G0GA 3KXPA 1J07A 4TUYA 1I3NA 3H5OA 3SZMA 2F43A 3MWDB 4K1LA 3KE9A 1JEDA 3MCZA 3GUUA 3RV4A 4KLIA 5MHTA 1B15A 5DI3B 2JNWA 1Q3HA 2MIIA 3V55A 1YDGA 1ZD2P 2OPHA 1G1AA 4A26A 3J81j 3SBEA 4M37A 1NK7A 4UB6U 3G6VA 1V1MB 4RFVA 1Z0IA 2IXDA 5HOEA 1PVOA 1X14A 4K81B 4AI6A 4F1WA 4R7ZA 1JRPA 3IERA 5C35A 4ECRA 1VHJA 4R1UA 4HVAA 2FFRA 1VGRA 3QMWA 1WBJB 2YCBA 1NT4A 3ACCA 1EA5A 3AM9A 1NNI1 2WSBA 5ETJA 2BN4A 3F5SA 2LV8A 1OKKA 4DQIA 1Y1RA 1A2KC 4OFWA 4MS4A 3IOYA 3LMKA 3W5DA 3WXMA 1UAGA 1ZGGA 1Q17A 4P08A 3IDSA 3IVMA 1SUBA 3LE8A 4YCMA 1ZMOA 1GPH1 3KDSE 4Z4FA 4U0KA 2WB4A 4I46A 1SV0A 2EAOA 4O59O 1TO2E 3QPWA 1H9AA 1LW6E 5DCYA 4UM8B 1YT3A 3RRHA 1L8XA 5AW8A 4ZCPA 4H0NA 2RGUA 4XYGA 1Z5UA 3T0FA 3CKMA 2C83A 4QDKA 3FCAA 1TZMA 4GP9A 5K01A 4MFCA 5C9ZA 5DFAA 4CL8A 1P33A 4V2UA 3WIUA 4WCFC 3PHHA 1YZ3A 1L3VA 1Z17A 1SIOA 3RT7A 1VHQA 2C5SA 1JHMA 4YUXA 2PT5A 1UMDA 3KYBA 1YI1A 2EZZA 1T1SA 3NBZC 4Q4HA 3HJRA 5DM2A 2W6IA 1UBUS 1BW9B 4TL6A 3FI9A 2XMDA 1XWFA 4JLJA 3GA7A 3C98A 4DR7B 1U9YA 4D9KA 4IDAA 4TUPA 2GN6A 1GGEA 3JPNA 4RPYA 3H2IA 3UB2A 1TAMA 4XPZA 3K71B 2BEVB 4LY9A 2Z2KA 4E6PA 3FTFA 5IAAA 5I3CA 3AHGA 3HFJA 5DHSA 4KGVA 3EPHA 5DGBA 4YD1A 1H85A 1S4QA 1SUAA 4BX0A 4MVYA 1TMYA 3IP4B 3RYTC 2FW9A 5BSGA 2BONA 3BFJA 1GPAA 4F93B 3LRXA 1T6YA 3H0KA 4P4NA 4ZU1X 4MUJA 2W43A 4GO1A 3QJGA 1MB4A 3EF3A 3GT4A 3PC2A 3JQ9C 1HV8A 3CUYA 5AVYA 4N18A 1A8QA 3HS2A 2P69A 1LC0A 5JCJD 2YB1A 1TQ8A 4QJ4A 4IPTA 2NO7A 1M1YB 2ADMA 4QTUB 3VJLA 5LYYA 3EE6A 2I3ZA 4J75A 1OTHA 4RL4A 1PR3A 1YZQA 1NBME 3WDKA 3DZIA 4FFPA 2BL4A 7ICPA 2HHHB 3L7YA 1T5OA 1U8FO 2PWBA 1JECA 4EA8A 1IZ9A 1BH6A 4Z1MD 3D8HA 2DUNA 1DJOA 2QZ4A 3PNLA 4NZPA 3NHJA 1RWNA 1LJ8A 2JEJA 2CL5A 4B8ZA 3ZVLA 4NI5A 4G0VA 4E4RA 1I0LA 2RKWA 4DJEC 1LB2B 3ZNPA 4RHUA 1KAOA 1NXSA 2HRDA 3N2KB 3UTDA 4XI9A 2I2CA 1G20A 4GC6A 4KTVE 4BS9A 1SC9A 2C2MA 2P5UA 4PY2A 1U02A 4UUBA 1PYDA 4O4LA 1ACLA 3A3PA 3F9IA 5B1DA 2C99A 2GTPA 3ZPXA 1HYQA 4ENVA 2GVZC 2KYRA 3PV8A 3ZHYA 2YWBA 4DNPA 3MRTA 3O0TA 1XYGA 4HDRA 4OQXA 5ILQA 2VOEA 1KPGA 2PO7A 3UOWA 2VF7A 3QUQA 4MI6A 4L9SA 3GJ6A 1VKOA 4OK6A 3E9ZA 2JMGA 5TISU 5SZHB 3V8BA 3I2KA 4JP3A 3T7AA 4EENA 2Y77A 3GY0A 4YO8A 1VLVA 3WICA 4C8KA 1DJPA 1SZCA 5DHQA 1NZPA 1L5SA 1VOTA 3D1VA 3F47A 3SJBA 1BWQA 4RCZA 4PC2A 3FUWA 3RNLA 1CEEA 2NXNA 3FZGA 4WK6A 4DUPA 3BD6A 4IBOA 1KKLA 2H06A 3RHZA 2VJBA 5FUWA 3TKYA 2WIGA 2HCFA 2O1XA 1TC2A 3KEQA 3K6RA 1B8VA 4ZAFA 4Q34A 2GZMA 3IP9A 3QY0A 1HQCA 2WWVD 1YCDA 1BCRA 1XTTA 4ARSA 4M1TA 4MKFA 2WHEA 2CWWA 1UMBB 2W37A 2XKBA 1DGJA 1WZ2A 2I2AA 4HNVA 3TBHA 1ZN7A 3HA3A 3Q3JB 1Y6RA 4JL5A 3RH5A 4L7QA 3R3SA 2V0NA 3AUOA 3P1JA 1MCZA 4LJRA 2XGGA 1XQ1A 5BT8A 1NYLA 1QCCA 2Q4DA 4U5XA 4DF8A 3FNQA 3GLFE 3X2EA 3U7JA 1ESEA 3F53A 1Z4NA 4PBTA 2QT1A 1DJMA 2VSFA 1WNFA 4MS3B 2YC2C 2PUTA 3GW8A 4MMZB 1HE3A 3IG5A 3NLLA 3L6OO 1KU6A 2REBA 1R10A 4AF7A 2IFTA 4ICAA 2X2PA 3FPAA 5HBGA 4EVIA 4ZHQA 1MOQA 5B66U 1T1JA 4OSPA 4UI4C 1QVWA 1TYZA 3FYUB 4S12A 1IOZA 3QZ7A 4BV3A 2ZE7A 4BTVA 3EZ9A 3Q7IA 1KMQA 2PTGA 1NATA 4BNNA 3GDWA 2W90A 4EVQA 4P4TA 4PNPA 1S1MA 3AW9A 3O9MA 2JHFA 2PSJA 3FDJA 5IUNC 5CDHA 1XJ0A 1A5ZA 3SDBA 1JA0A 2R96A 1SKWA 3EHEA 3O4GA 3ERCA 4HQKA 2PMKA 3EW7A 4JP1A 4PLGA 2YV1A 3KHHA 4KQEA 3JVEA 4EY8A 9ICQA 5DK6A 2C4HA 3PNMA 5EQTA 5E6UB 4I5IA 4IQGA 2RGDA 3GWZA 4EGQA 4J0GA 4WY2A 1HSZA 2V6FA 4FBGA 1CFZA 1QGYA 4FR2A 1KHHA 3QM1A 4DYDA 1PW5A 2I4OA 2Y1KA 4QZ9A 4G23A 3LXXA 7ICGA 4DRXA 3V4ZA 4R2MA 2KBFA 3CNQS 1IBSA 1TJ3A 4PE5B 2PTHA 5GONF 5BSTA 5CFNA 4MNTA 2WJAA 2C7BA 4J76A 2WPDD 4GNRA 4KMUA 1JWLA 2WWRA 1SPBS 4CRWB 4RO0A 1RYSA 1D3AA 3SYKA 3WLOA 2QP4A 1H3NA 1YJXA 2GILA 5EE1A 3OZAA 4ZTUB 2XSZA 3RABA 2CEKA 1NUHA 3REQA 2IHKA 3EVAA 2JFQA 2OBYA 1JVNA 5L4LA 1JJBA 5IVPA 1WUKS 4XQCA 3ZE2B 4FE7A 2QIPA 4D4MA 1F8FA 1R6AA 2AEMA 4BMDA 1WCLA 1ESCA 1RE1A 4B3HA 3E6AA 3E4CA 5C3UA 3EFEA 1M6EX 3N6XA 3ZTTA 2YICA 5DXJA 3KBOA 2B92A 5I51A 2Y0DA 4LXGA 2G72A 3IDFA 2B1RA 3AUSA 3TLMA 1XVIA 2FPSA 4P6VF 5J1SB 2HREA 1EUCB 3RASA 1RRVA 4MO9A 3HB5X 2VZ0A 3W9UA 3GEIA 4HDSA 1D1PA 3L84A 3RB4A 5CR0A 4ZGBA 5LA6F 2I6UA 4X41A 4MCJA 4X1YA 4BNHA 1NKVA 4XQ8A 5K8UA 4AROA 3TKAA 4YY3B 4LJLA 3ZGXA 1OWLA 1SIWA 1EFTA 3A6JA 1JHVA 4OHPA 4KUHA 2BZGA 2H2AA 2O2IA 3QBDA 4P80A 4TL7A 4NJMB 4X20A 2FR8C 1YBAA 2WHXA 5DM70 2BI4A 4NS4A 1P1IA 5AKYA 4KR9A 4MEBA 1XG5A 4U7WA 3NGDA 5HRUA 1VECA 2C29D 2ZJFA 5A4AA 4FZLA 3GVHA 5LXTB 4KJXA 2IYXA 3DL0A 2BT4A 5K3AA 4U4AA 1KEKA 3UPUA 3RFCA 4FC6A 2P3QA 4DMLA 3BYZA 4NESA 3PT5A 1RAEA 4EI2A 1WQ1R 3B9JA 4QPDA 4BP8A 1WZUA 3ZVNA 4GGPA 1KAQA 2ASVA 3HO8A 1IJFA 4BMYA 2XKKA 4B74A 2G4CA 4OJKA 5DOVA 3SBDA 4IQVA 1W2WB 5JFOA 4MUMA 3L8EA 4MW9A 3FGPA 2GAIA 4DSEA 1W4RA 4ZCLA 4J3FA 4IJ5A 3D02A 4M1MA 3DVRX 1ZWLA 2A30A 1PUJA 1E99A 4ZCSA 4YMTA 4UBIA 5TZVA 1Y3FE 4H1VA 5A62A 1AX9A 4F8EA 3CURA 3B12A 3HG7A 4LYDA 1WW2A 3D8BA 2CEAA 3IA2A 5KX5A 3UCFA 3PUJA 3GLKA 3NHSA 4UB5A 1C41A 4IDNA 3SI8A 3S40A 1LJLA 4BWYA 1NJ6A 2P6UA 4X5OA 2OYYA 3UJ3X 1M9NA 3HN7A 3TARA 1FDOA 3LGSA 3GIIA 3BWXA 4G1FA 1M5TA 3E2MA 4YQWA 3BPSA 4Y6LA 2GEBA 5FBRB 4ENRA 4LVOA 4GQBA 4DSTA 2F4NA 2W93A 2ZIVB 3JYLA 3HDTA 3VPHA 4WLEA 1Q0ZA 3WOVA 1SHLA 4YH1A 2NUTA 3Q2IA 5DHUA 4J16C 2R5WA 2B8EA 4DLWA 2O7RA 2HMTA 1WB6A 4KN8A 4WV3A 3CCCA 1MNAA 3BQNB 3N5CA 3FROA 3T9CA 3A6EA 4M8IA 2YJ5A 2B35A 3GAMA 4QWMA 2VKTA 5BNWA 1TO6A 3WKCA 2WTNA 3JALA 2XMBA 3STWA 2CXPA 4J94A 3ADKA 4H2DA 3TIXB 3WNQA 1B2LA 3QU9A 5CA7A 3OC0A 2PJZA 3BHIA 4FEEA 3LBFA 1E0DA 1K3FA 3FSJX 3X1DA 3MT9A 1PJZA 4X64B 1QQ5A 2X4DA 2VJMA 4AK9A 5AVWA 5LJIA 4D8VA 3SJUA 2NSJA 5CT9A 3UGTA 3LUDA 1G4AE 1KR2A 3WGKA 5M3BA 1FTSA 5AM0A 2E4WA 3MMXA 3PGJA 2XVZA 2ZLBA 1W581 2RJNA 4NV3A 1ZY2A 4QA9A 3ZV4A 3P9RA 1R8SA 2JA1A 1GD1O 2Y0SC 4CM4B 4OHKA 5FEMA 1L5HA 1LDBA 2HK6A 4EKIA 1YFZA 3JATB 2EBUA 4FCCA 3QUSA 1MW8X 1SXJE 1RYEA 2NRVA 4UTNA 2UVPA 4BJ1A 2A14A 1YRWA 4EG4A 3D6AA 3B48A 3WWEA 1R0RE 2ERXA 1GDHA 3CSSA 3R5TA 2HLDD 4GF5A 5D3KA 2KPOA 1ZQAA 4JKOA 3I05A 3TQTA 7ICQA 4I8DA 2VDOB 2JVJA 3ZDZB 1GLVA 1WXGA 3ZS9A 2O1EA 2JFUA 2H1RA 5MFZA 9ICJA 4BC0A 1UDAA 5E3JA 1FNSA 5DCLA 1PQPA 1V43A 4Z4EA 2R60A 1RAFA 3BCUA 4XTCS 3BSSA 2FRXA 3ZIAA 4DLKA 4ZZ3A 3QPUA 2REQB 4W99A 3B7PA 3VPBA 4EW3A 2V54A 2YJ6A 5I7UA 2PZGA 4NCIA 3I9V1 1Z75A 1PFGA 3FM9A 4Z5XA 1XPJA 1UMCB 4TYWA 5TIIA 4EUSA 5SY6A 4CNQA 3VR6A 5K2MA 3GLFB 5AM5A 2IKSA 1BS2A 4QGGA 4ETIA 3KOWA 1DRJA 1U31A 3MXTA 1BROA 3DKRA 3T5MA 5T7BA 2G1PA 3FYDA 2B61A 2BMDA 2I6SA 4YVFA 1JX4A 4D3SA 2ZAYA 1XZIA 4XCVA 4Y2HA 5CRIA 2CCGA 1IG3A 2D4AA 1T2EA 3E4DA 1X80A 1SUCA 1E3QA 3EXHB 2A84A 4OHCA 3FWPA 2H9AA 5G4KB 3K1YA 1XA4A 3G2HA 4YP1A 2CKDA 4DV1B 1FP1D 2IYYA 2R8PA 1I4EB 3I2HA 4W5NA 3H86A 1E1QD 1K4KA 1DAPA 1IPEA 4ZK6A 4OM8A 4OQEA 5GJCA 5AKGA 4C20A 4FEGA 1S9HA 1G20E 1ZGZA 1W5BA 4B3MB 4NBSA 2FKNA 3CLUC 3ECAA 2RARA 1DB3A 1XSLA 5J8YA 5D6OA 3HJBA 1CVLA 2CMDA 3KT3A 2DUUA 3GEEA 3HCAA 3HZRA 3RROA 2IU6A 2VC2B 1LTHR 1W4AA 2QJRA 5L7WA 3SSNA 1IDOA 4JBLA 4YT8A 2IHBA 1X9WA 3A3YA 3I04A 1IY1A 1E6KA 3F6RA 3FRHA 4JB0A 2P2LA 2W9CB 4Y6QA 2V4RA 4XSHA 5H2FU 2QMUA 4I50B 4MUNA 3VR2D 1G2QA 2X8JB 2QB0B 2CDNA 1I8TA 1U4OA 4QWEA 2QU7A 3E8XA 2FUG1 2ZRFA 4MINA 1K6MA 7GPBA 2YWCA 1AK2A 4FHEA 2ODGA 3I2FA 3OWXA 4B9MA 1CYDA 2IEDA 1X9MA 2OOKA 4FOPA 4G07A 3GGSA 4LQCA 4GDMA 1A2BA 1FX1A 3TUZC 4EF5A 4M0LA 1BMFD 3CF0A 4GXNA 1ORVA 3GX1A 2XGSA 5I8ZA 3W5HA 3N58A 2QUZA 3MCAA 3TPFA 4E4TA 3AU9A 3FZNA 3VH4A 2PBRA 4TV8B 4LK2A 3B7WA 2RIPA 4JHLA 1RM3A 4YDRA 2DBRA 4FYVA 1MEOA 3DOFA 2UZ1A 3PKJA 4FQ8A 2R3SA 2WWIA 2PRZA 4Q24A 1DDIA 1ZQNA 3TW8B 4TMWA 1MTOA 3G89A 621PA 5K8LA 3ILXA 3L9XA 1E3WB 2CJPA 3ENVA 4ROSA 4MYUA 2DKXA 1QLHA 3FJYA 5KG2A 2VJ4A 3Q10A 3UWSA 3ZG6A 4HEJA 1CU1A 3IBTA 4JP5A 3O9ZA 3UBMA 3FPSA 5KIAA 3GJ4A 4GRDA 2PN1A 3FYUC 4KLJA 2W6ZA 1SCQA 1E4YA 2X7JA 3ZCRA 3VPSA 5FUMA 4KQFA 1WW8A 1FFDA 2WZCA 3W4KA 1QO7A 3QJ5A 4IVQA 4OB6A 1PE0A 3NYRA 3C1ZA 3MJFA 4I1SA 4GDFA 3K1TA 3KQMA 2I3AA 3K2EA 1S3IA 3N7UA 5FOQA 1JYEA 4MR9B 3L1UA 4AJ4A 4ZOHC 1ENPA 5DDMA 4TTQA 5J9FA 2W8LA 4IOMA 5KVVA 1U9CA 2ZREA 1WAMA 1FSZA 4EHAA 2QOEA 2V45A 4YRGA 1NGSA 2HKIA 3C8UA 1B14A 5JXGA 4O2LA 3WQQA 1R0CA 3CE9A 4PTLA 1ML3A 2FSVC 4QZCA 5I9NA 3LY9A 3E35A 2OBNA 1SPXA 3COPA 4JLDA 4ED9A 9MHTA 1R3DA 1KY5A 1CUBA 1NWCA 3H9QA 1BDHA 1WETA 2GFIA 1CR2A 1CR6A 1JBEA 1G0OA 3Q8PB 3QF4B 3MWKA 3GJTA 5DGDA 2P90A 3A6GA 4K7JA 1RYBA 1J1IA 4NLGA 2BF4A 3JXEA 3JWIA 4BE7B 3RUFA 4E15A 3LECA 1VP9A 4DFDA 2EYUA 3SJZA 1W19A 5KFLA 1R0LA 3AL3A 1BS1A 2AQ4A 3B3JA 3I76A 4EJ0A 4QPPA 2HO5A 4JIMA 1WEHA 4N5DA 2RGNA 1QHYA 5IIJA 3DDZX 1EHYA 2FW7A 1KP9A 2AR0A 4PR0A 1VXOA 1SQ6A 2BM1A 5BN3A 5K5EA 5KT3A 3C97A 4DLAA 4UU8A 2BKEA 4YLYA 3T5BA 4KIUA 5JC8A 3FKSA 1S8OA 3FYSA 4XKJA 2WE7A 3WBKA 1JS1X 1MZVA 4TUYB 1JHXA 3DS8A 2GUGA 2JLQA 3EBOA 2F43B 4X6LA 3MOIA 4PF1A 2FFBA 3Q5GA 1HQKA 4DJDC 2ECQA 3K73O 2QD3A 4J9PA 4ZKDA 3HNRA 4F45A 2QN7A 3J81k 2P8SA 1G38A 1FDTA 5FLEX 2HOQA 4DIMA 4AECA 5IHPA 2XHEA 1UEJA 1MKYA 1FP6A 1L7BA 4CR7A 1Z4KA 4DM3A 3WLFA 5EE5B 5JAPA 2K89A 2DFPA 3DO8A 5EIBC 5JZVA 1RMTA 2C82A 3K4GA 2LZ0A 4NE7A 5J5AA 3AH8A 3AEYA 4UZFA 3ZN2A 5DP2A 1NXOA 1BVHA 1JXLA 4H6WA 4MS4B 1U1GA 1XAIA 3H8SA 3PQ6A 3KQUA 1ONNA 1HDCA 2W42A 4RHTA 7ICTA 1A4XA 2VRBA 3GFRA 1FYXA 2HMAA 5KFBA 1ND5A 3IIMA 4R83A 4ZU6X 1L7EA 1ZM7A 4CETA 3MYRA 3KKZA 3OCVA 4LRUA 3LDUA 3F3KA 1JHPA 4DOMA 4NWIA 1H4QA 2P9TA 4UXJA 2XUOA 4O33A 2RK6A 1YMVA 4QQ8A 4WY8A 1V97A 4Q1VA 3PGA1 4BNMA 4HB4A 2V7VA 1YE5A 3IHKA 3GOHA 4BUJA 4HNGA 1ZKDA 2VBCA 4CRXA 1KI4A 1SXJB 3E3MA 4J0EA 5KFFA 3LQYA 4MWZA 2HV9A 3DLTA 2DGDA 1K27A 3ZJTA 4MLDA 2X9VA 4ZAYA 3D59A 4KN6A 4KLFA 3M1AA 2AQ8A 3N74A 3ISVA 4Q4HB 3KZVA 4QTTB 1QX4A 5DMHA 1S8NA 3VNUA 4CIWA 1PX2A 1G5HA 4AY6A 4G0OA 2AFIA 4N49A 2M2IA 2ID9A 3U3XA 2OQIA 4RGBA 1DDOA 3OD1A 2QM3A 2A1UA 3I0ZA 4ZEOA 2WT9A 3RODA 4AWXA 4DT1A 4W9NA 3A25A 2NVWA 2PL3A 3ULKA 4F5WA 1EXWA 1YV9A 4NOJA 1PWXA 2F64A 3TR0A 4IGEA 3TTWA 2DKNA 5IYZF 2AMJA 1BE0A 3RHTA 3I6ZA 1JN0A 5IBPA 3PC7A 5HUJA 1D5CA 3KELA 5CTAA 5L45A 3D6NB 3HBNA 2PUCA 2V65A 1E5XA 4KLSA 4MKXA 3L92A 1NHGA 4O8CA 2OK8A 2H9IA 3RUEA 2F4VB 3UPTA 3GR6A 1IEVA 1YMQA 5KFRA 2PGAA 3DTVB 3BQTA 1W30A 1YRHA 5K6TA 4UPEA 2XCRB 5CP2A 1NJSA 2HHJA 4JC5A 1EPUA 3W7BA 3IYLW 2B1QA 4C5BA 3COYA 1PZXA 2XIJA 1YR7A 1EDOA 3O38A 3SXUA 3CEAA 1BFDA 1QCYA 1YS9A 5GONA 3U4GA 1G8KA 1U1DA 2VQEB 2QLMA 1QV6A 4JJFA 3TTTA 1UFOA 4IGFA 2WNHA 3L0IB 1QKJA 4WOPA 1G20B 3R5HA 1OUMA 3GFSA 2XVXA 1E69A 3MWEB 3KZKA 4WBXC 4OB7A 5HZKA 1KMHB 4MRNA 2D7JA 4RDXA 1B22A 4WL0A 3CB2A 1JG6A 3PFWO 4IXDA 5FEUA 3S27A 3WK8A 2PLRA 2CVHA 4DLLA 5TVGA 4H7JA 3NH9A 1HG0A 3MUEA 2BMAA 2CKMA 3GFPA 4G5GA 4DQVA 2RGXA 1WS6A 3MTIA 2C5EA 1OJLA 4ZYXA 4JSYA 1E92A 2BQUA 4B9UA 3F73A 1N77A 2O50A 1XMPA 2QV0A 2WFLB 1RQNA 5TMPA 1IRXA 4EFNA 4FEAA 4J7UA 4GPIB 4OQDA 4NYJQ 1PYOA 4IJQA 4XXHA 3DL2A 3L6RA 4WJKB 4KTTE 2C8LA 3PNCA 3TXYA 1EINA 1P6XA 1YU9A 1JXQA 3V7LA 1Z63A 5C7LO 5FLKA 4F2WA 4QTYA 2PUJA 3DHYA 1TRKA 3OEHA 4MI1A 3MWFA 5D8DA 4LFBB 1RXIA 5TPZA 1C2TA 3GH3A 3VJRA 4JQZA 3H2SA 3M6LA 2X8WA 1FK8A 4RD6A 4Y9TA 5A4FS 4G0QA 1HX7A 3R6DA 5B2ZA 2O9JA 1VRWA 1Z1VA 2F77X 1MC8A 1SOMA 2HN9A 4CGYA 4I1IA 2Z2IA 1J00A 3C6MA 3EIEA 4WKNA 2PANA 3DXXA 1FFXA 4TQSA 5JH7F 2O05A 3SR3A 1H2HA 5B3JA 1TIKA 1T3TA 4BJ6A 4LF5B 2XXAA 1SJ9A 4F3YA 3W79A 3GLQA 3HR4A 3MGCA 4YRIA 4HCJA 1ZUD1 2VR1A 2VAMA 5DNUA 1GNVA 5EOZA 3EASA 3EXHC 1XU9A 4MCHA 3EARA 2VDWA 4IVRA 2AGOA 3LX5A 3RJIA 1QZ3A 1QYXA 3F2CA 2ZZMA 1OBHA 2F3PA 2IXTA 4UEOA 1A77A 3BQ2A 3N6VA 3VZPA 2G76A 3KLMX 5KQMA 2P8JA 2JCBA 4AO8A 3PGXA 2IYQA 3I8XA 3G2OA 1G17A 2ZCJA 1L5VA 3WAJA 4DLSA 5ES4B 2Z08A 1UQRA 1BYUA 4JI3B 1DC6A 5ARDA 5ISMA 3CPSA 4FNAA 2CSXA 3D2CA 3TXAA 1I4WA 3LRPA 3PXBA 2F67A 2BTQA 3JYQA 1GKKA 1NZFA 1L5QA 3DEKA 3GT3A 2ORVA 2R66A 4RJJA 4C76A 1E4OA 1N6KA 4AVYA 3OJFA 2CSUA 1K98A 4X91A 3B36A 3IQEA 2FPPB 1BX1A 3HVUA 2Q3HA 2YRWA 4OI0A 3KNZA 1F44A 4YXWD 4OH7A 4ND3A 3OESA 4YNBA 2PWAA 3ZX5A 1SRQA 4EBFA 3OIVA 4N7JA 2NV0A 3T7IA 5CCDA 2VN8A 3JQ8B 1V4VA 1AJEA 5IHXA 3HCBA 2KKVA 3TM4A 4YP7A 1EUQA 1CDOA 3GIMA 5FH9A 1O97C 2VJYA 4MMYB 2W03A 1Y1LA 3WGLA 3UG6A 3KKLA 2WP0A 3REQB 2HADA 5FL7D 3I1YA 1G5QA 3AW8A 4YRFA 2QU8A 2JEZA 1YC5A 3OEED 3AVYA 1EBUA 2HMVA 5K2OA 4OXNA 1CJCA 4AF8A 4QU9A 2VJAA 2I76A 4X92A 4BFTA 4S2UA 3WY9A 2IHMA 3L4BC 1JH8A 1WDMA 3NW9A 3BQ9A 4LHWA 3VOBA 3W06A 4FGWA 2GAFA 4RXTA 4C2UA 1QC5B 2J6UA 8ICHA 3SHOA 4J6FA 3NRWA 3RYHA 2I7DA 3S28A 1C0LA 4QUHA 4XYEA 1E3EA 4USAA 3TO5A 3WLMA 3OH8A 1PK8A 5L95A 4HDSB 1R00A 3ACDA 1ZINA 2QK4A 4XA8A 4M0PA 4KVFA 3QVKA 3GF4A 4XFDA 4FWIB 3R3WA 3HKZF 2HLHA 2FMQA 4C21A 4HH0A 1SK9A 1LWNA 5I9SA 1WZNA 4CCWA 3N76A 4F38A 3EISA 2LRHA 1JJIA 3OA0A 3U4QB 1YJ8A 4X20B 2B4AA 3G0DA 5EXPA 3WB0A 1XDWA 4EGCB 3F78A 2CE2X 1R50A 3BH7A 2AG5A 2HBKA 4K3UA 3LT2A 3TPCA 5E2AA 2XEDA 3L41A 1CS4C 4OBEA 1TF2A 4BP9A 4JB3A 4HAIA 4EYQA 1PKXA 3HYRA 3SYZA 3OE1A 3ZTYA 3HXTA 3OJ0A 4N12A 5BWLA 4UTRA 1KI6A 1LX6A 5B5SA 5G53C 5BQOA 2WSYB 4HLNA 3VJMA 4MHSA 3VR3D 4UFNA 1PWHA 4IH9A 3VH1A 4DQLA 4YR7A 1G16A 1U1FA 821PA 4MYRA 3K9HA 2V6IA 4RESA 5GMOA 2HHUA 2IZ6A 1JN3A 4RQMA 3FOBA 4M83A 1PP4A 3LYAA 5AUQA 2NVUB 4DHWA 5FUQA 4HN2A 2WY2D 4PPQA 3MMZA 5C5QC 1NBIA 4XQGA 1UFQA 2FZVA 3RIHA 3QXSA 3D0RA 2HHQA 3U7QB 3IVAA 2F59A 1VE1A 3PJRA 1IB6A 4Q4LA 1A1SA 4BKRA 3A1DA 5TXGA 1KO7A 2EF0A 4L0MA 2P1DA 1U4SA 1ZRNA 1TK3A 2JJ2D 2ZXEA 3PR4A 3RTEA 2OLEA 5LQRA 1E58A 3K9NA 1KIAA 2HT1A 1OZ0A 4X9XA 3BAZA 1OLOA 3MQ4A 1ICEA 3RB3A 1X1SA 1RZUA 5FOWA 2PPLA 5JASA 2ZXFA 2IUUA 3LLCA 2OLKA 4Z7NB 3PNBA 3BQ0A 2QUAA 4ED3A 5J40A 5TY0A 4Z6KA 3L82B 5JCXA 2NUTB 4EGAA 3BEOA 3FB1A 4AJ9A 2QZJA 5KFQA 1M6WA 4EBCA 4C04A 1OU0A 1KFEB 4JKIA 3LC7O 5LQCA 1LS6A 4X24A 4J0FA 3U37A 3SE0A 4M46A 2K8AA 1KI2A 3BD7A 3HGQA 4L5CA 4P86A 3BJYA 3JALB 1LRJA 3WBJA 1A8UA 4P3PA 4G4GA 1CY8A 1FFWA 2G9UA 2VATA 3T7TA 4BFVA 3L4JA 4GMXA 1CULC 1DMRA 4TWZA 4JJGA 4J0IA 2CZCA 3FLMA 1XCOA 1FMTA 1MDBA 3FHCB 4O2AA 4QREA 3L5OA 1ZQGA 1ZJNA 2WI8A 1D2CA 2FRDA 2VJMB 3A7EA 1H4VB 1DO2A 2BSAA 3PNQA 2OKGA 5A3VA 3EDRA 4J9KA 2Y68A 2EDUA 1QPZA 1GEGA 1Z4IA 5JAMA 2ZRGA 2FLPA 5HKKA 1Y7TA 4LDJA 3A6KA 3TDKA 5COAA 2OK7A 3SENA 2B4TO 2II6A 4JSRA 1DEOA 1L5HB 4Q9DA 3GIWA 4K4GA 4DXHA 4TKVA 3IB6A 3H2YA 4FYIA 4YRJA 1J9ZA 5FJJA 1RXYA 3VTAA 4P8RA 3WGMA 1RXUA 3FFXA 3KHTA 4HYYA 3PWKA 1DK3A 3NC4A 4TVOA 1SXJC 4UREA 3R7NA 3VC1A 4DQKA 4AJHA 2QNRA 5A9SA 3U0BA 1J0XO 5BO5A 2C9YA 1G64A 3M34A 2W2LD 1RI2A 2J0EA 3DB1A 5JRTA 2VYQA 2AFIE 1L3TA 3UK1A 1DWUA 8ICNA 2H29A 3ORYA 1C7EA 1H66A 3UMFA 4RZ3A 5KC8A 1SR8A 3FETA 4DWIA 1KFJB 4RCYA 2C7GA 5ADWA 5DBAA 4IWNA 2J6IA 3QTTA 3CEPB 4U8GA 1DTWA 3D3KA 1F2DA 5G0VA 1PGOA 2RAPA 4JL8A 3F4LA 1ZNYA 5LZ5A 4PAMA 2I8AA 1IVNA 1KEUA 3ZWPA 3T9EA 2E1EA 2VUIB 3AEXA 1DCKA 3OLQA 3EXAA 5JO0A 3ABOB 5HW0A 3Q7PA 2XKJE 2B4QA 1DRWA 4JS0A 2C2KA 4IDQA 5J0OA 3T1VA 5JO9A 2VT2A 3U62A 3HSKA 2PO5A 2SCUA 5BWCA 3PJFA 4IDCA 4HVCA 2P67A 3QNMA 1FTGA 1X80B 3DYVA 5FNZA 2R1VA 2XMGA 4YCJA 3N2GA 1JI3A 2ZI5A 4PFSA 4H7FA 1E7RA 3IUSA 1FUUA 3RIMA 4Q7EA 1KAMA 1KXJA 3L7IA 3K7EA 1AB5A 1UJNA 4GC5A 5FDFA 4M9RA 5H81A 3TOVA 4CKCA 4X66B 1M33A 4GI2A 3M5WA 2DUYA 3MGHA 2MYUA 5L3QB 1COOA 5FBWB 1JEQA 2GK7A 1J70A 4YAWA 1LTKA 4XWWA 4LMRA 4YT2A 1XZQA 4KOAA 2FMKA 2IXBA 2NO6A 1RFGE 3JWEA 3K16A 2HEIA 4YCBA 5J1TB 4AYXA 3DTNA 4DSOA 2RH4A 3P5SA 2A9JA 2ZB8A 1KOGA 2H11A 4DY6A 2AQHA 3NUQA 4PPNA 4EY4A 2QUHA 1ENZA 1P61B 2ORWA 2F8KA 4HB2A 5B57C 4MPTA 2VJKA 3GNSA 4UBLA 3SXPA 1K6EA 3WLJA 2YNMC 3QQPA 4OIMA 3TM5A 2IVZA 2WJ3A 1NFFA 2AN4A 2CB9A 1HSOA 5ESDA 1ZOLA 1MA3A 5CDFE 3K30A 1WD5A 1AOXA 3LXRA 2ZUDA 4K9DA 3VHRA 4R0VA 2F1JA 1X87A 1R8QA 1DQZA 4YTEA 4C7OA 1PJQA 2NSYA 2WAMA 3RVNA 4BV8A 1E3TA 1KK0A 2J09A 3AINA 4WXPA 1F4LA 3KKOA 4JVOA 3KYJB 4Q3KA 4E14A 2VYFA 3EPPA 4R2IA 2QF7A 4GNKA 3ST7A 3NHYA 2W4IA 4G0ZA 5EJAA 2DBZA 4FFRA 2CBZA 1CX9B 2UZ1B 1ACJA 4BO9A 4UE3S 4US1R 3DZCA 3UMJA 2Y1JA 3U6KA 4HNAB 1WM1A 4FGKA 4ZN6A 2J59A 3T9DA 1KYXA 3T7RA 3RK4A 3NHZA 3DDWA 3HU5A 2DHEA 1WDKA 3ZDEA 3ENQA 3CNEA 2YY7A 4LMBA 2Q9BA 2F1OA 4JXXA 1C3OA 3SPXA 3PDHA 2DPYA 4QIHA 3LV8A 2OCGA 3CRVA 7AT1A 5LOVA 4XQ9A 3T4EA 3K2QA 2QRNA 5CW2A 2ODKA 4OFBA 2L17A 3ND9A 3MSCA 1IM5A 4FGUA 2FX2A 4ZOEA 5T64A 4NMXB 3ZCSA 5J0SA 3EDOA 1YH3A 5D6NA 5DSXA 1KFBB 4YIHA 4NCBA 1TYBE 4PHGA 4D44A 3U31A 2EW1A 1C4OA 4BQQA 4MRRA 4HP8A 4AMUA 1GNSA 4H7DA 4WXRA 2D5LA 2O3SA 3THSA 5COBA 3R75A 2ZUCA 3C2KA 5A03A 4TOIA 4F0JA 1TVMA 4IRMA 3B1XA 3RUPA 1Y33E 5HGJA 5DF1A 3CN7A 3SHTA 4MF8A 1U3WA 3AIOA 3M5DA 3M3HA 3K4QA 1M76A 4F8JA 3VISA 4OTZA 1QP0A 1FLNA 2ACEA 4TRJA 2R1ZA 5MDHA 4K05A 2JAXA 1US8A 4XR9A 3LNCA 1NXVA 2WK1A 4C4AA 2GDZA 3ZGNA 3M9OB 3H40A 4KE6A 4HZIA 2HPHA 1DOQA 2ZIAA 1RJEA 2A5DA 3LCUA 1W9MA 1C1XA 2Y1WA 1PFWA 4JVLA 5DX8A 1LPNA 3PQ7A 1T0PA 4DDVA 1WHSA 3R8CA 1QOPB 5EZ5A 3MMSA 2V6MA 5HE9A 4AZSA 4AO7A 2J41A 3PD0A 1NJ5A 2JGJA 4FXOA 3THWA 2PKQP 1Z0DA 4KLEA 3SHFA 4ZJPA 3Q3HA 5DEIA 4OA5A 1IXSB 4BP3A 4KZQC 1K97A 4JN6B 2FOXA 5DM60 2VYVA 3B6MA 1R37A 4AP6A 1DX4A 4DSAA 2W6CX 2YBDA 3CPEA 3C74A 3V46A 4QZFA 4X93A 5BN3B 4UOEA 4QZDA 4GIBA 3R9WA 4IILA 1HRKA 2XOKD 3EVBA 5EERA 3B0YA 1Y9ZA 2WHPA 1QWOA 4IGKA 3M8RA 3STUA 1UADA 2AMLA 3E9EA 1LV5A 3JQBC 3Q88A 1HYBA 3WMXA 3V3KA 4UM9D 3L02A 5HIJA 1Y3CE 5DO9A 3HJ6A 4YRQA 4OH1A 4NAUA 2QR2A 4J49A 3ZVRA 3U39A 4IIXA 4XPIA 2B6NA 2NO9A 4GRAA 3KKPA 1RBQA 3IKJA 4B75A 3PX2A 5KSYA 4U2GA 1P2GA 2O54A 3NIDB 2QDXA 1JDJA 1U94A 4EUEA 4KQMA 1U2ZA 2W6NA 1RPTA 2YTUA 2ZDHA 1ORDA 4J9OA 5BNFA 3WA7A 3TRHA 2VH2A 4GAEA 4CIAA 3I2JA 2E5FA 1L8AA 4MVJE 4ZOCA 1ZMBA 2PI5A 1E3DA 4DFMA 1YQQA 1GA4A 3PL5A 1FLDA 3VR4A 1ADGA 4GLJA 4TMKA 3IUYA 3H7IA 4MGEA 4LN1A 3IVGA 3UXMA 4GGMX 1MVNA 1V39A 4ZYLA 1Z88A 3IUJA 1EGVB 2ID8A 1W46A 5IF9A 3O7WA 7ICMA 3KEGA 5DN6A 2EVWX 5LBUA 2VBIA 5CGQB 2HCJB 1SUPA 4ER5A 3HK2A 3ALRA 1NP6A 3DCJA 1MSWD 1QFSA 4RMNA 4C3OB 1ZL0A 1UP6A 4NK5A 4E11A 1TOAA 3PHLA 4MP6A 1G1MA 5DH9A 5DIFA 5EGNA 4ECUA 1DKPA 3T5TA 5JEEA 4ZDWA 3TQSA 4DCSA 3A6DA 1Q3TA 3ISDA 3ZGVA 1KJQA 1CRWG 1R64A 1XYYA 1RRGA 1QU3A 5CVCA 3PUVA 4R40A 1XO0A 2E48A 4E88A 2JH8A 2NYVA 5EP1A 3V33A 4XUDA 2AFIB 5NULA 1WEKA 3W9YA 2HIMA 4HDKA 4G8BA 2ISQA 5HQJA 3V4RA 3GXOA 4RD4A 3RJ5A 2A1UB 3EEBA 1U9IA 3U7FB 2I2WA 4DT1B 3ORQA 2VO1A 2ZIWA 4LJ6A 3ZXYA 4DNXA 1JSXA 1OA0A 4MRAA 4BO5A 3PV0A 4KXQA 3CZAA 2C3OA 1T9GS 3DL4A 3A31A 4LNHA 3A3OA 5J0QA 4DC9A 3KDAA 1CK4A 2I6XA 4YBRA 3PFHA 4FHZA 5DT9A 3B1FA 4MUAA 3HN6A 4CCYA 4GXIA 3DA8A 3KSUA 4A92A 2O2GA 1N2GA 3N4MB 1XN1A 1IM4A 1WPXA 2EJBA 1XZMA 2DBYA 2CNOA 3ZXXA 4UUOA 4G5SA 2GMWA 2BP7A 5FAKA 2WYOA 3MTBA 4QNNA 1TIPA 3OOHA 2ZXIA 8MHTA 1TEZA 4YDSA 4KOEC 1SBHA 2ZTLA 3HBJA 2HF9A 1EFRD 4PS0A 1XTRA 1Y6FA 1GTL1 2V4MA 2HDHA 1P81A 1PR0A 4NC9A 2NRTA 2VHCA 1XMQB 2DHCA 4UI6C 2E21A 3RF7A 5GVSA 3RT9A 4DWJA 3DEIA 2VYCA 4UAYA 4UM5A 4C06A 5JJBA 1YB2A 3OQ6A 2MSDB 4HTAA 5FTLA 2J0UA 1UA0A 2ZJAA 4XAQA 3TRJA 5C5CA 4FHCA 1KZHA 1G5RA 4UB1A 1YJ5A 3AFGA 4DN6A 5F7XA 3E27A 5BV2P 2C58A 4FD2A 2DY1A 1VZ3A 3CLUD 3QOYA 3BMCB 3FFTA 2CLDX 2A1JB 2HK8A 3HDVA 2R5FA 4EI8A 4PWZA 1AD2A 1ZZGA 4Y9SA 5GVRA 3L46A 3KTFA 1G9TA 1XSEA 1EWQA 3FXAA 1AUOA 3QKUA 3BIXA 3RB6A 2PL9A 2XZTA 4TGLA 1EU1A 4PZEA 1EWRA 4ZTBA 1KZ7B 2FG5A 3KHUA 5J4VA 3DR3A 4EOGA 1P7DA 3RFXA 5JD6A 3ZWOA 5E3IA 3VBEA 2K6GA 3KB6A 3L4KA 1P9WA 2I9GA 4OI4A 3EVZA 3OAAD 4DA7A 1KEVA 1GQQA 2Q5QA 4Q21A 1MAUA 1GAXA 3U17A 2DFVA 2UUOA 3BL6A 3D5EA 1KFDA 4JYMA 2JI8A 3PTLA 4B9LA 3TQOA 4M22A 1WV0A 4B3SB 1D4FA 2GBLC 5H83A 3S2ZA 2FY8A 1Y5LA 1AHHA 1FFXB 3CE6A 2YR0A 1X40A 5SICE 3HEAA 2WZDA 4FMDF 1K7XB 4C4YA 1Q21A 2D4HA 4Q4CA 2WUVA 1PZNA 3N3BC 1DADA 3WDMA 3N8NA 3FWKA 5HILA 3SEZA 1WQ3A 1CUAA 4QUIA 3I12A 4LCJA 4V38A 1CC1S 1YL5A 1E6MA 3UJ6A 2VDWB 4YAFA 2AOTA 1PR4A 4HGYA 1EJBA 2GEVA 3E7XA 2HNAA 3P2MA 4WI1A 4IOKA 4JBYA 5JWOA 4ZZIA 1KMIY 4KH0A 5KTTA 4AX8A 3RJZA 3OMLA 4QWAA 5IKEA 2RHJA 4D99A 2C78A 1X86B 1P2UA 4R1SA 1IBMB 3NO4A 3PO4A 4PBRA 3PUHA 4KNVA 1E2MA 1D2HA 2B9VA 1XNJA 2BJVA 4EYGA 1ISJA 2Y1GA 2BTQB 3KPVA 1Z8HA 4AMGA 3S5JA 1CUEA 1FLAA 2FR1A 3ZI4A 5EJFA 3I4FA 2WAQC 3LHKA 1PK9A 2NYAA 5FLYA 5CCBA 3A9SA 2DQ4A 3U48A 5BQPA 1SCIA 5K7SA 3PXAA 5BOLA 2ASEA 1V6CA 4JLOA 3IOBA 2UV8A 4Q12A 1E9FA 4C6RA 2I78A 1RYHA 4FFOA 3CLVA 1S6YA 4FE3A 5D85A 2OG2A 4KVZA 1SK8A 1WBBA 3OU6A 5IC5A 1CUYA 3KWFA 4UD6A 2A19A 4R2JA 1U3UA 3REOA 2XT6A 3L0OA 2H63A 4G0XA 3U9TA 1CJSA 2OM2A 4KODA 4O63O 2PXIA 4ADSG 1PQYA 4GR4A 2FZCA 4PIMA 5B7NA 1T35A 1Z12A 3SLKA 1UIMA 3PR2B 3CF2A 2C1EA 4DF3A 2NAPA 1XLUA 4DILA 2ZUSA 1LZKA 3RYHB 1W76A 1MDFA 3ZS8A 3JR7A 4YCCA 1XTPA 5AXAA 2G1AA 2B83A 5AP9A 3D6TB 2M6RA 1LSSA 5LSAA 4NL9C 4CLDA 1N7IA 4WZBA 3THYA 1YZHA 4XLLA 4IIFA 2AE1A 3UUGA 2DL0A 1Q7RA 1Q46A 3K6SA 2HI0A 3EAFA 3E5NA 3MT0A 1NX6A 1U8TA 2YFQA 4I81A 4ASUD 1QFZA 3RJFA 4B6GA 2WVJA 1ISHA 1JSZA 1J2TA 2WINI 2NWQA 3H65A 2QKYA 1K8YB 1K06A 1Y3BE 3G1WA 1M0SA 3PFIA 1OVGA 3NBAA 2J3LA 3UFXA 2QPTA 4LRWA 1MV5A 4M04A 3VVCA 3KAKA 3ZHCA 3NIFB 5EIBD 4D57A 1NMYA 4F7DA 1J8VA 3DOOA 2GXQA 4EATA 1NBEA 2D1SA 5LLSA 1W47A 4HRAA 2D1RA 1RKXA 3L1VA 1MIOA 1C0KA 3EZ7A 2GN2A 4LX8A 2V96A 4K6OA 4NXNB 2CT8A 1QDEA 4FSDA 5IAJA 1YZGA 5DNCA 2EX1A 2FJ6A 1SVOA 4G0MA 3MWLA 3LF1A 4HQRA 3FC4A 4IR1A 3ZHZA 1HE5A 3TANA 3AHJA 1JRLA 2V74B 3U7IA 5IC4A 3LUGA 3NXKA 2QQFA 1NVTA 5KEIA 4JNKA 3DUWA 3ILHA 2VCEA 3NHUA 3EZNA 4O3PA 3GEDA 1F3LA 4J1QA 4NULA 2XBUA 4ZYUA 3AVVA 4FCTA 2BDUA 3TDMA 5CFOA 3ASZA 1VJCA 3INRA 4S1WA 4UDOA 4Z53A 1OLUB 2BD0A 1RMYA 2WDZA 4P4LA 5C4MA 4UNIA 1QTQA 1ZYQA 2HA0A 1OHHA 3HYLA 3NB0A 1E4EA 2OR3A 2PL5A 4ZM2A 3I3SR 3ZI7A 5F9MA 4HF7A 5FYDA 3CF4A 4JLUA 1K5DA 2PUEA 2QM8A 4OFXA 3W3ZB 1E77A 1KEZA 3P0FA 5FI0B 2FMFA 4MYHA 3HZZA 1Z6ZA 3L6UA 3N0WA 3BZUA 4DJFC 2RE8A 5F2EA 1U5CA 2Q62A 5EPUA 4LRTB 3JD3A 2D06A 4PRYA 2RHLA 4WN3A 3IP7A 1M1NB 1ZM3A 3FHOA 3LL7A 1WMSA 2VTBA 2AE2A 2QNBA 2V9CA 2X6TA 1QGUA 1IOLA 1NVEA 4JC0A 1CUFA 1XP8A 4W6ZA 2N1RA 2WU1A 2DP4E 3OPMA 1O0BA 3GCWA 2CVQA 4FFNA 1XQ6A 1PVQA 3VNSA 2MUTB 3G79A 4L73A 3K96A 1EB9A 5CX1A 4O2AB 4Q3OA 1NBMD 3OC6A 1Q0PA 3HUEA 4DBZA 4M8NE 1YOVB 3MJSA 4IIEA 3AEQA 5E2IA 3EAQA 4TM8A 3P9ZA 2GKGA 2ATEA 1ZIDA 4KO2S 3TLCA 4K86A 4K5QA 1I30A 1RTTA 3EGXB 3KWJA 4A8JA 3L1HA 1LI5A 3W3AD 1AQYA 3AEZA 1K1EA 4DM4A 4BO7A 4JUZA 4HATA 2ONJA 4OU4A 1SURA 2MMCA 5CD1A 3AV3A 2GJ8A 2VQ6A 1FP4A 2IZ5A 3DGFC 1PWZA 2ATCA 4KWEA 1RKBA 5TRTA 1WSBA 3K0EA 3CF4G 3FTDA 4GG1A 2VHYA 5A9SB 1O95C 3NDPA 5G41A 3VQTA 2FWMX 4HLUA 3I8OA 3NWOA 1Z3CA 1H1TA 1U8ZA 2N0SA 2J9XB 4QYWA 5A3RA 4CKZA 2G9QA 3IEPA 1O9HA 3LK6A 2ODPA 2QQ0A 4D5EA 4R7TA 4CHTA 2F00A 1DTWB 4DBVO 2Q5EA 4RZXA 2GLTA 3VNAA 2ZRIA 2PRYA 4TZ0A 3FA2A 2HMUA 2FWPA 4DQDA 3JZFA 3S7TA 4MWDA 4F4DA 4UNQA 3DFIA 1VIAA 1EESA 4ZA2A 3SZ2A 3EW9A 1MN6A 3PC8C 2W2PA 5CHYA 5JPDA 1GRVA 4PX3A 1RFLA 1QHEA 1NYQA 5C5DA 2VPWA 3DNPA 4H08A 2UUBB 3EIFA 3O47A 2BEKA 5JSFA 1XRNA 4L4UA 2SCUB 4BEWA 4RHFA 3T8YA 2O2JA 1XR3A 4QHYA 5AXCA 2R1VB 4MJLA 3N2GB 1UMDB 3OLZA 4F2GA 2G09A 3CLRC 2ZTVA 5G5HA 4M7WA 3FOEC 1LSOA 2GR9A 3ENZA 2QD4A 3T5CA 4KPEC 3FAZA 3VZQA 4V0NA 2UU9B 1GGMA 2LUOA 4XVHA 1A1VA 1J39A 1JFFA 1DTEA 1PNOA 4RQUA 3G49A 1NSFA 2E3JA 4JYCA 3ZCUA 3NJ8A 4JXZA 3WYFA 3CVJA 1UC4B 2GYUA 1X92A 1UHUA 4UJ5A 2WF5A 3V6KA 4X6YA 1XTUA 1JEQB 5K8TA 4U7TB 5D46A 3V7FA 4E31A 1DJQA 1RBMA 4X3CA 4OBWA 1DQPA 1U6IA 3HXQA 1Z82A 3EA5A 4J0DA 3BGSA 3Q87B 2AI1A 2PKRA 1KXZA 4MQ5A 1E18A 4I2NA 3DDCA 2P35A 2XBLA 2DPMA 1QU2A 2WM9B 4S0XA 3MJEA 3PGLA 4TWBA 3OZFA 3TCXB 2R65A 3AOGA 2CNKA 2BFEA 2NNWB 1UKYA 1K86A 1LPPA 1T8YA 1YRLA 3HJUA 5EJIA 1VGQA 4DR4B 4QW8A 2PLNA 4G6ZA 1CJBA 1AMUA 4JQCA 1QBGA 4Q18A 5CHGA 1AG9A 1ZNWA 3AB7A 2XNCA 5CITA 5THXA 3T9BA 2JEIA 4IHJF 3HCWA 3DBRA 2IYPA 3V8NA 4C7OB 1IZZA 1RLMA 1QQ6A 4ND1A 3WHKA 3WP1B 3L05A 5J0XA 3PFGA 2CMFA 4AP5A 1N3BA 3IUEA 4Z99A 3CKYA 1PEDA 4O4LB 4JLSA 3U56A 5U4XA 4Q8FA 5EQDA 2TMDA 3LHIA 2XB8A 2XE8A 3AEVA 5KTRA 1O97D 1BQEA 4A1OA 1Y1TA 4BJ3A 3P9SA 4HDRB 2ES6A 4FBLA 1HL3A 3K1JA 2FDXA 3OZRA 4N3AA 3K0CA 3CX3A 5D7BA 3G8DA 1WULS 9ICIA 2VXOA 1DAIA 3SDZA 1Q0RA 3M8SA 1PGQA 4QJ5A 5A3QA 2FUEA 4ABTA 2Q0SA 3DJYA 4YA6A 2DWUA 1GT91 5HA5A 3CGWA 3GA0A 1C3OB 4C8MA 4YV0A 4GOXA 5B3KA 4PS1A 2IZOA 4RFLA 1NXXA 4RKWA 3RVOA 5DTQA 3MVEA 2YUTA 5LOVB 3TINA 4AZ0A 1TO1E 5LA6A 3Q15C 1WSWA 1EX1A 5KQPA 3TMAA 2CLHB 2OZVA 2JHDA 5FLXA 4FDMA 4RX1A 4EI7A 4P2BA 1GKIA 4PW0A 3QGMA 1S7CA 1LZLA 5CP8A 2OC4A 4GPEA 4RMHA 4UOZA 1SVSA 1Q1GA 2DBQA 421PA 4RJ2A 3K70B 1MG5A 3SVLA 1BCRB 3U5TA 3GH1A 2AUNA 1Z62A 1DBWA 4M0DA 4AZ3A 3PNSA 3M2TA 4OHXA 1E1LA 4FS8A 16PKA 2H1VA 1TJ4A 2PGXA 3OY7A 3OBBA 4F3RA 2H4FA 4EFLA 3UO8B 5LFAA 4QEZA 2YXEA 3TSZA 5EQFA 3K3PA 2E5WA 1NP7A 4QOJA 2GASA 4WMLA 4IWXA 2HBQA 4ZT5A 3PFNA 1M7GA 1XMIA 5K6AC 1P4HA 1BG6A 4PR3A 5K0FA 2BDEA 5EZYF 5DLPA 1H0SA 5JIBA 1US8B 1AF4A 2A33A 4AUNA 2ONYA 3LYHA 4ZHQB 3A4IA 2DUJA 2WPNA 2QE7D 3MIZA 4RK0A 5JS2A 2G9ZA 3G0OA 1W0KD 4Z51A 3VHLB 2D0IA 5EE9A 5KFVA 1C1XB 1RC8A 3H5IA 3VSAA 3L93A 4D3FA 3EXG2 3GRCA 4NU6A 5T3UA 1L4MA 3PYXA 1WHSB 4KWCA 3GK3A 4DMFA 1C7JA 3LFTA 1X0VA 3CISA 4R6WA 1GKYA 4PAWA 3EB9A 4I5EA 2CJXA 1FYWA 5LQJA 5JJ5A 4LGYA 5C7OO 2C7PA 3QVWA 1HWYA 2P77A 1TCVA 4ID3A 1AZWA 2BHSA 4LDRA 3OIWA 4G09A 4NBWA 1F8GA 1TU0A 2WHPB 4ITUA 2K60A 4JR2A 1KK1A 2JAUA 2I3DA 2XB2A 4MV5A 2O3TA 1C7FA 1ZYUA 4HJXA 3FUCA 4HSGA 5G3ZA 4MKGA 2D13A 1GFZA 4URXR 1UXHA 4XPIB 3JWGA 3ABSB 4WZBE 3VU3A 1TQ2A 4DRXB 2CPRA 5FB3A 4I6GA 3M7DA 3PHCA 4NHOA 3A1WA 1Q6ZA 1YUNA 4GUAA 2GETA 1W2GA 5JFGA 3E5MA 4HWOA 3LUFA 3L6DA 3WWZA 5EJ6A 3EMKA 2AN5A 4IIGA 1YE8A 1LPOA 1UXGA 3ET5A 3EFHA 4GR5A 5F3XB 2A58A 3EZFA 4ACOA 4KI0A 4I36A 3P26A 4UDYX 1O6BA 3D8TA 2GERA 1XAJA 3UWDA 3BHMA 3M4JA 1JWAB 4TS4A 1J49A 3GNQA 2BFFA 4PU0A 1WMAA 1JDSA 2IW1A 4CLEA 2HF2A 1L4HA 5HDBB 3ZDBA 4KYIB 5CIYA 4OGWA 4GWGA 3BEDA 3RC1A 2IEIA 3BWEA 3P0HA 4F4ZA 2QW1A 3AEUA 5SZKB 1D2RA 3D8SA 1AU9A 1JWBB 1TF5A 4RM2A 5IIIA 1PZEA 1P0MA 1HUQA 4TLCA 1YB7A 4OCZA 3OHSX 4RAOA 1GGHA 3ESYA 4MYTA 1Z0SA 5C7YA 1XJQA 4RVSA 4X1YB 1K68A 1HUOA 4C8LA 1LPSA 4MUKA 2VBFA 3ADOA 2MAXA 3SAGA 1NK5A 1K1SA 1JNYA 3TQFA 1XO1A 5ARBA 2JFGA 1SXJD 4A0QA 5TX7A 721PA 3QW2A 3DSRA 1U8CB 1XRMA 4A15A 2ZIWB 4BUGA 3DE4X 2HMXA 1C3XA 2I34A 4F4UA 5FPHA 1QDUA 2OB1A 3KD3A 2H4WA 3RG8A 3NHLA 3I09A 1OFGA 3Q8WA 4XDZA 4U6QA 4GKAA 1R0XA 2K7ZA 4RT2A 5M34A 4YFKA 3L2OB 5A4IS 3BD9A 4CCYB 3O03A 1KI9A 1ODLA 4OMCA 3H11A 1OT3A 2BP7B 1ISMA 4Q93A 3BGDA 4PC7A 4RAQA 4WJ3B 4MIEA 3OF2A 1ZETA 4L0TC 3OECA 2GOYA 3I6MA 4IO0A 4N6OA 2FQ1A 4BBPA 1C7YA 4BX9A 1R74A 2P2ZA 1N2EA 1ZRHA 5I7HA 3DTVD 3LUKA 3Q12A 1WTAA 4WFKA 5ALWA 5KX5B 3E9QA 3SJAA 2QROA 4W4TA 3ZWQA 1MT3A 3BQ1A 2YZKA 3AUYA 1Q7EA 4ALJA 3IV6A 4XYMA 5JYCA 1ATZA 5HJEA 1U4NA 3ESQA 4P4PA 4WX2B 1FOEB 1DFIA 1U0GA 3I62A 1B0AA 3DULA 4HAWA 4DFJA 4ZI7F 1FPQA 5B3LA 3KALA 3BFVA 3VRHA 3VAZA 2BFMA 4RMJA 1VKRA 3RIGA 1WDWB 4E1AA 4ZVPA 2CLIB 4RPZA 1A5SB 2H7XA 4ZVUA 4CTNA 4Q7KA 3E0FA 4TL8A 4BEVA 3BE5A 4IDPA 2H7YA 5DLYA 1D7OA 4N54A 1ST2A 3CVYA 4D5GA 3HKDA 2PXAA 1NF2A 2QZ9A 3RC8A 1V5IA 2V7EA 1XOIA 4PH5A 3RJHA 4MQEA 3KQPA 4LSMA 4EHJA 5HZGA 1PK1A 3N6RA 2DJIA 3MTQA 1B0XA 1PSDA 1C9YA 3ZD7A 2JIPA 3UV7A 1OC2A 3C4VA 5A5VA 4UVGA 2B30A 1J56A 4CI9A 3OIYA 1LDYA 3ORHA 2WJHA 3LA6A 2XT9A 4MIYA 4TSRA 3JWHA 3H87A 5DYTA 2HBRA 2YNMD 1J7JA 2TSYB 5EMHA 4JJ8A 3RK0A 1LK7A 2A0YA 1ES9A 2DX7A 5TQ2A 3P0EA 3T12A 1KC3A 4PSUA 2E1RA 1ZIXA 3LLUA 4AL4A 2QV7A 2FRVA 1O77A 3V80A 5EWEA 4I2FA 3DT8A 1U47A 3V8RA 2IP4A 3GCXA 1X1EA 3T0GA 1SV0C 4AKEA 1NL3A 4PZAA 3DBHA 4M47A 2NZXA 2PR2A 5TDHA 5IDVA 2YN0A 3A4VA 4JLBA 3NIWA 1OIXA 1VPLA 1CCWA 4RPHA 1EK2A 3W2HA 2UVPB 1NRXA 1F12A 3W8NA 2BBOA 5YASA 2KX7A 3O3NB 2CHEA 1HK7A 4OI1A 5KG7A 1K0FA 3NIGB 1IYZA 4JJIA 5FWYA 4M6WA 5FV7A 1VCNA 3IEKA 5JY1A 5DHTA 1TTQB 1JILA 4ZTZB 4Z2AA 2Q1SA 1E2UA 3G0HA 3Q3EA 3GLHA 3C7CB 3GN2A 2M9NA 5LM3A 4C89A 3PF8A 2GZSA 4I1UA 4R63A 4GPBA 2WKQA 3JQGA 3NM4A 1T8PA 3QMPA 2I54A 3WAGA 2VPIA 4QRHA 2P75A 2XAAA 4CF5A 4RNOA 5J4LA 3HBAA 4IXMA 3GRAA 4NNOA 1IJEA 5KSZA 3FGZA 2NRZA 1XA3A 1EJ2A 3UB4A 4KAFA 1GGNA 5EFOA 1SB8A 4IF6A 1J9EA 3OOWA 1AO3A 4UVHA 2R751 3K5PA 2QTVA 3G0CA 1IUPA 3FIJA 1IC6A 3BAFA 5DM1A 3V4FA 4WY5A 5TS2A 3I01A 4G63A 3EUB2 3MABA 3ITNA 5E0KB 4DIBA 1OB5A 4AUMA 5ALEA 3HCFA 8ICRA 2KS6A 4J0KA 1NN0A 1UWVA 3EEYA 3G0IA 3M3PA 5J2BA 3DLCA 4OAOA 5CH5A 2AF4C 3Q7SA 1SZJG 5KINB 1TZBA 3H1BA 5DXAA 3D3WA 4P4OA 1H9BA 2QR3A 4WN9A 5FOUA 4JBNA 2PKYX 4UI7C 6PFKA 5DU2A 2R6AA 1Q3KA 1QUEA 2HBLA 1M66A 3W5BA 4RIEA 4I55F 5F9LA 4EFKA 3E7PA 1DAEA 4LWPA 4R8RA 3H1PA 1RAHA 1SWWA 3WRWA 1BVYF 3WV4A 1FB5A 3RSHA 4BNZA 3BH6A 3O8CA 1A9PA 3DYIA 3K33B 1DZIA 4ER0A 5IK2D 2IU3A 4WNCA 2QLFA 3GJXC 2EFEB 3H1TA 3IP6A 2XSZD 4JGGA 1UXIA 1TKRA 2XMZA 1SC6A 4LPSA 1DPGA 4PLYA 5C0OE 4HDNA 3SEQA 3PX0A 3NVYA 3SR0A 1I5EA 3A04A 2FXVA 4C2TA 4WZBB 3THYB 4MR8A 2A0XA 3E9CA 5JJKA 4HHEA 5KU7A 3K6SB 2Q5FA 4J7XA 5G0WA 4URYR 5T4BA 1HE2A 3Q6MA 2NRWA 3E7FA 4Q6WA 4MZDA 2FN8A 7ICNA 1MRZA 3RFAA 4PLZA 1THZA 3NVDA 4NPHA 3AHCA 4HS9A 2GEUA 5HF6A 1DQRA 4BGDA 2X9GA 5IBCA 3OF3A 4PC6A 3A6LA 1NI5A 2NADA 5K0CA 3KSRA 5B1IA 3PRHA 4JDPA 1HR0B 3TRDA 3KVRA 4KLHA 1MIOB 4KRFA 3IILA 3D7SA 1NVFA 3L77A 1W87A 2WJPA 1V96A 1DO0A 1ZXBA 4BJQA 3R44A 4X65B 2PS3A 3GLRA 3PC3A 4HL5C 4DL3A 4X54A 1QVVA 3IAHA 3TSAA 2EG5A 5AVOA 3ZWNA 2XCIA 1COWA 2YKGA 3K75D 2BFBA 4TMXA 3EWIA 5JNRA 4FU0A 5AHOA 2C4KA 5FQOA 3IP8A 2XMRA 5ALOA 2BH2A 1Q84A 4I9UA 3MC1A 3O4JA 3T3GA 3TSCA 5H3CA 3UXYA 5C37A 1Z2CA 3X43A 1QTNA 4KZKA 2WABA 2XZOA 4LV6A 4L78A 1VTKA 1FDVA 2EIHA 3DVAA 2J4CA 5A04A 2LGJA 4I2HA 1IQ0A 2XV1A 3CRXA 3B53X 1Q57A 1EP9A 2QRZA 5IWAB 2F1IA 2AT1A 3PI7A 1PV2A 5I7OA 3RWOA 4XVRA 2J0SA 1Q44A 5DN9A 2AGVA 2IXEA 2SKDA 3QA3E 1T3ZA 3H1AA 4LJ4A 2AVDA 3SC4A 3VDRA 3N7PD 3RBZA 5IYZA 3TYXA 5E3HA 4AYBC 3FSRA 3BE6A 2GPTA 3F5AA 5BUSA 3IKTA 4O4IF 4PN7A 2W8ZA 2VTBB 1JLSA 4MQUA 2VHEA 2P9GA 2B69A 4FB4A 3OVMA 1QGUB 2WFZA 4P3OA 2JZOA 3E81A 4FPXA 2PH7A 1UPHA 3PHBE 1P5FA 4D3DA 1N7HA 4ILEA 4F85A 3ELYA 4YHHB 1TM2A 2OL4A 2OT3B 4D4LA 1K5OA 3E8SA 1Y8RA 5KNBD 2PX4A 5J4HA 2F55A 1BA2A 5CX1B 2XQJA 2LCIA 3OZSA 1NBHA 1CUCA 3ZYCA 2C0QA 3ECCA 3AEQB 3K5IA 4K87A 6ABPA 1Z39A 5BWNA 5M5BA 1DRGA 4KO4S 4YG2A 1QZTA 1S7GA 2EJCA 2J5BA 1HDIA 4TLLB 1GZHB 5DGTA 3DL7A 2GPBA 2PH5A 2PNFA 1BOOA 3H0LB 3QX3A 4R8SA 5IUJC 4CLXA 1RQ2A 1ZVVA 1L5GB 3H5VA 3V1NA 3S4YA 2VZ9A 3BTUA 1F0PA 3L1KA 3U49A 2C4UA 1KQNA 4BE4A 1DEHA 1BVUA 1EH5A 2MU2A 2PH1A 1E7YA 3EZGA 4LE2A 1Q19A 1R7RA 1WX1A 1DJLA 4M55A 2W98A 2ZCUA 4HH3C 1SCNE 4I9HA</