2ZIXB

Crystal structure of the mus81-eme1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
322
structure length
259
Chain Sequence
ECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQESRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGETSRRIGPELSRRIYLQMTTLQPHLSLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Crossover junction endonuclease MUS81
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 259
sequence length 322
ec nomenclature ec 3.1.22.-:
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zixB03
3.40.50.11760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zixB02
3.40.1620.30 Alpha Beta 3-Layer(aba) Sandwich YefM-like fold YefM-like fold 2zixB01
4P0PA 2ZIWA 4P0QA 2ZIVA 2ZIXA 2ZIUB 4P0PB 2ZIWB 4P0QB 2ZIVB 2ZIUA 2ZIXB
chains in the Genus database with same CATH superfamily
2BMDA 2D2EA 2EGHA 6LDHA 3ZJ4A 3HWTA 4ODIA 2AOTA 3MMXA 1T4BA 3R7LA 2VDVE 3PD0A 1F60A 3KHKA 1ZI6A 3E8SA 721PA 2JFOA 5ICCA 1U2DA 2IQIA 2CJFA 4GM1A 1CR6A 3VC3A 4BFUA 4C4YA 1K4KA 1CRZA 2OFWA 2QB0A 1OH8A 2WKRA 4HI0E 2WSIA 1S8FA 3VM6A 4E46A 5EWLA 5KQLA 3ENWA 2AR9A 1CNEA 1E9EA 3BVPA 3QMWA 6ABPA 1C7JA 3SKVA 3M0EA 3IUNA 2EBWA 1K6IA 2ZBGA 2OH2A 2C22A 4HX5A 1SBTA 3G7SA 4BV3A 3NTXA 3L3FX 4L0SC 2Y1WA 4YD1A 5AUQA 3AOEA 1K4MA 3L0IB 1JG2A 1S2DA 4NBUA 3BXGA 4H4CA 3V6LA 4JLKA 4TRRA 1KFKB 2J46A 4PLTA 3RSHA 3AB7A 3G68A 1E0KA 3KSBC 1AO3A 3EUEA 3LGSA 5AR1A 3GP8A 1IZ7A 4NNOA 4AJ9A 1DJPA 1CRQA 5COAA 3QTTA 4G36A 2ZTMA 5F1PA 3H9EO 4BFVA 4K1XA 2ZTUA 4Q9KA 6REQB 4IVQA 2BQRA 3SM3A 2P75A 5A2GA 4K46A 1F17A 4X93A 4F5ZA 4YRAA 3GEIA 4MB6A 5AVQA 1VI6A 3K31A 3MXTA 2GCIA 2OK8A 5DASA 1KJIA 4OI0A 2UVVA 2J6BA 4J9RA 5C31A 2GTHA 5CDGA 1URJA 4N5DA 2LDBA 5CFPA 2H57A 3KFXA 1YZUA 4JENA 3V6MA 5KL8B 2P2NA 2D06A 3JXEA 1XSNA 4EG4A 2Q3LA 3WMWA 4MQEA 3ROMA 1HSOA 3X1MA 3KAKA 2NMVA 2Y68A 3ZIUA 5IIIA 2CLDX 1DTWB 2ARKA 3TR5A 1Y6ZA 2QLJA 1KN5A 4LX8A 3MCTA 4AKEA 4G5FA 2DT8A 4FD2A 5DRTA 3B2QA 2AF3C 1DJQA 3OM8A 4MKGA 4R71A 2IBKA 1V38A 4LI3X 5SZIA 2GHTA 3SYKA 4H1WA 2HR1A 4DLGA 4Y2YA 1T1RA 1P2VA 3ZGVA 1A9ZA 2EAOA 3BZCA 4QWDA 1Y1TA 5C8DA 4WNYA 1D03A 5KVVA 1RNLA 4LYEA 2VCHA 3LK9A 1JDPA 4UAWA 3IP6A 5KWJA 1MA7A 4PGXA 1NQWA 1XNRB 3K1TA 4BV8A 4R40A 5DG8A 4Q1FA 5EMLA 1NG9A 1LA2A 4OHBA 1Z6ZA 5A4MS 2FWIA 1O6BA 3QXCA 1RP1A 2BVNA 2PX4A 3GBVA 1OKKA 3CF4A 4MCJA 5TRTA 4DR7B 2HGSA 1HGXA 4ARAA 4UAZA 1JEJA 3PV8A 2WUWE 4LYFA 8LDHA 3LT2A 4B84A 1K5PA 1ZJ6A 5BYAA 5IUKC 4O8ZA 4JODA 5DNUA 4JVNA 1BFUA 4C6SA 3PX2A 3PJFA 2IT1A 3JWPA 4KKXB 3RI3A 3AILA 1LC3A 5JTTA 3SZUA 4RHEA 2G1UA 1XAGA 3UT6A 5K6RA 2IXFA 3C48A 2HV8A 3QPCA 2JAHA 3LV8A 1D9XA 1V41E 4KO3S 2WMYA 1YUNA 1EFVB 4RUKA 1BDJA 4BNGA 4FQ5A 5LU9A 1W2HA 1OILA 1FNDA 2BELA 4BNDB 5FBVB 5CGQB 4FN4A 1SK9A 1FLNA 4KQFA 3CTOA 4HBGA 3RK0A 1KXZA 4KLMA 3A7DA 1CZRA 4QICA 3HVKA 3VNBA 4H15A 4IH1A 5DGDA 3E9NA 2FPPB 1LDYA 4NICA 1LDGA 2X58A 2H18A 4RMHA 1U8UA 4ZO9A 1EH5A 4DNPA 2RFLA 1JA0A 3OSUA 3DEKA 3RADC 1V6AA 1VYUA 1KEJA 4Z4IA 1KDRA 4G85A 5JMTA 1T8UA 1SOAA 2WKQA 4HKKB 2QZJA 1YJBA 1KQNA 3NZEA 2H5EA 2HRQA 3DMTC 3DEIA 1G18A 1ZH8A 3KZMA 4UVGA 3QWFA 5LYJF 3HM2A 3WSTA 5AK0A 4XASA 4DFJA 4EO4A 2JLYA 3TGWA 2ZBPA 3GEGA 3BUSA 2BN4A 2G67A 1AU9A 1H8ED 3ZTYA 1NQTA 3G0HA 4B46A 4KLHA 3GHHA 2V4UA 1KRPA 1EQAA 2IDZA 3ZS8A 1ZGZA 2BP7A 4MWDA 1DAEA 1VFPA 4PZPA 1U3VA 4QJ4A 1T8EA 4H18A 2LR0A 3MZ0A 5BVGB 5CLFA 4K9PA 1GUAA 3MTBA 2BCSA 2JEYA 3KZ1E 1UKEA 3S40A 3EEFA 3B60A 4YJ3A 2XUGA 4J7CA 3PXDA 1P44A 4XQEA 3L8MA 1E6WA 1QHHA 3D4LA 2NSDA 1P4JA 1M6NA 3DAGA 1TK2A 4UXHA 3K8QA 2OBFA 3OMWA 4KX3A 1HDRA 3FTDA 5KNCA 4J16C 3NHRA 1KU6A 3G17A 4IHJB 3BMQA 1J2UA 2HLHA 4CMIB 4YD2A 2G5IB 3T5LA 2F1HA 3M1IA 2AOUA 2PEYA 1KRXA 5LNK1 4HDSA 3RNLA 3QOXA 2PZFA 2WR8A 2EX1A 2HBMA 1V37A 3BWXA 4WGGA 2YYSA 3ZWDA 4BO0A 3A9TA 3NBMA 3WYCA 2Y27A 4EUKA 1JJFA 3AMVA 1RLJA 2GD6A 4RTNA 2TECE 4M7PA 1T0HB 2IV2X 1NJ5A 2F9LA 1VIVA 4L7QA 2ZJ1A 5EKXA 1SXDA 2MAXA 3HZHA 3EDCA 4UJ5A 3OPXA 1PJAA 1U1DA 1UAYA 1UQRA 4FCVA 1Q20A 3GIJA 3SSMA 5TMPA 4ZC8A 2PWYA 1C9MA 2WMNB 1NNSA 4D1YA 1W94A 5JROA 4F4ZA 4KIUA 3N3BC 4HRYA 5JD3A 2I4LA 3BMXA 4HQFA 4MVJD 2F44A 2VXCA 3AJEA 4N6GA 2PMFA 1NVVR 1DCKA 3VR4A 1JG7A 2GN4A 2EZTA 3T5MA 4FMDB 2PCLA 1WF3A 2WTXA 5BW4A 4Z8YA 4X24A 4D6XA 2WHPB 2VL7A 3A2MA 2V6GA 2RSLA 2QUIA 1X0XA 5CVUA 4UE6A 1MIHA 1L5WA 1JG3A 4O4LA 1UANA 4JI8B 1YRLA 3LDUA 2BHLA 3T6KA 3FYDA 4MAAA 4J1NA 3LVBA 5HQTA 4XGKA 2D1QA 5KVQA 2RIRA 1FP6A 4C7BA 1US8B 1DG1G 4A7PA 1O5IA 4LNHA 5CH8A 3DTNA 3CVVA 1SHZA 1X7YB 2EATA 1IHYA 3U62A 5IN5A 2J67A 1L5RA 3QZUA 3GELA 1GQSA 2JIZD 3GLIE 5KBYA 4MVCA 1YB4A 1V3TA 3BD6A 2XZOA 3D7MA 4R41A 2V6BA 1XSPA 1K3UB 4ON9A 2ODAA 4DPLA 3V7FA 4LOLA 4LECA 4F2WA 3WB1A 2BEKA 2J45A 4FX2A 2Z2KA 3O8OB 3ZWWA 1PZEA 1VB3A 2R79A 3GZNA 4GO1A 2IH5A 2PZJA 4E7PA 1U1GA 1YKFA 2QKYA 4KRFA 1UDCA 1R5OA 2XUAA 1TUBA 1P4HA 1ARZA 5KS2A 5JAMA 4L9WA 3D3NA 1BROA 4N0DA 1DNPA 3MERA 4YQZA 1KIFA 2HBQA 2XNJA 1BGXT 1M73E 2IZ5A 4P3YA 5DT2A 1REQB 5DKWA 5FIUA 2W03A 4EX6A 2QXTA 4Q16A 3KJGA 1JHAA 3NHYA 2CHEA 3KJNA 3FYCA 2QSYA 3NJ8A 2ERCA 3VC7A 3B1FA 1OXVA 2HN9A 1M0EA 3PVXA 2V7VA 3AXSA 3H4DA 3B85A 1PN3A 3TYXA 3A1TA 3VUEA 1OYYA 1Y4DE 2NRTA 2YN0A 4B6JA 3QX7A 1N2CB 2Y1LA 3OG9A 2A1UB 2ATVA 2BCQA 2QVGA 4N0QA 1L7XA 4EG6A 4AC9A 2F8KA 2OQIA 3OFND 3PS9A 1Z7WA 1CDEA 3UJ7A 4TT3A 4GBGA 5AOVA 3KNZA 4Y1RB 3CEAA 1FFGA 2C84A 1JHXA 1ESZA 5L3QB 2ONCA 2KOBA 1R64A 4B7AA 4P0TA 2XMRA 3P2MA 4UEKA 2A5DA 3IMEA 2V6MA 1RXIA 5TC4A 2NSHA 2W2XA 2XPCA 1YRYE 4DCNA 3VRHA 4IH9A 2MRLA 2B8TA 3BCRA 4KEAA 5F9LA 2UVUA 3QW4B 2JZBB 1SG9A 4W9MC 1B2LA 2ZJYA 1WO8A 4XQGA 1EP2B 4ZU6X 1ISRA 3OA2A 3PW4A 1FTYA 4WLOA 2WYUA 1IZZA 3NM5A 3R3ZA 3JPTA 1TVEA 2LXNA 4U6QA 5LOVB 2J9YB 2YJTD 5LQUA 1FFUA 1NF3A 2P9JA 5KOHB 5EQFA 3VR6H 1GG9A 4K0KB 1F7VA 4LWQA 3F4KA 4YRBA 3VSCA 4UBIA 1WM1A 3HT3A 4URVR 4A3SA 5BSVA 3FUUA 5DISB 4EYEA 3ZWNA 5NLLA 3GJQA 3KT3A 1MB2A 4CTJA 2AGQA 2JCVA 3GJTA 3I9KA 2GDJA 4ZCMA 4NV3A 2Z7JA 4I50A 5AOBA 3C3BA 2HQBA 1RJGA 2BGJA 5KHLB 2QUHA 3CZ9A 2HU5A 4NENB 2F8SA 1DEHA 3EE6A 3GFTA 2ZAGA 2ZYRA 1NSTA 4ND5A 2QYHA 2B7CA 4D2IA 4AQYB 1K2WA 4XA5A 5CVTA 3AR2A 1M2FA 3UXYA 3RTDA 4EJSA 3BQ9A 4ZA2A 4HYYA 4V24A 1X1TA 2A3RA 3P2YA 4X20A 3K1RB 3DZGA 1J8VA 3N8IA 1NKVA 3FFBA 3ESYA 3D59A 2I76A 1GXSA 1XPRA 4ZANA 2ZG6A 4GQIA 4ZODA 4U2EA 1YQQA 2OV2A 4GZ5A 1D2NA 1NYTA 1E0AA 2VANA 1YDMA 2PWBA 3CO5A 4C6HA 1GNSA 3ZPXA 3IQEA 4NCJA 3N0RA 2BV3A 5HKBA 3M6ZA 1GRCA 2VDOB 5ALUA 1V26A 2ZBFA 3MMSA 8ICAA 1ZDMA 3IQFA 3OIDA 4C04A 4EBBA 3UWMA 1HOXA 3IPCA 3QE4A 2VA8A 2UYQA 3RVOA 2ZS8A 2PKXA 5KQPA 3JQBC 4L2GC 4OM8A 3JZIA 5IJ0A 2GXUA 3PO5A 4LE2A 4UMDA 5BN3A 1WWUA 5KAMA 3E84A 4CIAA 4OM7A 3QI2A 2BFCB 2J4FA 2VF7A 1PK8A 5TT0A 5KTKA 1TXGA 3WP1B 4Y2JA 2FPGB 1ZQCA 2Z6AA 2G63A 5DSXA 2QQ5A 4RY0A 2AMVA 1IXRC 3ZTWA 4CI0B 2VJKA 2GYYA 1XC9A 4HJRA 2VQDA 1D5CA 4FWTA 4QEDA 1VHTA 1SB3C 4JOQA 1X87A 2XLBA 4YCJA 3K33B 5G1OA 4ZOCA 5L9AA 3TQSA 2POQX 4ZCSA 5INTA 2G04A 1YI8A 4H7DA 2OLKA 1E63A 1WMSA 5ADRB 2I8AA 3HUUA 2W0SA 1GRQA 2LYBA 3AP1A 4H0FA 3D5QA 1BDHA 4Q47A 4MZDA 5AXBA 1B8PA 3JQ7B 1SU8A 5EYPA 4B6OA 1GG5A 1Y3CE 5AVXA 2NZYA 1T9BA 4C8KA 4AY3A 5IM4A 4DOBA 1U3CA 4WJ3B 3Q8SB 1G7TA 4M8SA 3LW8A 1VCMA 1OPRA 4NDZA 1RFLA 5CCEA 3QSGA 3RTAA 2QT1A 4HB2A 2B4TO 3UV6A 1HT2E 3NUQA 3THYA 3RDPA 3K9FC 3GRUA 2E1FA 5I51A 4ZV4A 4IDEA 4LZOA 4MWCA 3TDKA 2QN8A 3PQCA 1E60A 3PW0A 1CRLA 5KEIA 1SXPA 1MV8A 2WU4A 4QHYA 3IAUA 3BHMA 2DLDA 2A88A 4BNMA 5SY9A 2X5OA 2W71A 3MJRA 1NURA 3R7FA 2QTNA 3R6GA 5DCLA 1XYGA 2H3HA 2XTJA 1EWYA 2RI6A 3L0OA 1JXMA 3AL0C 1YC5A 2ZATA 1ZHHA 3G0GA 3L93A 5JPCA 4H08A 3KRTA 2H9IA 3C5GA 1Y37A 5J2UA 1TC2A 1KE2A 2FLVA 3O8LA 3AI7A 1IIBA 1DIAA 3I28A 2JV3A 4DSJA 2A2ZA 2G09A 1E4YA 4L32C 5DHUA 1QYCA 2H65A 2R6R1 4NECA 4X1IB 3IHWA 1FTQA 2GEBA 4V3BA 1JHUA 1JSLA 5KJCA 1SAYA 4RQ0A 1P8AA 5LDGA 3ABOB 1VL0A 4UNPA 2G7MC 2OQVA 1AS0A 4FD3A 1ZUWA 5FAKA 4ICAA 3GX1A 2ZB4A 3LDHA 4AYBC 2SKDA 4H27A 2X8BA 1RACA 4ZQHA 3N1UA 1JDSA 4FYHA 4GR5A 5DW0A 1OC2A 3HFSA 4ECXA 3I58A 2YFKA 4GT1A 2FWMX 2FZWA 3PFNA 4PV7A 3WZLA 1PE0A 1TM1E 1ML4A 2J0SA 3GT4A 1STOA 4Z4FA 3RH0A 3COVA 3URMA 4DXAA 4I66A 1VYTA 2J3IA 1RDFA 3H6KA 5F3XB 4QT4A 2Q6IA 2UXCB 2Q0ZX 2HHSA 1J9GA 3K53A 2AD1A 1AKMA 2AA3A 2DTEA 2FE1A 1AOXA 5KFQA 1KMNA 1M1YB 4KFRA 2XCLA 3LWZA 4YMVA 5ALKA 2H4WA 2C92A 3QXSA 2UVRA 4F5OA 3AZOA 5L40A 1CUGA 1MOSA 4FILA 2FSFA 3G8AA 2J0UB 4CU2A 4EITA 5T4EA 5HM6A 1OH5A 1Y3IA 3OFJA 1RS0A 1BW9A 4F7DA 3K0HA 3OTIA 3TRIA 5HEKA 3N2GA 1FX0B 4EI8A 4OQYA 1ST3A 4MVJP 4BEVA 3DTTA 2QXUA 3RWOA 2O5RA 3EW7A 4LC1A 2AL7A 4C03A 3L1IA 2OR3A 2WFLB 2GNPA 4X64B 3KKAC 3MK31 3EJ6A 5BNWA 3L41A 1HC7A 1ID1A 4EATA 1ADBA 3EASA 2W8ZA 3PYXA 3WHPA 2NRZA 3EISA 1KF0A 3W8DA 3U56A 5A5GA 5MGBA 4B8WA 1T2AA 1ZX1A 3JTEA 5EE0A 3EXIB 4BFLA 3GHYA 2XDWA 5L45A 3WLAA 1XC7A 1XU9A 4IKEA 4L4UA 2I6GA 4I6GA 2G72A 4LGVA 3N7UA 1GITA 1OU4A 1T5LA 3WYEA 3GJ7A 3W6UA 2ODTX 2VAVA 1ATZA 4KJZA 2K4PA 2IWHA 2C57A 2ZIVA 2FRDA 4M49A 3U9LA 1WDWB 3AJRA 3BSSA 3TMKA 2Z0MA 4TV8A 3DAOA 4FFDA 1Q17A 1QIDA 5DBOA 1Z00A 3HGQA 2II6A 3V97A 5ALTA 1J2JA 3SC6A 1SRQA 4H7KA 5AKIA 5EFOA 4EFKA 4BN0A 3PQ4A 1Q0UA 1YVUA 3HJCA 1D0IA 4TPKA 1HTTA 4EQ6B 4NQZA 3R41A 5C5QC 2X0NA 1DXHA 3EZXA 5DTEA 4WN3A 1QQTA 2AWOA 3NHSA 1TK0A 3FMOB 4AKIA 4QTTB 4RXTA 1DRVA 3LWMA 3ZXUB 3IQHX 4J2HA 4J0GA 3JQAB 4KN4A 3QYFA 1J25A 4BNKA 4F8RA 3I30X 1GPBA 2VDNB 1ESMA 4G9BA 4YECA 3UK2A 1GCGA 1ZRNA 4BYMA 1ZCAA 3UT0A 4JT9A 3OZ7A 2F2TA 3QXGA 3ZOKA 4HZUB 5BUCA 4DSEA 1Y1LA 1NUSA 4DFPA 3IULA 5JBNA 4LJ6A 4IKPA 1T91A 4CUJA 2HRDA 2GN8A 1S3IA 1OA1A 3H1BA 3TSWA 1ZGHA 2J3LA 4PSAA 1JDVA 1XEWY 4NBVA 4NOJA 4LAFA 4AZWA 4DIBA 1VIMA 3AO0B 1GZ3A 4D8XA 3DVSX 4UOZA 5CPFA 2PZMA 1HKUA 4LF5B 1KI3A 4YR7A 4D9BA 3K1JA 4W9NA 1L4GA 4UI7C 1YT5A 4MUMA 4CM1A 1I3KA 3MS2A 1ZCZA 5MF6A 2XAUA 2P2CA 4MUBA 4C6TB 4A8JB 1XF9A 1XQ9A 5EE9A 3U44A 5GM2A 1RXCA 4LDAA 1P0QA 2GEDA 4R3NA 2WB4A 1ZIDA 3WLPA 4ARIA 1MORA 2B2XA 1XL1A 3RTGA 5AKJA 2A9RA 5EWGA 4B7ZA 3FKQA 1KYWA 1MAWA 3UMYA 2H48A 3TE6A 3F8WA 1Y9JA 1GTMA 1IE3A 5FWXB 3DHVA 2IXTA 4DRXA 2JFYA 2WOJA 3PZRA 2O54A 3KR9A 4PPYA 3NVWA 1U45A 5LB2A 2VK2A 4DIMA 1C9DB 4O3SA 5I9BA 1HUOA 1R1DA 3ZLTA 4JKOA 4UVIA 1Q7RA 3TSCA 2WEKA 3CVOA 3WMGA 2LIPA 3FTNA 3HKDB 4NZMA 2JH9A 4DM3A 1WLYA 3D7KA 3F0TA 4JR0A 4UI4C 2QTLA 1OGYA 1R66A 3AINA 4HGPA 2O0LA 1ECWA 3ZGOA 4TVKA 3VR0A 1NVMB 2R6AA 1ZITA 2PI5A 2WILA 1FDTA 1BCRA 4TMXA 3M82A 1M6WA 1C7QA 2G4VA 5D87A 5KU1A 3SYZA 3MFQA 3BBPA 1DI0A 3PC4A 3D1JA 2D00A 4M83A 2D5AA 3OLZA 3DO8A 4ICIA 1N1GA 4UNQA 2OD2A 3C7CB 4FS2A 7YASA 1Z5ZA 2W2LD 5J4LA 1PV4A 3OC6A 4M1WA 4P93A 5DF1A 4EMBA 1X9GA 2SICE 1L7DA 2O7SA 3CKLA 3TPZA 5JZMA 5J2BA 1N5OX 2Y0DA 2O06A 4KMUA 1Z8FA 3RSSA 5CB4F 2K89A 4OGWA 2JZNA 4YXJA 2XITA 3Q85A 1I24A 4ZDIA 2OWOA 4K88A 3LVQE 1HE2A 2HBJA 1BXRA 3M33A 1LTKA 5DWVA 4N48A 2IQ5A 1WOMA 3V4FA 1SUFA 3NQ41 4MPRA 1L5NA 1HYQA 1XDBA 2KZ3A 2NO0A 1NK4A 2WDPA 4MF2A 3D8UA 3VTZA 4P4SB 1TAQA 1UF9A 5FWYB 1QFSA 2X13A 1WPGA 4EYSA 4BVEA 3HEAA 3ESRA 2P7IA 1SL2A 4RANA 3ECCA 1URPA 4IQWA 5KNCD 4ED7A 5LQRA 2WYVA 2NTYC 3FY4A 4KV7A 3SF8B 4A73A 3NEYA 2IPMA 1PVQA 3EMBA 4V2IA 1GRNA 5J4HA 1QCKA 3AVVA 3C98A 4JD5A 4TTVA 1PZXA 3GVCA 2XNSA 3ZUPA 2I2XB 3PXBA 3V7NA 1KS9A 5B36A 6YASA 1TT5B 4KXUA 3OVMA 2DP4E 1EWTA 2HF8A 2JI4A 1CS4C 2A9PA 2BZGA 3BMOB 4FYPA 4JUDX 2VUHB 1E77A 121PA 4G5YA 1OLUB 4BMVA 4ZOLB 1R2QA 1GTSA 3FCSB 4LV8B 4WFKA 1DOZA 3VO2A 1QH8A 2PE5A 2BIFA 4EMSA 5DYWA 4DXHA 4WI1A 1AUOA 3H0RB 1AK2A 4FDUA 5C4IA 4C7OA 2ZDQA 3QE0A 4H3HB 2VPYA 5CJ7A 2QVXX 3VNUA 2ZTLA 5DDIP 2ZT7A 2NPOA 3TW8B 1UBNA 4OBWA 3OZBA 4Z5XA 4HKNC 3LIIA 4CCYB 3DAPA 2R8IA 2E85A 3ULKA 2FRXA 3BN3A 3F1KA 3ZW9A 2INGX 3R9XB 3O1IC 3V9PA 4XYEA 2A9FA 2KM1A 3B3AA 4GBED 5EUQB 4ECQA 2FZGA 3Q1LA 5JY1A 3HCNA 3C5FA 1NVEA 4G1CA 2Y9MB 2GWSA 4FM9A 2BTQB 1GWNA 2XVZA 3HH8A 4N1AA 5BSRA 1FA9A 2W3RA 3BQTA 2CJXA 3O94A 3ESZA 1XZLA 3G6KA 2D0IA 4L95C 3FPLA 3KB1A 3PTZA 1TL7C 3PWSA 3D0QA 2VYFA 1YBFA 4YCDA 1DQRA 4Q9LA 3LLMA 2B25A 5JLJA 4P2GA 4FBTA 4KBYA 2QLLA 3O8QB 2IHUA 2HW3A 3HM9A 3V6JA 1ZSYA 2WT8A 1P2SA 3U26A 1FYWA 2FMPA 1A9OA 3FZNA 3ADBA 3BIFA 2O57A 4BGUA 4F3RA 2CB0A 1BE0A 2V6FA 3LIPA 3UJ3X 1WX1A 1TJYA 2VS1A 5FNVB 2R7AA 3FPKA 2DPXA 3L6UA 3DB1A 2J7PD 3ZCTA 3LCUA 3ICQB 1UWCA 2R1VA 4ZEVA 4YJHA 1N4AA 1ZM9A 4EB3A 2COUA 3V7JA 1RKUA 3SLGA 1UCFA 2KI5A 3N7RC 3EAGA 5E6SA 3UFXB 3FCOA 3TVDA 3JQ8B 1X7ZA 3SHVA 4EY8A 4MDEA 1C30B 2R8JA 1ZWKA 3RWMB 8ICQA 4CQJA 4ER7A 4OHOA 4KGDA 5IYZA 4OYHA 9ICCA 3K09A 3PX7A 4HLDA 4INJA 3IQWA 5BN1A 1WB6A 2J31A 4RK0A 4O8CA 2OZLA 1XZJA 5LCXA 1PQPA 3PKJA 5CVVA 3ZZNA 1UKVY 1E1RD 1BDBA 2AX4A 2FVYA 1LBIA 1U6KA 2CKDA 4Z1OA 2F55A 2DHDA 5FFMA 1SVLA 4H1UA 2W48A 2N1BA 3Q8PB 3RC7A 5C9ZA 2GM9A 3UH1A 3QKSB 4AECA 1TK8A 2W8BA 1XRQA 3KVOA 3WISA 3KVRA 4RNDB 4YCCA 4AY4A 3IT1A 4MB2A 2WAYA 1VI5A 1SQFA 1CD5A 5I45A 2FDCA 4ZJZA 4COKA 2PL5A 3NYWA 1U98A 3HDJA 4B7CA 2RJOA 3AV3A 1ENOA 1SJ9A 2X4DA 2I3GA 3L0DA 3B1ZA 3GRVA 1BXZA 1MOPA 1J4AA 4PPQA 1BA2A 5BQFA 3RHTA 2MINA 3KQLA 4MEBA 1Z62A 1ML3A 3EMDA 4OB8A 3NAGA 3AKEA 3CZ5A 5JSFA 4C4AA 2JFVA 5I7HA 1H2XA 1K6JA 4LDNA 5TPZA 5ITVA 3UGQA 3AGPA 1XP5A 1Y7HA 2Z8YA 4MCIA 3ORRA 3QWIA 4KE6A 4Y2UA 5L9XA 1YI1A 4PQEA 4EX7A 2CVHA 1EJBA 3W5VA 4C01A 3NVKI 1Q14A 3VYWA 4N5HX 3RS2A 2ZYAA 3V42A 3RJJA 1H6AA 5JMOA 1W4RA 4DLXA 2V4MA 3NR2A 4L8LA 4J76A 4Q1EA 1NX9A 3WBJA 3C3AA 2RDJA 3HSSA 3LUGA 5CAEB 4TVSA 4AQ7A 4JP2A 1ZK2A 4BQPA 4Y67A 2AHRA 4IQVA 1FDRA 5AP9A 1C1YA 1N5JA 1T6BY 1JEYA 5CT8A 3X1WA 4PBRA 1S3SA 4LRTB 4TTIA 9GPBA 3SAJA 2ZROA 2EZUA 4Q37A 1Y3DE 4OHRA 1YJAA 2OBYA 3BAZA 1NOMA 5ECWA 3ECAA 4TYYA 2W2OA 1A2BA 3O9VA 1NOKA 3PSAA 5DLPA 4MLZA 4Q7QA 2WWRA 1PSDA 2Q5EA 1CULC 4K1LA 3CLSD 1PZHA 5G4KA 1LUAA 1ADFA 3A4VA 1MABB 1TQDA 4C43A 3GJ5A 4KPUA 2KIWA 1B76A 4OV6B 3O7WA 4CGYA 4LXIA 4YPVA 1CRWG 3IV9A 2W70A 1LZLA 3VAAA 1Y8CA 3IX7A 4J03A 3B48A 1EWKA 3IOEA 1WF6A 2JPDA 4JL5A 3N8GA 1Z4NA 3DGEC 2NO6A 4QULA 4F6RB 3R8CA 3UPTA 1VG8A 3F2BA 3ESQA 2I87A 1LRJA 1C1XB 1Y6QA 3NH6A 3NBYC 4P2HA 4YREA 2GJ4A 3MFIA 4I1SA 4BDTA 1SKSA 4CEJA 1GQYA 3QFRA 4WERA 2X0JA 2KNJA 5E6UA 3TFWA 3LC0A 1QKIA 1GUZA 1ADJA 1KEEA 4GW3A 4O3PA 1WHTB 2P4HX 1S76D 1S5LU 4XRHA 3G3EA 2DUYA 2O8BA 4P54A 5DE3A 3GIIA 4CE6A 2QQEA 1G21E 1E18A 4X6LA 2ADOA 1GKIA 3W6PA 3T34A 4WESA 2JI6A 4M98A 1ZIXA 5A0TA 1ZAKA 2H7VA 5LA6F 5HGXA 5LSAA 5J0OA 4JB3A 1BRMA 2YMMA 4PONA 2PRYA 5JH7B 3Q5EA 3H8VA 4A1FA 4ENRA 1U3GA 1RYRA 1E6CA 4I5DA 3U6BA 1JHMA 1Y7LA 2P5SA 5K0BA 3BMCA 5IF9A 2FP3A 2ODKA 4LXHA 3O93A 2BHTA 5G5GA 3RUIA 2P8JA 4TWBA 5TZVA 1FMCA 3I8OA 3NGLA 5DV9A 3F6BX 3LA6A 1VLJA 1ZQPA 1ZL0A 3BJIC 4YJFA 1GZ5A 4DYDA 3OJXA 5IXJA 3MTIA 4BMDA 5ES3A 3OC0A 1NULA 2CVQA 3KEFA 5DBEX 2JBAA 1GN8A 1BMQA 2F4VB 3NAQA 3SC2B 2RHRA 1Z15A 5KFSA 3C41J 1VPVA 4F21A 3AOGA 5K99A 5FNZA 3HCDA 4M7RA 3FGNA 4YMSA 2ST1A 2B9EA 5JXHA 2FCRA 3RFVA 4QG7A 3V8QA 3T3HA 3EQZA 1B0PA 2BFWA 1MD9A 5E6RA 1NASA 4NONA 1S7GA 3GVIA 2J3JA 2YMPA 2PD6A 2O1WA 2ZR8A 2HQOA 4G5HA 2YV3A 1V95A 5KFZA 2QLNA 5CA7A 1TU0A 2JEZA 5HQ3A 2PWZA 3WICA 1JB9A 2QPLA 1PUXA 3F67A 4YGYA 2KJ5A 1ZY2A 4KMMA 3TLXA 3VCBA 1S0VA 3RC2A 4JI1B 3S2IA 2IE0A 3TM5A 4BTEA 3GEPA 2C5EA 1WXEA 4MW7A 1C5KA 5H3CA 2I2AA 3FDZA 4WEQA 1Q7BA 3SKXA 4XUCA 2OAGA 4B3FX 1LDEA 1MOZA 1SKBA 4UB6U 3N4MB 1NG1A 2L17A 4OXYA 1S5PA 1OYVA 4LZZA 4WXRA 2G88A 3OFKA 3UN1A 3K0AB 2P2ZA 1A4XA 4AURA 3NKLA 1DOAA 3EUFA 4JU9A 1XD2A 2VTDA 2GERA 2VKTA 3LBAA 4XB2A 3I6YA 2ZBEA 2FX5A 3BGSA 1CZKA 4BQEA 3JPYA 3OPMA 3ND8A 5KDOA 4R66A 3SR4A 1UWVA 1U2ZA 2Y4OA 1A98A 4ARCA 4D44A 4I4TB 3RB8A 1V5EA 1WD7A 4C8OA 3OP1A 3UA3A 3LUBA 1QBKC 3T1QA 1IH8A 2BKXA 2HJRA 5J0WA 1QIMA 4HDMA 1L2TA 2CLKB 1N48A 3KOUA 1EFTA 3F97A 4J0EA 2C1XA 3CR7A 5EJGA 4BDPA 3ZNNA 2YWEA 4JBHA 4YYZA 4K4HA 2UZ4A 2IWRA 3NHFA 2PUVA 3V2HA 5AHWA 4Q6WA 2W4MA 4GHWA 1H6CA 3I04M 1UMCB 4PHFA 1FMFA 4W7IA 3FGPA 3K70B 5JD6A 1DAPA 2JD2A 5LB4A 4LRSB 5CA0F 3FSEA 5T14A 4RSRA 1WG8A 4I6JA 2FN9A 2JGDB 2P62A 1Z34A 4LRUA 2G5CA 1JIKA 3GL9A 4ZTZB 2IEGA 3GUVA 9ICLA 2RGNA 1HQDA 2ZI4A 5JVDF 3MS4A 4Q03A 5J9FA 3ST7A 2PI4A 1H69A 1M1ZA 3HACA 2ZSAA 5KNBD 3U1BA 4NV0A 2ZB2A 3MMPA 9ICGA 3C21A 4LRYA 1FFDA 2FG7C 3M49A 1MC1A 4GQAA 3D1LA 4FU0A 4H4DA 1AG9A 5BN5A 4DB4A 3RU2A 1U31A 5LPNA 4YRRA 4RD4A 1U1FA 1IVSA 4BUGA 2ILVA 4TUYB 2O1SA 2BSXA 3EG9A 1GV1A 2X42A 1W0KA 1ZKDA 3I2GA 3F7NA 5KDDA 2PH7A 2Z98A 3INTA 4WVLA 2ZYUX 1AY0A 1QG6A 4F5EA 1I3CA 3GUCA 3AUJB 3MB8A 4ZCPA 2IYZA 2FWBA 3IODA 3BCUA 4ZT7A 1E96A 2IPOA 3T5BA 3L7MA 2WFMA 1EFRD 1MO2A 3E15A 3D0RA 1DAFA 1VLZA 3D3JA 2EFYA 3ISVA 4J9NA 1ORVA 3V2GA 2OYCA 3QEAZ 2BMAA 4JLWA 5BMOA 2B8WA 7ICNA 4BNXA 1IBKB 1ZZGA 2O20A 3FI0A 1AQJA 1KYXA 4DUGD 1DEOA 2AIRA 1YVEI 3A3KA 1OFUA 2QUJA 4UB3A 4ZQIA 4GZ3A 3VYVA 1MC5A 1CI4A 3MCVA 3W3AD 1RVV1 3BWCA 2XZPA 1TECE 3UK6A 2JCBA 3NC1C 3K9NA 4AO6A 4UHHA 2F64A 5EXPA 5C18A 2D6FA 3T4EA 4WZZA 5EWMB 1GPH1 4O1IA 4AG3A 1OV4A 3ZV5A 4F92B 4YWHA 3UQYS 1UP7A 3W1EA 3SY8A 4R2MA 5DLDA 2GN6A 2IS2A 3O8DA 3T5PA 4KUGA 4LMPA 1QWSA 1H9CA 3GT7A 1XZHA 4DQVA 4L5BA 4AWAA 3UOAB 2IV3A 5JD4A 5TJHA 2BFBA 3U7IA 3R0JA 2Q1TA 4OMDA 4KXXA 3T3OA 4DC9A 4FJ0A 2YWGA 1TGYA 1E79A 4HDKB 1Q57A 4FLEA 1KK1A 3L8FA 1PD1A 3D4IA 1YQUA 1WU8A 3ABRB 3NIGB 1NSYA 4WCDA 2V59A 3VVMA 4EY5A 2D1FA 3REQB 4YMGA 1DC6A 4MEAA 2PJZA 3T3NA 1U7WA 1TKAA 2EFJA 4UFPA 4OX9Y 2ASLA 4XCQA 1SBQA 4Q12A 1V97A 3D4BA 5ALQA 4M0LA 4BUZA 3Q5GA 4EUEA 1C8LA 4IIFA 3MWYW 2CKMA 3CLTC 1HH4A 2CDCA 1SKMA 3LWBA 4DSAA 4W63A 1XZQA 4YRKA 4UM7A 3B7GA 4DM4A 3KB8A 3SLKA 2UYGA 1UBGA 3SN6A 1M2NA 1KWKA 3ZJYA 4KOAA 2BKEA 4FO6A 6Q21A 2EQBA 4HUJA 1ES9A 1KKLA 3D6NB 4MUIA 3VKHA 3VHQA 4H3SA 1K9VF 2WTAA 2RHBA 3NBKA 2JAUA 3B38A 1YIDA 3CUYA 2X0DA 1OU0A 3PXEA 3L7CA 5G1NA 5DK6A 1VHWA 4OB7A 2FPOA 1GYRA 2IXAA 1Z7EA 4FFMA 4D79A 2FPWA 4AZVA 1P6UA 2WKSA 1T3SA 3G5OA 1M6YA 1E32A 4RQ2A 1N9GA 4DL5A 4OHPA 3QA3E 1HDGO 4RJTA 1RCFA 1JR3E 3B1JA 1GAQA 2M0NA 2J87A 1DK3A 5D86A 4Y30A 4Z1MA 2WWXA 5K0EA 1H94A 1H42A 2V5UA 3IIIA 1RMQA 3MD0A 3ZQJA 2WD8A 1ISGA 2AVNA 1JXEA 1DV2A 5I4KA 1CYEA 3O4HA 1EXVA 2WPDD 4A82A 2CLCX 4RF3A 1PR9A 4WD3A 4AMVA 5ICFA 2AFHA 4HYKA 1SO8A 1WRBA 3BZUA 1CIJA 3UJAA 1JG6A 5DGAA 3HRDD 2Z2IA 3SQIA 2A78A 2X14A 4C2BA 1OVGA 1NE2A 4TN1A 1WCYA 3LT0A 1W19A 2D5CA 2LNDA 2ROQA 3RB3A 1M8FA 3RIXA 1LLDA 1TIBA 3R23A 4HPXB 3G9XA 2MHCA 2I2DA 4UNNA 1K86A 1X86B 4ALNA 1C9YA 1CQPA 3MLAA 2Z2JA 5ILGA 2XZLA 3SFVA 2G77B 3UJ8A 2CW5A 3IP8A 2F76X 4GLXA 1ZOIA 4HEHA 2BQUA 1PEKE 3C7AA 3DOIA 1F2UA 4N6NA 2HZ7A 3OKFA 4GBMA 4R7ZA 2PR2A 1VC2A 5EINA 4XTCS 3TZ6A 5FWAA 3G5MA 1IONA 1SXJD 2XWBF 1NJYA 4KLEA 1VBKA 4R8KA 2DKXA 3GB9A 4M76B 4ZRMA 2QARA 4ASUD 3E3LA 4GUDA 4YR2A 3GFPA 3PSPA 4DANA 3N8HA 4MDHA 2QRPA 4QTYA 2PUCA 3S4YA 4LQLA 2REQB 1N36B 3ED1A 4V0NA 2JI7A 4X6YA 3O0DA 5LQDA 1K75A 1FS6A 4XGNA 5B2EA 1B42A 9ICNA 3ES9A 3PICA 1MO6A 2QTFA 4UHBA 2K4HA 1E5XA 4YO8A 1N0VC 4F2HA 2YV1A 5BV7A 3AFNA 3E2MA 5HIKA 1BN7A 2VYNA 1BC5A 4PRLA 1ORRA 4D9MA 4BVLA 3QELA 4QZ8A 2EKLA 1U8FO 5GONB 4UNSA 4RMNA 4C7MA 5D2CA 1KFDA 3TR0A 4BY9E 2GD0A 1V96A 2XRFA 2DBVO 2I54A 3P0IA 3SJCA 3HSKA 5DNVA 2OG1A 4DO9A 2NU8A 3AF5A 1FPMA 2GN2A 5FUVA 4LTDA 1J0EA 5B64A 1KRHA 3GLFE 3P9QA 4CRWB 3IQXA 2G71A 3ZE9A 4HN4B 3ICXA 4EHNA 1YQDA 1KE1A 3FCXA 3MUNA 3EPHA 3FWYA 1R6BX 3A1CA 4PXSA 4AF7A 1JG4A 3SE7A 1ZNWA 5IINA 4HNHA 3OKCA 2ZYSA 3WAJA 2EERA 3CSDA 3BG5A 5YASA 2DU8A 3HN6A 1OI4A 1R6VA 3F8SA 3BBLA 1X70A 1LPOA 3HVJA 3II6X 2XJ9A 5TE9A 4PZ0A 4Q3OA 5HW0A 3OHAA 3PSHA 2XB6A 4QU8A 3GA0A 1T5SA 3DS8A 3VDRA 1JDTA 4LZWA 1MT0A 1SFRA 3DUWA 3AXTA 1VECA 4HKIC 1S4QA 3UQZA 3NDBB 3M2TA 2IL1A 5J2TA 1WR8A 3JZDA 3NX4A 1YZLA 2GEUA 2J3EA 5B1SA 4DL9A 2R8BA 3VOBA 2FMQA 3USCS 3UNXA 1XALA 2AG6A 3AEKA 1A27A 1JEEA 1QHEA 3Q9NA 2IH2A 4ZHQB 1VJ1A 1D7AA 5KNDA 3JYOA 5CHGA 1UFRA 4ZVOA 1OFTA 3UXHA 2PTHA 1VJTA 2XWJI 1LS6A 4U7FA 3VAZA 2HIGA 3UWDA 1Z0JA 3R20A 1GADO 1XKLA 1QAOA 2JFWA 3KZVA 3JQQA 2V1UA 1KFJB 4YXWA 3UHFA 3M6AA 1SOWA 1V6SA 3DBLB 2B8JA 3PZPA 1R8XA 4NXMB 5AIBA 1PUZA 1IZ0A 1AXGA 4Q39A 1F0PA 7ICEA 3HY4A 4L2IA 5FO0A 3RS8A 2O1XA 3E2EA 3BWBA 3OHPA 2V0GA 1HRDA 2ID8A 2W6PA 1SH7A 3HI4A 3E61A 2CNNA 2JKZA 4FW9A 5I7OA 4DLNA 4EY4A 4BU1A 2PS1A 4P2BA 3QUBA 5A4KA 1DO8A 4QYXA 4Z0TA 4S1NA 2G7ZA 2X23A 1XZEA 2B94A 4R64A 3MABA 2ET6A 4G81A 1DRUA 2VQ6A 4CLOA 3NKVA 3MT0A 3NMUF 3ZTTA 5KFNA 5B5EU 1R6UA 4A23A 1HYBA 5J2EA 3R24A 1VLQA 1QF7A 1W6RA 2J5BA 4NJOA 1J2RA 4RMJA 3EFHA 3IVAA 2JRZA 4HDRA 2C54A 5DXFA 2QR2A 3TTTA 3PV0A 4IX1A 5JUWA 2VNHA 2OFXA 3QVTA 4C2AA 3WQHA 1TKBA 3V2IA 3ILVA 1GM5A 3SOPA 3KXLA 4QXQA 3H0CA 1M6VB 1N32B 3MWGA 1BPBA 3KOWA 3K0CC 2PXIA 5L53A 1TVCA 1NM5C 5DEIA 1DGSA 1RJDA 1XI2A 5AW4A 4C4RA 2GCOA 5EJ8A 3U80A 1YB5A 4K9OA 4EOGA 2PFSA 2WY2D 4E94A 3HVUA 3H9BA 4NRDA 521PA 1ZQOA 1AX9A 2PGDA 3RFTA 3QUQA 5EY5B 4MLPA 1OMOA 3I8SA 4BX9A 1L5FA 4OLFA 1C2YA 2ZR7A 2WJAA 2EL7A 3K6JA 2VATA 2W9CB 3T35A 2NN3C 1HEIA 4JCCA 4U9UA 4ELVA 2X0IA 1T3GA 3VU8A 4FX5A 4OJYA 3H9JA 4JJ6A 1NU6A 4PR3A 2HPZA 4BVHA 4HRVA 4ZI7B 1QU3A 4TGLA 3TAPA 4CG1A 1F0NA 3OEWA 1EEXB 5FD8A 2WAOA 1NR1A 2ZYHA 4PLCA 4PNEA 5J3JA 2YB4A 4ZVNA 1C8VB 2JK0A 3MM4A 3FPEA 4MS1A 3MSCA 2QOEA 4L5IA 5F9NA 1QCZA 5CYOA 1UBJS 3GG9A 3SZOA 4NP6A 3T3FA 4F2DA 1E69A 1HNWB 4L2FC 1ZRSA 1QV9A 1UPBA 5FAXA 3UUEA 5BPCA 4UTRA 3FYSA 1GU0A 4JS0A 5AM3A 3RT9A 3O47A 3RFUA 3CR3C 1L7NA 5T41A 2DTXA 2KX7A 3COPA 2AI1A 2FSHA 1QGUB 1DBSA 3LX8A 2VA9A 2KZMA 5IZ4A 2JFGA 1QO0D 3WYAA 4K87A 3TQQA 1N77A 3OX4A 2PLWA 4ECWA 1RKBA 4PLVA 1JA9A 3PL5A 4CBVA 2QT9A 2PMEA 1Z75A 5BWBA 2PEZA 3E7XA 4S2EA 2EYQA 5B3JA 1XU4A 1WZEA 3LHFA 5K0NA 4KQCA 3MJFA 4RLFA 5ALRA 3PXGA 3KHRA 4B6RA 1WB4A 3ZK9A 4U2GA 5FWNA 3AIIA 2QJOA 2HB6A 4MWTA 3SAHA 1UK7A 1TQ2A 1W5AA 1PL0A 2ZXIA 1SUWA 5L3VA 5IUJC 5ALVA 1DU4A 1ADCA 1YR8A 5ES4B 3AF1A 2Z3ZA 2EJWA 5K09A 3GA5A 1P7DA 3O3CA 1CBUA 5G3ZA 3N76A 3SX2A 3LVWA 3RANA 3QG5A 3ND7A 3E4CA 3AERB 3IT2A 5C8YA 3ZQUA 5A4DA 5K4LA 4Y6RA 1E7QA 1UA1A 5AJYA 5EXSA 2NP6A 4QU5A 4OIFA 2P2YA 2NU9B 5KYKA 2JEOA 4OSOA 3H3FA 3E1GA 3NDJA 4ZM2A 4DT1A 2Y2UA 2VT7A 2JHDA 3AM9A 3U3OA 2IEYA 4PZZA 4N3BA 1D2MA 2JK1A 4TMKA 4EEXA 4UAYA 4X45A 2P9ZA 4CMEA 1UMDA 3RJFA 5GTHU 1PJ8A 4E1BA 4RD0A 1BE8A 4PIMA 1HT1E 1OFHA 1PJ2A 2ASDA 3SQNA 5L7YA 4IXNA 4NULA 1SULA 3KG2A 4P7BA 3JY6A 3TINA 3AL3A 4F45A 1YE8A 4D4HA 2PFQA 4BQIA 2H4ZA 1QH1B 3VMMA 2KMDA 1B43A 3ZLJA 2HYDA 1LTHR 4L0QA 4ADSG 2IX3A 3PNPA 1IJKA 3CRXA 5C5JA 1DHRA 4K8OA 5FR1A 3GMDA 5KC8A 2VTKA 3O9ZA 4GMKA 2VA2A 1N0IA 5ALYA 4J2TA 1G41A 3KYBA 2AZMA 3EFOA 4PQYA 2HQ1A 3TPFA 4UAUA 1N2IA 1QNLA 2M6KA 4HKTA 1YRAA 2E82A 3E22B 2XGJA 4D9IA 3S3TA 3FZQA 3DNMA 2V55B 1UKBA 4BO2A 4FQ7A 4MPDA 1WCNA 2OXOA 1A5BB 2YOHA 4OLAA 2P0YA 4X3CA 2ZRMA 3SMQA 3KQYA 3HWX1 3NP7A 5EZYB 4P3OA 3X2FA 4B8ZA 4B75A 4BP9A 3DR3A 3GRCA 2DQ4A 3IKMB 2CEAA 5TMEA 4IFBA 4FT4A 3MWEB 4RWEA 2XVXA 1SIJA 4NAUA 1YR7A 3EYAA 4C0JA 1VJGA 3JALA 3SCZA 2V7BA 3JRXA 1OTYA 5KMGB 4RTQA 2CLOB 2JKYA 1G8FA 3S6JA 5ILOA 3HO8A 3VYSB 2DLCX 3NWEA 4UAGA 2O8DA 2D13A 1NRWA 1JHQA 3ZVNA 4FEAA 5BV1A 3I6MA 4DYHA 3HPQA 1EWRA 1W93A 4IIJF 3F5QA 3ZWBA 4AUKA 4YN4A 4QWEA 1KMMA 1BEZA 3SS9X 1W7AA 1YR2A 4XA8A 8ICBA 4IO1A 3U40A 1Q3KA 5JLAA 5H3HA 3IBSA 2PGIA 2HIHA 3GGOA 1E1CA 3MR5A 1DJOA 4G2TA 4NCNA 2XQIA 1E2UA 4P36A 4WNAB 1RT9A 2BDUA 2EP5A 1A7UA 5H9VA 4K9LA 1J42A 1U49A 4PS0A 1P2UA 3M8KA 3WQBA 2QRVA 5EZ6B 2ZJ3A 3FNIA 2OVFA 4K6CA 2IZ7A 4D43A 1RQXA 2P35A 1Z2NX 1MC4A 4NPCA 4FCWA 2ZE5A 3CNEA 4O33A 4C0SA 1QZ3A 3WGZA 4E7OA 2CD9A 1JALA 2YFQA 4YAGA 4IUYA 5JAIA 1IG0A 4DXDA 2IS4A 4I27A 4FONA 4MHSA 2PFNA 4R8SA 5FWDA 1P7WA 4JT8A 1P6XA 1T5IA 3Q3HA 5A4IS 1CDOA 3PPYA 3RJTA 1FNNA 1OKKD 4FR0A 3VPFA 3MINB 2HRZA 4PLHA 3V8BA 2P6PA 3IDAA 4EM6A 2Q29A 2O3JA 7ICHA 1PV1A 1SBNE 2ODEA 1RYMA 5KYXA 2I2FA 2MUTB 1S9DA 3IPRA 2VPWA 1W0KD 3TE7A 5J58A 5EJ6A 1KZ4A 4JOBA 4BECA 1ZD4A 1V16A 2QX7A 4QDUA 3FOZA 3DSRA 3GT3A 4QUJA 1UR5A 3WHIA 2WF5A 4B9AA 3ZJTA 1X42A 2A57A 1EFLA 5KAPA 4E07A 1O96B 4M9NA 2H2WA 4RK1A 1B3BA 2R7LA 1MXFA 1YR3A 1G2IA 3OQMA 2RHJA 4LBZA 3Q4GA 1CJMA 1YDHA 1FDOA 3Q7EA 3B53X 3DVRX 2WHXA 3HYCA 3SYNA 1S6YA 2XNDA 4DOMA 3K6SA 3H11A 3WK5A 2BFFB 3T5AA 3U3JA 1SD5A 1UQVA 1AQLA 1A4IA 4J3FA 1LJLA 1FUUA 4X7PA 2GK7A 1H2RS 5J0SA 5K0SA 4RY2A 1T8RA 1SKAA 7ICVA 1VLVA 2C83A 3C1TA 4AF6A 4I55B 4TTAA 4CKEB 1YZHA 5KFJA 2RHHA 4HATA 1AGPA 4UMFA 3TFSA 2BCVA 1D8LA 1POXA 3GGGA 1JDBC 4CQMB 2GA9A 4G8CA 2CGEA 2VSOA 1QK5A 3KTOA 3EUB2 4B9VA 3E9ZA 1KOFA 4KZLC 1W0JA 4IDFA 4N18A 1A4UA 1EVIA 1SBCA 2HUNA 3K94A 4U9IS 1WVMA 3K5PA 3Q6IA 3LE8A 3KUCA 2XDQB 5SY4A 1L4KA 3K4GA 4Q6BA 4BRWA 2LYHA 1JSCA 3HXMA 5KFEA 2BEJA 5HGJA 4YFVA 1GR0A 2QVYX 4B76A 1XRSB 2C99A 1CERA 1FLVA 3MBKA 4F46A 1LPAB 4QFBA 2BM0A 1KO8A 1E79D 4Z7JA 2C9YA 3I92A 2C3UA 3PX0A 3BB3A 4BLQA 1OX4A 1R15A 5B1YA 2QUKA 4KXMA 1FL9A 2OXEA 5E4JA 4ED2A 2XI9A 4QOFA 2PJDA 2YDXA 4KC0A 1CVIA 1L4MA 1OZFA 3F3MA 1JYSA 2B98A 4D80A 2W6QA 5E4FA 3KO8A 3T5TA 1A95A 1BN6A 3ESXA 4DCOA 2DYKA 2PNJA 3C8DA 1PKXA 3MT9A 1Z5WA 3PF8A 4HUTA 4LQDA 3UK7A 2W4QA 4JI4B 5GPBA 4OO1J 2FDXA 1P3JA 3EB9A 4LKOA 2QAJA 3TI7A 1DGJA 4MA0A 4AAYA 7ICFA 3LXXA 1IG3A 3IEPA 2Q9BA 3CRQA 4J91A 5GJVC 2CYBA 5IT0A 2VAWA 4YXMA 1Y8RA 2Y1GA 4MUXA 4UARA 2QVBA 1P4AA 4FOPA 1Z3CA 3JSXA 4NS1A 1NC1A 2GD2A 1T4CB 5JRDS 5D3QA 3RIYA 2OYRA 3THXB 1JR2A 2YZGA 2E5WA 3R75A 4PGGA 2OC9A 2UUOA 4C4PA 4ENTA 5ESDA 3AMZA 2D1SA 4AS3A 4YRFA 3VU1A 2HWWA 2J6HA 3R7AA 4ZQFA 2CXHA 3LU1A 3EH2A 2KYRA 2WJZB 2BZFA 1SCUA 2JMGA 2ALZA 1U0JA 1D2AA 3VR4D 5HTKA 7ICRA 1AB6A 4I81A 3FHOA 4ZMBA 4QWMA 5SZKB 4RTPA 2YOGA 2G17A 4AFNA 5KNLA 1V6CA 1U11A 5IT9A 4RPJA 1EUDA 3EPGA 1GCIA 1SZPA 5FEUA 4JASB 5DQIA 1JAYA 3T41A 3UTCA 4XPIB 4MQ5A 1IY8A 4ZCQA 5A06A 3GLRA 4Y1EA 2GM3A 4F85A 1MMFB 1ZK0A 1M8GA 3A1SA 3WG9A 3P4YA 1ZQXA 4Y9DA 3NRBA 3DBRB 2PSJA 5KTYA 5DOVA 3VPCA 2PXAA 2QP4A 3VYTB 2JD0A 2VPIA 2HI0A 1LLFA 3RS5A 2D3TA 1PTJC 1QGOA 4OP3A 4JP1A 1DKRA 1LKYB 4PEVA 2OSVA 4L0VC 1DXYA 1QGYA 2HMAA 4MYCA 4Y8VA 4A5SA 1TVMA 2GZ2A 3DVAA 4ENUA 2MTBA 3EVGA 4ZAXA 3I34X 4CNBA 3F46A 1P7YA 3O1JC 4DTIA 3AFOA 1EBBA 4A5OA 1U7HA 4DKJA 5PNTA 4Y6LA 4XKJA 1GGNA 4RVOA 4HL6A 3OZGA 2QX8A 3DJFA 1I2AA 1F2TB 3H5OA 1T4MA 2BC9A 3PNLA 1M8JA 2BFDA 4G3XA 2BEUA 5REQA 2I3ZA 5JFOA 2Q27A 2XKAA 2XA1A 4EO7A 4F91B 4PG8A 2UYHA 3WDKA 3AWIA 1M9NA 4A36A 2QDKA 3TIFA 1KYVA 3KFVA 5JCPA 4HHEA 3UXEA 5CVEA 4WLFA 3G2LA 4AJPA 1DOHA 4RV4A 3WXMA 5FYQA 4TT3D 3HFRA 4C88A 1V85A 5JJIA 1WXHA 5A0FA 4AIRA 5FJIA 2HA4A 2ZR0A 3L8GA 2ZETA 2Q3EA 3V7UA 4V0SA 1E0SA 3U4HA 4TYNA 1KVRA 2AFRA 2EKPA 1DK2A 4E6PA 1GPAA 1EDOA 1Z0SA 4KLZA 2GN1A 2AOXA 4HAUA 1OH6A 2G0NA 1VDZA 2MCFA 1I94B 4J0QA 1MQ8B 2HXYA 3DV0A 2PMCA 1JIUA 1EK1A 1GL3A 3R44A 4J9KA 8ICYA 3N39C 5EIHA 2OCKA 4PIPA 3PGLA 3DDZX 3NI2A 4RJKA 4XX1A 1IRXA 5G2OA 4S1OA 4JKIA 1XJ5A 5KNDD 2TSYB 4AB1A 1GPDG 3ABSB 1MJGM 5EN4A 2H5JA 5HOQA 4EUNA 1HKHA 3HEBA 5ADTB 5BYJA 3Q9SA 5F33A 3O21A 3J81j 3C1OA 4BNIA 2Z1MA 3RYCB 4PZ9A 1Q7CA 1LPBB 4O5EA 1L4EA 3G0OA 2QAGA 3Q88A 2O4UX 3NRWA 5AVKA 1FIQA 4RHUA 2OAP1 3K2BA 4BNHA 1X6IA 4HLGC 2W6IA 3UWKA 2GEJA 1B16A 3PYMA 1CT9A 1FYXA 5DGHA 3PNCA 1WZUA 1GNVA 5K1ZA 2Z5LA 3ZHQA 2WIJA 3TW4A 4I3HA 1Y9DA 3LF2A 1J24A 3L0ZA 2P3LA 4QRHA 5AI0A 4CKXA 1WXWA 5DSZA 3SU8A 3GGJA 9ATCA 2GCPA 4EFDA 2NO1A 1OV6A 4AYBF 3FETA 4P38A 1MQ9A 3NJ4A 5BPHA 5CU7A 2E4XA 1E3JA 1J0CA 4MHOA 3OE5A 1Y3HA 3QUTA 4U7HA 1ZHOA 1KI1A 1E8DA 4TMZA 4BGDA 1DMRA 3VKUA 3HP6A 1GZ4A 4QO8A 1BMTA 1QIEA 1HORA 3MAAC 3KZOA 4ESEA 3LKBA 1UPHA 1XCJA 4UB4A 3KK0A 2A1IA 2A0XA 2HFJA 3B2NA 5E9WA 3VR3A 2CRXA 2BUCA 2D2IA 3PKZA 1DC7A 4A0FA 4V3CA 3SYMA 4AX8A 3HN7A 5K8VA 3HW8A 1XMXA 4MEJA 2ESEA 4O2BB 4IQGA 2B8EA 2JL1A 5KQMA 3TADC 2Q3JA 3FLBA 3TZEA 3PQFA 3UG6A 3CN7A 1D4FA 1RJWA 4KQMA 2ZBRA 2BSQA 3CQ9A 1O03A 2I8CA 1Z36A 3R5FA 1B74A 3IDWA 3BJRA 2YY7A 2XCAA 5JASA 3JAKA 4OK6A 4CR8A 3ZXYA 4BVKA 1CUHA 4HLHC 3KETA 3KU1A 5KQSA 4JB0A 2X5XA 1OCEA 5K0TA 3M81A 4JWTA 3KAJA 3IAHA 2IXGA 2QMQA 1GA4A 1VG9B 3OUZA 2O8FB 2VZ0A 1QRRA 3M8SA 4YACA 4NDAA 1X9HA 4I2VA 2D2XA 3DEHA 3K9QO 2CDNA 2IHVA 1K5HA 4O2AF 2R6DA 3I0MA 1HXHA 3H5LA 3OWOA 3T1TA 3AYXB 1WJGA 1KP2A 2PSFA 2E5SA 1EFKA 1DBIA 2RAVA 4ED9A 4FZMA 1SC3A 5C1IA 2IGBA 1TTHA 2O7QA 4DNOA 3RRMA 1Y88A 3QKRA 2IOFA 1Z0ZA 2WWIA 5BRNA 4IZ6A 4MROA 1UZUA 3RAJA 3ND5A 3PLNA 3U4GA 3N58A 5BOVA 1NUAA 2W83A 1WSWA 1FE8A 3HB5X 1OAOC 3DYBA 1WW2A 2JJ8A 2VNSA 4ESOA 3BXEA 4O4IB 2MSDB 4UOQA 2FN7A 3DNPA 1E2QA 5J1TB 1B3RA 4C29A 4L3VA 4Q4DA 4Y9RA 1XZGA 3CSSA 1WB9A 1NK0A 1E6LA 2CZGA 4M8KA 1YCHA 4OD0A 1WNFA 2I91A 1JI3A 2Q7XA 2V65A 3ZKWB 3ND6A 1HFWA 2YWRA 3ABIA 4G97A 2PZ8A 3U3ZA 2A86A 2GI4A 1JLLA 2O8CA 1RWPA 1YVRA 3AWDA 2O50A 1KAQA 3CRNA 1MNAA 2M1ZA 4G0WA 3PVSA 5JU6A 4CR6A 1T3QA 4MYUA 1S1CA 5FPKA 3PSTA 1ZLYA 2YVQA 4XIYA 2ES4A 3O3NB 4IHQA 3IHLA 4PR0A 3RBEA 2Q21A 5I48A 3ZI0A 3NHKA 2AFIB 1ZW6A 2DFNA 2CLLB 3VGJA 4MGEA 4MFFA 3JQ9C 1XUOA 1PFYA 2WP8J 4KH0A 5KG2A 1P5FA 1WCIA 4YQFA 3WMFA 2PO5A 2GEKA 5HP4A 1RI3A 1GL9B 4HQNA 2XUHA 4AS1A 3PO4A 1HDOA 4G5QA 1MT3A 2NZWA 4WOJA 3W5JA 1UKCA 4AY5A 4GOND 4GC7A 2LKDA 3C15C 4FWBA 5KNIA 3GLGE 4OP1A 2ZRHA 1UPFA 4F3NA 2ZTVA 1EIWA 3GU3A 3SFTA 4PG7A 4LJYA 4HDOB 4U4AA 3E9MA 3INGA 1MEJA 3Q11A 5AJUA 2Q1WA 3N59A 3SEQA 1U7UA 3JASB 2ERXA 2PKCA 3PCTA 1S9HA 2B4YA 4FWIB 4DL4A 5KHAA 2ZJ5A 2FZEA 2BF4A 1Z29A 2QI9C 4D6PA 4BEWA 4BGIA 3TAHA 5CXSA 4O4JF 1TYZA 1CVLA 3PUYA 3PPXA 5L3SB 3BIJA 4ZP1A 4AJHA 2ZULA 3CUTA 4YJGA 4ALKA 3O73A 2ZJ0A 1FJHA 4BAUA 1ND5A 2VHEA 3QFHA 3FBWA 2JJMA 4XWYA 2PSSA 5KO2A 2R6GA 4UU7A 4PC1A 2Y1JA 2XGSA 2B0CA 3UUWA 1JKFA 3PC2A 4TVBA 1CZLA 3TFRA 4N01A 1CF9A 1GUYA 8ICNA 3MTQA 1O08A 1VSQA 4PG5A 1T5DX 2DCUA 3U5ZB 1LX6A 9ICPA 1H5NA 2RMKA 2ZUTA 1Q7EA 4Y98A 3BSWA 3LHSA 2J3DA 2I99A 2QN3A 2PGJA 1M34A 1BCSB 3MIZA 2O8EB 2GAOA 4NABA 1VLHA 3PE3A 2AEEA 3K3PA 2QL5A 3UXMA 3SIPA 2IYQA 4XM0A 4GLFA 2QM0A 3U61B 3HXLA 3OOYA 5IJXA 2WZDA 5BSMA 4HFMA 4XDYA 4DMLA 1RQGA 3LUHA 4KWHA 3HWRA 4KQ1A 3OMLA 1W76A 3U16A 1ESDA 3HB9A 2UDPA 1QTRA 3CCBA 1NHWA 4DCGA 1TQ6A 1SHKA 5DN9A 4OH1A 1FS4A 3EY4A 1AGXA 5KYYA 5HKOA 5HNKA 4PAWA 1ZICA 5IKEA 3CTMA 2Y1XA 2QD1A 2F00A 2NVBA 1O95C 1EVKA 2AMFA 5BVHA 2Q1SA 1UBFA 2PL1A 2QJRA 5IVHA 4ALLA 1J6UA 3H4VA 1EKXA 3N2NA 5ALFA 2VDKB 2NRXA 3OX1A 4UKDA 1NLMA 1AK9A 3ZBPA 1ORDA 1T8TA 4ZZ2A 2Y0SC 2YFHA 3PNVA 4P5DA 4C30A 1LX7A 3B78A 2VUUA 3L6RA 3FTCA 4ME6A 5LIPA 1WKVA 4POAA 5ICGA 3RSFA 5K20A 3OIVA 4L9AA 4IMPA 4J1QA 1QAQA 2YINC 4UUQA 1ZBDA 3GW8A 1BMFA 3CM0A 1FZQA 1EI9A 2BEWB 3FNGA 1I4TD 5D1NA 3ZS9A 3KAPA 5EERA 1RXSA 5DLEA 3U4CA 1VLBA 2AMLA 3KYDB 1ZUIA 1YFZA 4RZIA 2IF2A 3WLFA 3VH3A 5KUTA 4B3BA 5EP2A 1VMEA 2FW9A 3OT1B 2FUG1 1IXKA 2GK6A 4MI3A 4OXIA 4WZBB 3JWGA 3QU7A 1GFSA 5BN4B 2DR0A 1ECBA 5FFFA 4P3KA 3OZFA 2BBSA 3CX8A 3GQCA 1TDJA 2GNOA 2I4IA 4YFKA 1YBMA 3LDAA 3VI4B 4RX1A 4E2WA 1ZQGA 4CG0A 3EGDB 3KQPA 2L82A 3QE2A 5KFTA 1KAHA 3OQHA 4ZQCB 3L7AA 4NARA 4BX2A 4CCAA 2N75A 2EW8A 2D4AA 3STTA 2Z9DA 4RVUA 2IE8A 1NMEA 2E1PA 3ENVA 4Q3BA 4RW0A 4UD2A 3QF4B 2LI6A 1ECCA 3OO0A 3CP8A 1OAKA 4EYQA 3EZGA 4Y2GA 2OENG 4B40A 1XDUA 1L5OA 2CE7A 4YLEA 2Z08A 3TTUA 1ODTC 1GQOA 2DG2A 1DB3A 4FGZA 4JI5B 2HMSA 3LY8A 4JGIA 2A1JB 1W0JD 2QMZA 2ZLBA 3I0NA 3BWYA 4EL5A 2W9BA 1XV5A 1B6SA 3PQ7A 3QV1A 4F3KA 4IWXA 5GINE 2PPVA 2JGNA 1W30A 4ER5A 2QQ0A 3MD9A 2LPEA 5IFKA 1QLHA 1HFKA 4KDCA 2D54A 5CLGA 2QTGA 1J49A 2ADFA 4RTMA 4HDNB 2AZ4A 2DKZA 4IINA 3ZV3A 4UZSA 4JAVC 4KYIB 1H0HA 4TKVA 1L3SA 4GX2A 1LI4A 3SX4A 3A32A 4NLNA 4WCVA 1DKLA 1Q12A 4MFCA 3CNOA 3W9SA 1CXZA 3Q8QB 3P96A 4DRZA 5AKGA 2XMPA 3UKDA 3TZHA 1IZYA 2QIOA 2IHNA 1EFHA 3OLVA 4WE3A 1R6DA 4C2UA 4YHHB 2XT0A 2BZ0A 3H97A 3BKXA 1W48A 1R0CA 3C1UA 4ZVQA 5D5HA 2P5UA 4Z6CA 1R9JA 1XGKA 2V6JA 3DE4X 1L5QA 4F38A 4YJ2F 1C9NA 2Q3FA 1LS1A 4OJ5A 4RA6B 3RRFA 1G4AE 1QRDA 1HTBA 2PUAA 3HB7A 3W78A 1IN6A 3M3DA 2PUFA 4CTKA 3JPNA 3RM3A 1XFDA 1JR4A 9ICEA 1J90A 4UMEA 4AJ4A 3WLSA 3I62A 2ONYA 4QXPA 4ENVA 2IUSA 1PDWA 2DKFA 4GVXA 4J4BA 1U9CA 1WUYA 4RVDA 3O4FA 5I6DA 5IZCA 4DV1B 4QOSA 3OWHA 2EVWX 5MFZA 4W8GA 2BR5A 3KSRA 3M9XA 1Z4OA 4QL3A 3LKZA 4UBBA 1TO1E 2IUTA 4L6AA 4QVIA 5KFXA 1G16A 3DOHA 4MVWA 1QB7A 2WU3A 1MFZA 2B82A 1R0RE 1BX3A 1G5FA 1A88A 3SZGA 2XC9A 4MKXA 2O7VA 3C5HA 3F3SA 4D3SA 4YAFA 2HF7A 5LVAA 2X9GA 2BGUA 5IBQA 3IILA 2VCYA 4H0CA 2Y71A 2HC9A 1QX3A 1ZAYA 5EHZA 2FCAA 4GXRA 2WG0A 4F1WA 4CFZA 2NTNA 4LNAA 4N5IX 1TU4A 1VMKA 3L43A 4BWFB 5A6SA 1VLLA 4IBOA 2WV9A 3M6MD 2NACA 1EX6A 4A2QA 1LVGA 1Q7GA 2HHVA 1QVRA 1NUHA 4KYTA 4I9HA 4YIHA 2G1JA 2IYYA 4QG3A 1OHHA 5IDWA 1QMGA 1JIIA 3FE2A 1CUIA 2RHDA 2D5IA 1IK4A 2FFHA 3M6LA 4ERXA 3A7EA 1A9RA 1M66A 3OHMA 2D74A 2WJ3A 4P7KA 1JTFA 4KI0A 3UAOA 1YE3A 3AW9A 4I5FA 3JARA 3W1VA 1SKRA 3JQGB 4FCTA 1P77A 3EXG2 3QPDA 4QIWC 1T9DA 1CWUA 5CDTA 3ZBTA 5AH0A 2X0KA 3BGOS 3G49A 3ZI7A 3TUJC 2EJUA 3LT4A 2OD9A 4EW6A 5TISU 3PUVA 4TLAA 1T2EA 2CMFA 3G2MA 5BMVB 5KTMA 1WXXA 3RFFA 2FZLA 4HY3A 3G2OA 2UZ1B 4A10A 4DG9A 3KYCB 1M2VA 5T3YA 1EX7A 2R6JA 4HAXA 1FS5A 5CK4A 1QE0A 3LQ1A 2V9WA 1Z1BA 1BPDA 3GNTA 3P2IA 1WWVA 4GX0A 2I71A 1PX0A 1S10A 3AR6A 2W9MA 4PJ0U 1BOFA 3NHMA 1ZQFA 1K88A 2Z9BA 3HJHA 2R6HA 2D7JA 1XHFA 5B6JA 1OF1A 1R00A 4ZVVA 5JANA 5J0YA 2M1XA 4WBXC 2AC7A 2PFPA 1UT6A 4HJXA 4DJJA 4LC9A 3TI9A 1GEEA 3ZD6A 3C74A 3CS3A 1UOPA 5B4TA 2I9PA 4A8JC 5TSDA 3UWOA 4PYNA 2I2CA 4DCJA 3PDHA 2H52A 4NYJQ 4Z86A 4HMHC 1ISJA 2MOKA 5T8KA 1ADYA 5G41A 2E6KA 3PJDA 1CY1A 4KQKA 4HQOA 4CVNA 3QVVA 2Q9CA 3H2JA 2EL9A 3JVUA 4ZU3A 4RDXA 3R8FA 4B6EA 1X8JA 1DKMA 4B3MB 3EVCA 5HIAA 1Y8QB 3DXZA 3KKNA 2WYHA 3IH5A 1ENZA 1LJUA 3HG7A 2XVYA 2IXDA 1C80A 2W2PA 3BMNA 1S4MA 5C52B 5TPZD 1NR5A 4D7AA 4FOOA 3PGXA 2I67A 4XRRA 3NW9A 3G2IA 3OQIB 3B8HA 4FGJA 2PUJA 4G3IA 4ZOHC 1EVEA 1YSCA 1V4VA 2MR6A 4EMUA 2HSWA 4KN7A 5JZSA 2EBFX 5JXWA 1J8YF 5K3CA 4BWGA 1M2HA 2FGJA 1F1JA 4E09A 3Q8MA 4I2JA 4X3OA 9ICKA 3JTMA 4FYIA 3HXTA 4PWZA 1K7XB 3LUFA 4ZOQI 4HD8A 1RXEA 4FFLA 1H4SA 7ICOA 3V4RA 1XCBA 4DCMA 4RL6A 2FY8A 4JBGA 3ZOZA 1TC1A 1FFEA 4EGQA 2B37A 2ZFUA 2BMWA 5ILQA 3E53A 3ZK7A 5LMCA 4LJXA 1IXZA 2PMDA 4RIIA 4M0EA 1UQTA 3GLUA 1OJ7A 1CSEE 4MQLA 3WU2U 2AJDA 1KO4A 2H63A 2EXXA 4L8GA 1R4AA 2PJUA 1U0LA 1H8HA 1ZJ4A 5K0CA 1Q0LA 4L51A 2CXRA 4HOYA 2P4UA 4YI5A 5JDCA 3AI2A 1PVOA 5HF8A 1P7ZA 3EQ6A 1BJTA 5DSTA 3HUFA 1FTNA 3I76A 4QEZA 3T3MB 3NIBA 4MQ6A 4LWPA 4U3JA 1OBVA 3C6QA 2K8CB 3RVNA 2FPIA 4LHSA 1U5AA 3HUTA 4DB2A 4BLRA 2CVPA 5AHKA 1J5PA 3MJVA 3RQIA 4UULA 3SHFA 2LGJA 3DMRA 1GLGA 1QK4A 3RODA 4PSKA 1WPQA 4F3YA 1Z73A 4L0TC 4RPXA 1ZW1A 4UI6C 3MTGA 5ECDA 4L4RA 1B14A 1NW5A 2HHWA 3ISTA 4TLLB 1U65A 3VR3D 4G9GA 1ZOPA 4OHCA 2C7RA 1B0UA 2HV9A 2VHQA 2EZXA 2O23A 5GZ6A 1JP7A 3F5EA 4HWGA 4D97A 2C5SA 3L0CA 5AVRA 1OVMA 4A15A 3X1DA 3UMMA 1RLUA 5CD9A 4GM0A 5HF6A 4XSHA 1MG5A 5C35A 3MW8A 1JQEA 3UW3A 2VTBA 4JBXA 2EJCA 2HCBA 3LZCA 1MNQA 3M9NB 4I2AA 4AKHA 1COOA 4G67A 3WIEA 1NK6A 2FWNA 5HZMA 3BH6A 4MS4A 4YJ3B 2A5YB 1RXWA 2GILA 1UODA 5SYMA 3DEEA 4US1R 1PFVA 1KO1A 4IOLA 1HJPA 4NYIQ 4LJAA 4KO4S 4DEXA 3AX6A 3GDOA 4D6YA 4PGHA 1FSGA 1QDLB 3OIGA 5ICMA 2YS6A 4ALJA 4N7JA 1R4NA 4HNAA 4N76A 1LRLA 1U3DA 1YBVA 3UJ9A 4YP6A 1KIAA 5EWJB 3V2UA 3KX2A 4OUDA 4IFIA 5K3OA 5F3DA 4GRIA 5AM5A 3IESA 1DCTA 1IHUA 2AOUB 3TTVA 3FDFA 1ANKA 3A6PC 2R6ZA 3ZLBA 3R5JA 4C4SA 1BKYA 1GEGA 1SVUA 2K7FA 3ONDA 3G0IA 3O74A 1XMVA 1FDSA 2V6IA 2ZBQA 4F9TA 4PYIA 1S3FA 5LBTA 3ETDA 2GPAA 4RO0A 2WAAA 1NN1A 2X86A 3N2KA 5KX5A 4E0BA 3UTDA 3L1JA 4P53A 3I1JA 3DR5A 3NGXA 4TM8A 2VHZA 1UDAA 1UBOS 4BN4A 4ZVLA 4I4LA 4JP5A 4CCWA 3DOFA 1TRKA 2CV1A 1UBHS 5CLQA 2FPLA 4CEHB 3TEFA 3BYZA 3BHJA 1SL1A 2P9HA 2ATEA 3V8MA 4ESHA 5F3WB 1ZA2A 1N6KA 1D7OA 3WK7A 1KC1A 4M6WA 4R5HA 2BH2A 2FQYA 1OYOA 4JK3A 1L7OA 3TKYA 1RMTA 1X40A 3DLBA 3T94A 2GA8A 4QVKA 2KLBA 4Q93A 2Y0SF 5C5IA 4UI3C 4MQMA 5ENZA 3GMIA 2NUTB 1DC8A 4EF4A 2P5YA 3HCRA 3B1VA 1W8DA 1QO7A 2JEIA 4NS4A 2QY9A 2RGEA 1JROA 1SXEA 5TF0A 4OCZA 4HXFB 1MAAA 3TGPA 4Q66C 1OXXK 2XNHA 4JQZA 4H3VA 3O5AA 3FUXA 4QASA 3HB0A 4UFOA 2DECA 3M83A 5CDSA 3KHLA 4AK9A 4H4EA 1HTWA 4DF8A 4MGYR 3LFHA 4BS9A 1U8XX 1ZGBA 1JNXX 3BTSA 5EQDA 1G38A 2WLTA 1E2DA 4EQZA 3AB8A 2P6MA 5KOYA 5I3ZA 4XWKA 2ZIFA 2OZPA 1NFQA 2R00C 3Q8KA 3R3WA 1T8PA 1RYDA 3Q8LA 3ZWYA 4G25A 3WGVA 4E5YA 4B5LA 4FP9A 1GQ2A 1JEOA 1QXSA 4HFNA 4KLSA 1P75A 3HWSA 4LNUA 3RFAA 4FDTA 3U1TA 2QRQA 3BE5A 3WL5A 1V47A 4RSHA 3SV3A 2QVZX 4EDHA 1L7BA 5K6TA 4PS1A 4B9MA 5CCBA 3WKCA 1UADA 3HBMA 1IQPA 5A71A 3KQUA 1X3SA 3MGKA 3PZBA 1XDDA 1RM4A 4KGVA 3VYRB 4NLZA 5EEHA 4ATNA 5BUQA 2HTFA 4J6FA 4DL3A 1KBUA 4KXWA 2P4SA 2BF7A 1TRHA 3WX0A 3LQRA 4PPFA 3H5VA 2JLRA 2JLBA 1ZXXA 5A3RA 1OGJA 2W5UA 2B21A 2FP4A 3GG2A 3ZHBA 1XXHB 3AIMA 4MYTA 3T7AA 3V7LA 5TQ0A 3PFBA 3H8WA 2REXB 4UREA 3B3QA 3NGMA 4Z0PA 3T9FA 3W2HA 4HVCA 4M21A 3PNBA 4TT8A 2ZVJA 3R7BA 2GN9A 5CB0A 5DHPA 1D8TA 4M8NE 4DNQA 3OCXA 5IVIA 3C6BA 2GLXA 1IN5A 3QXJA 1H1LB 5GY7A 5C46F 2W43A 4KFSA 2OBXA 2K6GA 4G1BA 5TDHA 2ZTDA 5FA5A 3QOYA 2KBFA 2I6QA 3TWOA 5ADWA 4KAJA 2SCUA 4DHEA 2ACWA 1G17A 3RJMA 3V1KA 2H1IA 2YVAA 4R98A 1E1MA 1GVHA 1E6KA 7MHTA 3ZX5A 3RYHB 1RXUA 7REQA 2YY5A 3L0SA 3ASZA 1FVHA 1VB5A 2H1FA 1CB0A 4LVNA 1GNLA 3I83A 4IVPA 4JSTA 1FP4A 3TEJA 3OZEA 5JAPA 4IIGA 3HTXA 4CN8A 3K71B 1T0JB 5HCNA 3NAZA 2P9BA 5CNJA 5IJ9A 5DYGA 2FDRA 2Q5CA 4JEMA 1N2CE 2FB9A 3DHWC 4TL9A 4EB6A 3ZU6A 3PF9A 4GSYA 1NV9A 2P2GA 2XNKA 3KJEA 5IWCA 3KUDA 3B6EA 4ZV9A 2WE8A 3WYFA 4I1IA 3GUHA 3EDRA 4I2FA 3I1IA 4UB2A 3C3YA 4W5HA 4QJ3A 2IZ1A 3VOTA 4CF6A 4FGUA 1U6IA 1SVSA 1UEXC 3A9WA 4I50B 4CIWA 2OBNA 1CFZA 4HVLA 1RKXA 4AO7A 2CLEB 1YZTA 1BEUB 3GDGA 2LVBA 2JHFA 2NTEA 5BSKA 3KTAB 2CUTA 2HU8A 3ADCA 5C4MA 2J9FB 1PK9A 2ZGVA 5DFAA 4YY3B 3PEFA 3N07A 5L3ZA 4LHZA 2ZPUA 1GO2A 2VP3A 1Y42X 2WYWA 4C14A 2LCQA 2DQNB 2KEYA 5KFYA 1K63A 5B4VA 4HVAA 1YDGA 2OV3A 1GXSB 3A10A 4CIYA 1VJDA 4Q00A 4U7WA 2JIRA 1PFUA 1ADGA 3Q0EA 3SIXA 2A1AA 2ZRNA 2ERYA 4W6QA 1G63A 2ZOSA 4U5QA 3LXUX 1Y63A 1WTCA 1ZVQA 3B1YA 1XYYA 1NDQA 3WGQA 1FJXA 2XWPA 3DBIA 2OO5C 3D0OA 2V4ZA 1UKYA 2CC2A 2VAMA 1DLJA 4DMCA 3CCCA 2ZQYA 2P3QA 3NNSA 3BB1A 1PUIA 3IDOA 2QTWB 4PGFA 2AQKA 5IIKA 2YIDA 1BH6A 1KEKA 4X1YA 3SV4A 4ZXFA 1ZQ9A 2PZKA 3BGWA 4EKDA 2NTJA 3NALA 2QSUA 3QM1A 4MV7A 2ZZMA 3B7WA 7MDHA 4Q3EA 4BNVA 1SOMA 2ZJOA 2WD7B 1XTKA 2IOFK 4DC0A 3UAXA 4QIWF 3RABA 5K0LA 1P7PA 4KK3A 4RQMA 2D5BA 3TEMA 3NVMB 1Q3HA 4F9FA 4LXYA 4WLUA 1WZ2A 4RFLA 4KVGA 3WLHA 1CJCA 3V8RA 4CTOA 4X95A 1AKWA 1UKZA 1LI7A 3OESA 4YUXA 4QM7A 3OBBA 4O4HF 1DRKA 4MXDA 3LNTA 4XVHA 2B3TA 2SNIE 2XT9A 4PINA 2GPJA 2C9DA 1QU2A 1HDXA 2GCGA 3G5TA 1BZYA 3HRHA 3FTEA 3M3HA 2AGVA 3THYB 3WDSA 3SJ7A 1JFFA 5JAOA 1Z19A 2OPBA 5CGZA 2HZBA 3IJPA 5FI5A 1RI5A 4Z1MD 1XWIA 4EPVA 5LDHA 1S2MA 5KFVA 5GIOE 2ODBA 1NOIA 4XOIA 2SKEA 1KWGA 4RU9A 3C5CA 5C3UA 3HU1A 2AW3A 2X9NA 1FRZA 4BKMA 4BLOA 1HDEA 3OOSA 3KB6A 4ZYTA 4ZO8A 1UFKA 5DOZA 1CY7A 4PHDA 1Z5PA 3BE4A 2JLZA 2HLDA 4MP3A 3DMFA 5K9ZA 2BJWA 1BS1A 4Q9NA 1W581 1ZCBA 4UB1A 3PTAA 3TJRA 2I5HA 3HZZA 4P4OA 1YOVB 3GJXC 4I1OA 1PJ3A 2B4AA 4GYKA 4Y1FA 5AW6A 4ZAGA 4WCFB 3DFZA 4LGYA 1G7RA 1X1SA 4R83A 3PW7A 2PA0A 5DVZA 5ESRA 1N6NA 3RBZA 1S8AA 3CRW1 1MFPA 2HSJA 2VSXA 4EBCA 2B1GA 3ZHTA 2Z8ZA 2WUGA 3AB3A 4TQAA 4BATA 1NBIA 4Q4HB 2VAXA 5HJEA 5AKHA 2YWBA 2X3YA 2R8PA 3GCDA 1OI3A 4UE3S 4RH3A 3IXQA 2I4TA 2HVIA 1CHDA 5E8RA 1Z68A 1T0BA 3HYLA 2XADA 3L9XA 1D6MA 3RJZA 2OD7A 1RRKA 2FEWB 1SBYA 2QY6A 8OHMA 4O0IA 5J8YC 1YGPA 5KTTA 1K5OA 4CEIB 5M04A 4G86A 1F0KA 4ES6A 3G0BA 5KSPA 4UDNA 4L34C 4BFSA 2VJ5A 2XMBA 1Q0HA 2VJYA 3KT0A 2VP6A 5UKDA 3KCNA 1EMDA 2JFUA 3C5EA 5CA1F 3SHQA 4AJJA 1OZHA 1ZQMA 3GCXA 3W77A 4R0VA 2AYYA 5CFZA 2VYND 4R1TA 2KTQA 3M9LA 4YQWA 5CP8A 2H51A 3EGIA 4JLBA 3WBFA 2IHMA 3F49S 2HX1A 2I3BA 1FBNA 1WTAA 3B12A 1EK0A 1X8LA 1SHLA 3N2GB 2Q2NA 3TQ1A 3IBTA 3FN4A 3EIOA 4DUPA 1RJEA 4YC7A 4LA4A 1C7YA 4IGIA 4GC6A 1L4HA 4MR7A 3ZHSA 1K66A 5DJ5A 4CI9A 3SBOA 4KWCA 3NYIA 4B7UA 3F9CA 3WB2A 3HPOA 3MRTA 1G291 1CQXA 1F3LA 1FNMA 2W0MA 4AM8A 5JS2A 1TMKA 4KXFB 2O2DA 5CLHA 2EQ5A 4N5NA 4MKRA 5EXEA 1VSVA 2XUOA 1E1KA 2PZAA 4PC6A 3F5FA 4YI3A 4JNCA 1YGYA 4N9QA 1GAWA 1VRVA 2VF8A 2WE7A 2IBTA 3RC8A 1M1YE 1VG1A 1PUJA 3SLRA 2CFRA 3I39X 2ZIVB 2VNIA 4PLYA 4B79A 3NHBA 1MJHA 4TV8B 2G07A 3PEUA 2QNRA 4YN3A 4YG2A 1Z00B 2GTIA 1MUUA 5IKMA 2CJWB 5JTUA 3BZKA 4I5GA 5DBHX 3Q7TA 4UATA 4MWSA 4QGGA 4BVGA 5KCZA 2ACKA 1SXGA 4ZPJA 1ZN2A 3QOWA 1RPJA 1RBQA 1GZUA 4CM3A 4B9LA 3UXPA 5TPWA 3G9TA 3A4MA 4CV3A 4PZOA 4X94A 2AW5A 4D8UA 5D46A 3K5HA 1DWOA 1C4KA 5U4XA 5KT2A 3LQFA 1CUJA 3BORA 3PIDA 4YXWD 1USWA 3I61A 5T4BA 4UTZA 4HLUC 4C0ZA 2C07A 3P2EA 1VTKA 5AVWA 3C8HA 4JR2A 4LPKA 4PL1A 4JYCA 1TK9A 3K2IA 4DLSA 3SEIA 3CT4A 1J2YA 2A0WA 2QN2A 3E3OA 1EX1A 1SB8A 2C5BA 5C8ZA 4ECTA 3LHKA 5DM70 5I9NA 4YO7A 4R5MA 1RPNA 1Q21A 2VFAA 1MN8A 5AI4A 5LMZA 4DQLA 2P1ZA 3LZ6A 2VWGA 2VEDA 3U37A 1G8JA 1BHSA 3VH1A 3LQQA 3L8HA 3QPWA 1XK7A 3CUKA 3JYLA 2ON6A 1GJRA 4MI6A 4I9GA 3IJRA 3RYIA 4ZI5A 1XVUA 4C21A 2RK6A 3AKZA 7ICJA 4FYJA 4OQPA 4M38A 4O29A 3PR5B 4S0XA 2C2YA 2IU3A 2CMHA 2X9VA 1O9BA 2BGGA 1VPLA 1XAHA 2YZMA 1NK8A 2I4NA 3PR2B 4GUAA 2VUTA 1C7FA 4QQRA 2CNBA 3R4CA 4DDUA 4UDXX 2BFEA 5J2DA 1ORTA 3ZE8A 3TCKA 3BQ0A 3RRYA 1Y33E 3U44B 4GI2A 2G6TA 3RBAA 1E4OA 2GN0A 1QORA 5TJ9A 1J0XO 8ICKA 1BU5A 4HYTA 2YWJA 1DBQA 4HN9A 1M0WA 3X44A 5T67A 2YJ4A 1KQGA 1DTSA 2PM8A 1JFLA 1TLFA 4LYJA 1H8HD 1C29B 4LS3A 3GUZA 1MP0A 3IJEB 1PK7A 2WWWA 4JXJA 5CLJA 1CKEA 5KFHA 2JB9A 2JGMA 1QVAA 1ZFNA 4Y2HA 1B22A 1I3MA 5AKEA 2KIVA 3N6VA 4L78A 1HRKA 3BXHA 4TV9F 5D00A 1G66A 2CLH