2ZIXB

Crystal structure of the mus81-eme1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
322
structure length
259
Chain Sequence
b'ECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQESRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGETSRRIGPELSRRIYLQMTTLQPHLSLDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crossover junction endonuclease MUS81
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 21
structure length 259
sequence length 322
ec nomenclature ec 3.1.22.-:
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zixB03
3.40.50.11760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zixB02
3.40.1620.30 Alpha Beta 3-Layer(aba) Sandwich YefM-like fold YefM-like fold 2zixB01
2ZIUB 2ZIVB 4P0QA 2ZIUA 4P0PA 2ZIWA 2ZIXA 4P0QB 2ZIVA 4P0PB 2ZIWB 2ZIXB
chains in the Genus database with same CATH superfamily
3ASZA 5K0ZA 4RA9A 1MOZA 4H1TA 1M6VA 3EMKA 3DFUA 2PR7A 4R8UA 4S3MA 4G07A 2Z7JA 4Y0AA 3IAUA 2B2NA 2X40A 4M6WA 5HS4A 1T8TA 1DMSA 1E8NA 5BR8B 1XDZA 2PJZA 2Q07A 1Y48E 4KAXA 3RVSA 1M8GA 2Q49A 3PNMA 4GQAA 1R3DA 3GR6A 1EFCA 5L3QA 5HKBA 1LCIA 4GL2A 2VO1A 5KUTA 3F73A 1QBKC 5A6SA 3GU3A 1GDHA 5AVVA 3ZLVA 4IQ0A 2EZ4A 3OZUA 4WOPA 4E1VA 4CLOB 1HBJA 3ZVNA 3UKOA 1ZD1A 1USIA 5A0VA 4DFMA 1UBMS 4BNWA 1MRZA 4TUYB 4ENUA 3VI4B 3H4MA 1PYGA 3UXPA 1QHXA 1AJEA 1JQLB 4GPZA 1UUFA 3I2JA 1OREA 3I2GA 3R6LA 5NLLA 1B0UA 2I3AA 5C4IA 5EHGA 4YJHA 3OLCX 4JI8B 4I1YA 3NRCA 4OD0A 1V41E 5LZ2A 4RMNA 1LY1A 5CW1A 4M9LA 2QRLA 4ZI7B 1N5XA 3ILSA 4OLJA 4BP9A 4D45A 3D8RA 2XUHA 3KOXA 6AT1A 5TF0A 2XWSA 4CMIA 5DQGA 4EG8A 2HA7A 2ICAA 4PSDA 3SDBA 2BW0A 3SX2A 3MFYA 1IWOA 1YZGA 1UT6A 1H5UA 4OP1A 3O4IA 5CURA 3KHTA 3ETJA 1BEZA 5JSZA 1KF0A 2VIXA 3COSA 4KYIB 4MUHA 2BBWA 1DBWA 2NSDA 3A1SA 3CISA 4Z7NB 3P0HA 3RJ5A 3PFHA 4Y0NA 3AEKB 1WEKA 4ACOA 1KY2A 1TYBE 2LCQA 1KRPA 1IBRA 3M5WA 1WXFA 2XTNA 5K7SA 2DH6A 2VTBA 4YP1A 2ZJ7A 3GLIA 2QMQA 5JC1A 3J81k 1YCGA 1X7YA 3R7LA 2ZIUB 4HTFA 5IDQA 1F2UB 2NUPB 5KVSA 3DFKA 4I4TB 1ZVMA 2WW8A 3I8SA 2Z4TA 1CJTC 3NJ4A 8ICPA 3UKJA 3ZDZB 1A77A 2ZJYA 5A6VA 2DRIA 4M0UA 1XSPA 2VJAA 2A0YA 5H59A 5BW5A 5H16A 3ASVA 2LPEA 1CVRA 1A9RA 4GVLA 2D2VA 2IS2A 1CS0B 1OBVA 4HFNA 3IX7A 1GRNA 2WJYA 3AWDA 4UNRA 3EPJA 2HIGA 3L8MA 5CXSA 3KD2A 1R8XA 3D8BA 4BC1A 1CY2A 4FMCB 2PXIA 1DPFA 2AN5A 3A1EA 5KX5F 3G6YA 4X20B 2AXTU 3W5UA 3EIFA 4S35A 4U7TB 5HHIA 3GUYA 4IS7A 3ZE9A 5E3HA 4AF7A 4DSKA 2AJQA 2GASA 5HGJA 1PF7E 3TJZA 1WKVA 5HIKA 2D5LA 2ARKA 4X63A 1D8LA 5JUMA 4Q18A 3DZDA 3H83A 5LJLA 4Y2GA 3ZN2A 2DWPA 2P8JA 3CRMA 4TMXA 5JNTA 1N2CA 4QFDA 3FLMA 1U7TA 3PYXA 2OR3A 3MF4A 3HCWA 1BH2A 2ZBEA 4Y67A 5AW0A 2QI9C 5ALFA 1A7UA 4M0FA 4Q66C 2B8TA 2BMDA 2IU0A 5DI9A 3T79A 4M76B 4CMAA 4U2KA 4DLEA 5CX4A 1PQUA 2J5XA 3UJ6A 3FPAA 1GPYA 2IY7A 4C9BA 2UYYA 1JSRA 1IZ7A 3WKEA 3KK0A 4MWTA 4QVIA 2XUZA 3HMQA 1ZR4A 3SXUB 2Y1GA 4Y8VA 1RCTE 5JCZA 3TLZA 4HYEA 3NEYA 1L7RA 2PD4A 4W4TA 3PKZA 2WG1A 1XDSA 2X0NA 2A9PA 3OTQA 2WA2A 1K2WA 2X9GA 1FXWF 3DNFA 3SZRA 1PBNA 3KKKA 3Q98A 1U2TA 3RU7A 2YHIB 2CC2A 2NSJA 1Q2UA 3MVEA 5A7FA 1LQUA 3BRQA 2XMSA 3VZCA 1EVZA 3MTQA 3X2FA 3P27A 2WSYB 4O5EA 4FDMA 4HLGC 4ZKEA 3N7TA 3GMIA 5CFQA 4CMKA 3O47A 2DHDA 2C2ZA 2NOAA 2Q5CA 1C9DB 3HP4A 2WSLA 3ZHRA 4ZAFA 3KH2E 1PHRA 3FCOA 1ODTC 4IF4A 3A7EA 2VH2A 4XQ0A 1BPEA 2RB4A 2V0GA 2BGNA 1AUQA 2W4QA 1SN7A 1XZHA 2V7QA 2VTEA 3TKLA 5HIJA 1FW8A 3BQNB 1BCSA 4NMMA 2CYAA 2R8PA 1L3BA 5A3QA 5IN5A 2BCRA 2PUJA 1C0EA 4E0DA 3W8EA 5SV2A 5L7WA 1OXSC 5ARBA 3QU9A 3I2YX 4BNIA 4OSPA 3GEIA 3COZA 1T13A 2ZYSA 1GO3F 3AP3A 1GZ3A 1JH9A 5L7TA 3V8EA 1U0BB 4M9JA 3RTAA 4NLBA 1J23A 3ROQA 1K7FB 2KMDA 9ICIA 4UBLA 3W2FA 3A10A 3Q3EA 2WKRA 3C70A 3KZCA 4FZJA 4AO8A 5JW6A 1UAYA 1ZQHA 3OT1B 2W3SA 5EP2A 5DDIP 3SBDA 4RU1A 3PHGA 1VE3A 2NU7A 2WT4A 1ED1A 3VKHA 4BBZA 2QUIA 2G88A 3N8KA 4EG5A 3D3WA 1TJ3A 2JEGA 1U90A 2X0JA 1H65A 1Z82A 2EZ8A 4TX1A 2VHVA 1SV0A 4NM2A 1Z4QA 3V9PA 4NZNA 4F4UA 2FPRA 3TZCA 3ZDYB 1OXUA 4N0QA 3LT1A 4M1MA 4FNGA 1GGEA 4JKIA 3SQLA 4B4OA 3G9ZA 5EE1A 4W1RA 2PT6A 4WN9B 2JLAA 3R5KA 3PIDA 2PS9A 3CHYA 3UANA 2P1RA 3GZ4A 3X1JA 2DPHA 3P4XA 4YMTA 4FUQA 1PJCA 2ODNA 1A98A 1U47A 5DWQA 1EHCA 2C9DA 2C8LA 3EGCA 2FE1A 5KFPA 3BG5A 1KH3A 2QR3A 2CXOA 3DDHA 4W63A 2MSCB 1DAFA 3UKDA 2VJMA 3QWBA 2ZIAA 3BFJA 4W7SA 1E7WA 3GLSA 4C76A 1BRMA 4TTPA 4PZ0A 1BZYA 1KZ1A 3L7LA 4PBRA 3UUGA 1DRGA 4EY6A 3AR6A 4NX2A 1BEUB 3SHQA 1VI5A 4Q3CA 3UJDA 4RKEA 5DMXA 1FFSA 4QYIA 4RQ7A 2YOHA 3GFKB 3DAFA 1KO8A 4YRGA 3RTEA 2R8IA 4B1FA 2XMQA 5CGQB 1P0IA 1RPZA 2P6MA 2IUEA 3MBOA 5K0SA 2VCHA 1D03A 3DR5A 1JKJB 2WU0A 4INJA 2WFLB 3BGOS 4CR7A 4OQFA 4KO3S 4HPJB 2AC7A 4UZSA 3B3FA 2G4LA 3DMYA 3GLRA 4DPKA 4XGIA 4LKOA 3EA5A 5BWBA 3FI0A 3QE2A 2WIBA 5IDVA 3NKFA 1LW6E 3PXEA 5EUBA 5CD1A 3ECAA 2P4QA 1PK9A 5L3ZA 4INAA 3VC2A 2C28A 3ANLA 4ZK2A 2AR0A 3WGZA 4EVIA 1QMGA 1W5AA 4KLCA 2HK7A 3F6CA 5DCYA 1IN5A 5FNVF 1XX6A 1Z12A 4MW2A 4N7MA 5C2JB 2JJ1A 4Q9JA 1SL1A 2H4FA 4RD4A 5I8PA 4DZZA 3H3FA 1Z56C 3WL5A 2O0LA 3A6HA 5IVKA 1E6EA 5KFHA 2PWAA 1OILA 3TLMA 1P5ZB 1U3CA 5DB6A 5IG2A 2HYIC 3G89A 1FFBA 2FPSA 3IPRA 1MIOB 3ONEA 1KJJA 5K6AC 3P2YA 3KTFA 1FEZA 5FCDA 2Y9MB 1Z8FA 2JXJA 4MZDA 3GJ3A 3HYNA 1ISRA 2IEBA 2YJ3A 3SVLA 2LI6A 2K8CB 3FPJA 4XJTA 4CN8A 1MMFB 3DKVA 3K9GA 3GUCA 3ZZ1A 1PRYA 1L8AA 4QU9A 2PL1A 3BFVA 2CVFA 5BSRA 1DGSA 5LA6F 3GJXC 4CQNA 1EH5A 1RI2A 3SQXA 4ZYZA 5C80A 1L7NA 4HF7A 3FC4A 2D8MA 2H0QA 3KKMA 5G0WA 3BIOA 5DISB 4ARZA 3D1LA 4L9RA 4XM1A 2H8KA 2P8SA 1FVOA 3RBVA 3VBCA 1XZIA 3TZBA 1XTKA 4JSYA 1JA9A 4NOMA 3R8FA 1H0SA 1JF8A 2O2SA 2W0SA 1H9AA 1P7VA 5C8YB 1W88A 4X44A 1T5SA 3FXAA 2EKDA 3WNQA 2L82A 5D5HA 3M7DA 1CR4A 1K68A 5FUWA 1QR2A 2J9XB 5AH0A 1LU9A 4RE6A 5ARDA 1DEKA 1TA4A 5AW9A 3NQ41 2H7YA 1LKZA 3F8WA 3SV4A 1ZQGA 1M0SA 4BX9A 2VTKA 4YRKA 4YFVA 2EW1A 5IWAB 3FCUB 4NNJA 3GDWA 4RZRA 4Q4DA 4Z6DA 3U4QB 4CMBA 5FF9A 1JJBA 3OD5A 2MTBA 3SF8B 1RABA 3W6NA 3W4KA 4DQRA 3DCNA 2WHPB 3GCDA 4RVSA 1P7YA 3OQIA 3K1JA 3SEAA 3PWTA 2VZLA 2A1UA 3C4VA 4UCWA 3DTVD 5FORA 1EM6A 4YG2A 4UNSA 2GJ9A 3Q87B 3PI6A 4HLNA 2ES4A 2QD4A 4ABYA 4HYQA 3C1UA 4KZKA 4CHGA 5IF9A 1A71A 3S5UA 2Z0MA 3PFFA 1PGJA 2CLIB 2NV2B 4P58A 5HKLA 2HBKA 1DZ3A 2Z8YA 3CNEA 1L7OA 3W2GA 2QROA 1QIEA 3AI2A 2WUGA 4ARUA 2C2HA 3B1XA 4JJZA 5C52B 2I3DA 1EZ1A 1R00A 2YXDA 1C8KA 3BKWA 4WJZA 4HQ6A 3UK0A 2JFPA 1HZZA 4AG6A 3BJIC 1BDJA 4KYTA 5JZ9A 2HSJA 1ZQMA 4PSUA 4KKXB 5HKAA 3HGMA 4E15A 1EUQA 3UY4A 4H1UA 4JLDA 1X86B 1XZQA 5I6DA 2JA1A 1VLJA 2XZOA 2J9FB 1ULZA 1R0KA 1Q95A 1ZIDA 3GGJA 1GM5A 2GTIA 4KLLA 5K4AA 3LUFA 2DUWA 3GIIA 4OM8A 1DRWA 2EBFX 5DQIA 4AKEA 3VMFA 4PIMA 4E13A 4FNAA 1DU4A 3BYZA 2IXFA 1ML4A 4CFSA 3B9QA 1RIIA 3IG8A 1Z8HA 1C80A 3OAAA 2Y4OA 3J81A 2Z1DA 2CKMA 2FU5C 3GPLA 4CPDA 1E60A 4TQAA 1LPMA 5FUQA 1XMXA 1P9WA 3GRUA 1BXGB 3IKVA 3NDBB 1YRLA 1N78A 4GRDA 2H11A 2GWSA 2IVFA 2WNIA 3EVAA 5A4IS 1L2TA 4ND5A 1JSCA 2ZBRA 4NICA 3L8EA 1F17A 4RLQA 4P4OA 2HHLA 1IJKA 4WINA 4NBLA 3GLGA 2FSFA 2R96A 3DBLA 3PXUA 3G0DA 4NECA 2GDZA 4M1YA 3FAHA 1XKXA 2R8OA 2XTAA 2MU2A 3NU1A 1NRIA 2BFEB 1N8SA 2H1HA 2CMGA 4EO9A 2C2MA 9ATCA 1WHTB 1CP3A 1CRWG 2QT9A 3BFPA 2KV2A 1RYUA 4WLNA 5G40A 3UUEA 4B9UA 1UBOS 1YS4A 3T52A 2VQEB 4IIGA 3RU9A 3EF1A 1DK2A 3O94A 4J4HA 3IVMA 4XB2A 1IXSB 4FHFA 3PS9A 1CNMA 2YZKA 4JKOA 3DLTA 3RYFA 2YVLA 4ETWA 4I4CA 1Q7GA 1UJBA 3VOAA 1JEOA 1JN3A 2CHQA 4UMEA 2XQVA 5KG4A 3RAQA 1BHSA 5EMJA 1EX1A 3CW2C 2Q3JA 4DIOA 1C3VA 1XL1A 1G3RA 1FXUA 4HZUA 2LZ0A 3FW1A 3W5HA 4MS4A 5B5SA 1JHDA 3D5TA 1NBOA 3T4PA 3G17A 4ZXPA 4Y2YA 1HR0B 2ONYA 2QK4A 5COBA 5L1LA 3OETA 4RK4A 1A6SA 1DKQA 1FRVA 2AQ0A 2F7SA 5AESA 1ZIXA 1AQIA 1LLFA 2BR3A 4RNOA 3LC0A 4QYTA 1HLDA 5IT5A 5D85A 1HT0A 4ECYA 1RWMA 3OJUA 1EDBA 5TR9A 3EE6A 4YVFA 1Y1LA 1GU1A 1Q1EA 3MGIA 4K9MA 5HR6A 2M0NA 2XQIA 9ICCA 1C8BA 2AQIA 3CNNA 4GX2A 4JX8A 3CKYA 3WGOA 4RTKA 4IDAA 3CRRA 8MHTA 2IRWA 4JS0A 1Z2NX 5DZSA 3UPTA 1HK7A 4S1WA 1NJSA 4D0SA 1JG6A 4AKTA 1W96A 1K3FA 3MJ4A 4U7JA 2WWHA 8ICNA 2A33A 1R6UA 3HHPA 4OQXA 2ZQYA 4JD5A 2J30A 5CLJA 4E12A 4QC2A 3W6PA 2E1FA 3R24A 1CSEE 1KP9A 1D2EA 1N0VC 1O5OA 4UXJA 5T3UA 3QVWA 1JZTA 3VDMA 1DX6A 3OE5A 2GEJA 3ZHBA 1YQEA 3WV4A 2INGX 2QAGB 1KTQA 1FS4A 4M0PA 1NVXQ 4PC1A 3NOQA 5AW6A 3SQMA 5LYJF 1B1CA 3Q8SB 1O6FA 5AT1A 5EHQA 2A9RA 5BXYA 1QV9A 2OO5A 3ROEA 4G5SA 1P7ZA 5MDHA 3RUPA 4L3VA 1FIQA 1A97A 2QSZA 2UYOA 2HMYB 4JR1A 5CG2A 4YCCA 3O4GA 4EUHA 2TMKA 9ICLA 5IKXA 4UM8B 3L7OA 3LPLA 1ODJA 1QVVA 3HBNA 2AB0A 2YRXA 4E46A 1I94B 1PZXA 2D1RA 3E9DA 4Y2PA 2Q1UA 2AG0A 4QL3A 1ICEA 3GJRA 4EBEA 1O0SA 4RIGA 2V74B 1FUUA 4X61A 1VRWA 3C3DA 1N4AA 4AL4A 4WCFA 1NZDA 2XBMA 3G2QA 1RMTA 3ENZA 2B94A 2R48A 6YASA 3FDJA 5LMUB 3C14C 3B6MA 3MGGA 1CIPA 3RBAA 3PTLA 1YGPA 3KQMA 2IHVA 2PUFA 3MJCA 5KSYA 4GI7A 4OJ6A 1DIHA 5A04A 4CQMD 2X9NA 1QO0A 4P93A 2WV7A 5J0QA 2ZSKA 1EVQA 1S7GA 4NONA 1PFUA 4HI0E 4DAOA 4H17A 1PV4A 4ECRA 4IX9A 4KTTE 2PI5A 3VUFA 3V3TA 4WV3A 1NMXA 1LJUA 3MWFA 1XZGA 3IUPA 3OBIA 1E2IA 2A35A 3RROA 3GL9A 4LRUA 2APJA 3I1FA 4LG1A 1DFGA 1EEXB 2WF6A 1Z4KA 4H2DA 5B1SA 2GAIA 2HF8A 4UVGA 6NULA 5JOQA 4CN9A 1DWPA 2WF8A 3IAS6 1JTVA 1SULA 1SZCA 4BRUA 1TMOA 3EWIA 3DS8A 5DHUA 1D4OA 2QV7A 1DE0A 3OHSX 1YI8A 4HWPA 4U7GA 1CCWA 2VNAA 2PUBA 2GYYA 5CT9A 4DLRA 2VJ4A 3BICA 3N5CA 3I6ZA 3MS4A 4CIVA 3JQ6A 3Q6NA 3X1ZA 4EQZA 2K8BB 4X6UA 3JD1A 1PFWA 3BIFA 4MK4A 2B8NA 2W2QA 3M1IA 1AQUA 3FX2A 4MGEA 1C4OA 1YQUA 3ACDA 5C5DA 2DWOA 5FO0A 2XQGA 4FOSA 4RQTA 4F0JA 1QPGA 3C3PA 3H8SA 4B6JA 3RIYA 3WB1A 5IVIA 3KHLA 4M0KA 2HSGA 4R1SA 2FN7A 3INYA 1K6MA 4ROTA 1F1JA 4FYMA 3S2FA 2ATEA 2I9KA 2QWXA 5LOVA 3MD0A 2JBHA 1AHPA 4R3NA 5K2MA 3W78A 2W6ZA 4BX8A 5A02A 2YMPA 3ZVKA 4L74A 4E88A 4DL2A 2E89A 2XQJA 1P29A 3UMRA 5FBWB 4UTNA 3F49S 1XLTA 5FUYA 5DTIA 4Q6WA 4UU7A 3WK7A 2OZEA 2PMBA 3TIIA 2WG0A 5FI3A 1ZPDA 3DBRA 3VVCA 1KE1A 4JR2A 1KMHB 3JRNA 4LOIA 2BE9A 2HF2A 5KWJA 4M1SA 2I65A 2FPGB 5EJ2A 3OO0A 1D9XA 3ZHOA 2XMDA 3ZNQA 2G67A 4DA7A 5BSKA 5IFLA 2D7CA 3M6VA 1OLUB 1MJHA 2ZKIA 4O63O 4E5VA 4JIMA 2GM3A 3ZDQA 3FI9A 1NBAA 1A7KA 3BHMA 1M1XB 3O8LA 3HCEA 1W0KD 2GEFA 1TCVA 2YNMA 1ZQIA 4K9QA 3CUVA 1XJQA 1AS0A 4CQMA 1KDRA 4LC9A 6LDHA 2V0NA 3LPMA 2ZAGA 1K7EB 3G9TA 3O2NA 1CEZA 1BOFA 4LBVA 2IYAA 1G5HA 3FGOA 2ETXA 4WY8A 2PZMA 3PYMA 1JRPA 2KHVA 4JLOA 1RPLA 3UB2A 1UDCA 4N48A 4QOSA 4BEVA 4C0WA 5FOVA 4PO8A 5K3FA 1S9FA 2BZSA 3T5DA 4RPHA 4Q3BA 1J4AA 2X4GA 2AE2A 1FU7A 3M1AA 2CFOA 1NK5A 1C7QA 1YBHA 5KKNB 3BWBA 5CR0A 4FKZA 1N3LA 4ZRMA 1QVWA 3WNBA 2DSTA 3ZJTA 1XWWA 2II6A 1KNQA 2C07A 1XZAA 3GFQA 5KHOC 1KPGA 3HJEA 4R1LA 1GILA 2IP4A 3M9OB 1Q91A 5DGBA 3I5MA 3BZKA 4MAMA 5E6SA 3QKIA 3WU2U 1MENA 1ZG3A 4L27A 3KQHA 7ICMA 4MVJD 3R76A 1ORWA 2Q4DA 4OKIA 3MOSA 4Q4JA 4IIJF 1NR5A 1NT2A 4Z4GA 1X1RA 2PRIA 2R6JA 1J90A 1FDTA 3UC9A 1GA6A 1ZCZA 4B2PA 2DTEA 2C7PA 3RVQA 1OFGA 3CX4A 5FPSA 3FUUA 3UK1A 1T2UA 3MWYW 3NBXX 1F1BA 3OOJA 3AM3A 1KFJB 1ZQNA 1EWKA 1Y4DE 4OHYA 1QK3A 1E89A 5KWVA 3WJ2A 1QVAA 1XRPA 3A6KA 2O3JA 3VO8A 5E4YA 1FP6A 5CVJA 4J9OA 2DU8A 2C7BA 3B5IA 5TEWA 1JH8A 4MAFA 4O4LB 4JJ4A 3W9YA 2VEOA 5HSGA 1PK7A 1NVDA 1V16A 1DEAA 3RVMA 3WICA 1ITZA 3AW9A 1LLUA 2HD4A 5ENZA 1M67A 1S4MA 1COKA 1QIGA 3HG7A 3NYWA 1SCNE 4KYUA 1ZJNA 4IYJA 1OI7A 1QGDA 2AOWA 1AGYA 3C0KA 2DTXA 2XVZA 2CFTA 3A3OA 5JNUA 3OPVA 5JJKA 5KNCA 4KH0A 1OB5A 1YJCA 1W0KA 4ZALA 3RC3A 2R5WA 3AOEC 2EANA 1YNOA 4AY6A 4H27A 2OP1A 2XNDD 2P4HX 3BM5A 2W2KB 4NBRA 2XIQA 3TL3A 2DF4B 2KFZA 4QSMA 3K6SA 1OFUA 4C3UA 3WL3A 3VZBA 4R81A 2LVBA 4UTPA 3U1VA 1KA9H 3NBYC 2OFPA 1RPAA 1EFPA 2D1TA 4ENTA 3OCYA 3KKPA 4DDTA 3RIHA 3M3DA 3PPXA 3O8OA 5JJCA 5D46A 2GXUA 4OREX 4DVJA 3ZKWA 1M0EA 2OO7A 4UJ5A 4QU0A 4IUBS 4CF3A 3WZLA 5T14A 1E3QA 5CX1A 1K4YA 1O3YA 2ZS8A 3OU6A 5JE8A 2Q0QA 3TAQA 2A0XA 5CH8A 3STYA 1NXQA 4ND2A 2WB1C 1UC4B 1IK4A 4B3TB 1XTSA 4HS9A 3UJ8A 3AM5A 2ZIXA 2CDRA 2QN2A 1NP7A 1LI4A 2ZR9A 4ON9A 5HK8A 2AF4C 3LPAA 3EUAA 3PW2A 2BF7A 3HVHA 1QHNA 3OM8A 1GZHB 8ICCA 4M7PA 1G3UA 2ZB8A 4EFNA 4MFCA 3IJRA 5LZ5A 4BMVA 1Z62A 1Z3CA 3EXEA 3GPCA 7ICFA 5KOIA 4ENQA 1Y7IA 4HEJA 3AESA 4WXHA 4FGJA 1GQQA 1OTHA 1NTRA 4F3OA 2HUPA 3IQHX 1FP1D 1YQXA 3QYAA 2HDHA 2FZVA 2VDQB 1YS2X 3C1OA 4BLQA 4H3VA 3JQ7B 2HJGA 4KBFA 3TLCA 3V1UA 5ALUA 5K6TA 5FKJA 1P4AA 1F38A 4IXMA 3TI7A 2ALJA 3PVZA 1DIAA 4Y9DA 1MC4A 5KFKA 4AG5A 1LVHA 2DF8A 2FA9A 3W1VA 4DS4A 1OI2A 1RPJA 3BXXA 2C4UA 4K8RB 4OHPA 4U7FA 4YO7A 4M36A 4Z99A 4ZVSA 2CJYA 1YDFA 1ZQLA 5EXPA 1ZRHA 3W9SA 1T2VA 3DONA 2XR1A 4WQMA 1MU0A 1ZGGA 1ODLA 1QUFA 2LBPA 1SZDA 1UOQA 2D0DA 3ZK8A 4KQ2A 3EQ2A 3DT8A 3GCXA 2Q3DA 2JFWA 4Z53A 1DQRA 1ZOLA 1U9IC 2B99A 3QA3E 1UQUA 1Q3VA 5AM0A 2QUBA 3KXDA 4JX9A 3TBFA 3FNHA 2JZBA 2RI1A 5KFAA 5HQJA 3VZSA 3RH6A 1I2DA 4ZOQI 2BJWA 2IPLA 5DWDA 3QPAA 4H0CA 5TZVA 2EAOA 1WCIB 1EP2B 4TQRA 3ZCUA 3U7JA 4ZAGA 1KORA 1C9JA 4YJFA 4C6TA 1A5TA 2ROQA 2BPGA 1FUYB 2Z8XA 2J0UA 5P8WA 1N6NA 1IG3A 1W2GA 2GJ8A 2Z09A 3DOCA 1FDVA 3EA4A 5J0XA 4MGHA 1G20A 1QK5A 3PC6A 2ZRAA 4G9EA 4D5GA 5IAEA 1RQNA 4N6OA 4UNQA 1WOYA 4B82A 1U3FA 4AKIA 1YGYA 4XIYA 2W11A 4CMHA 4PONA 4BX3A 3G0OA 4H0NA 1NVVR 1J24A 3VO1A 1MPTA 3VJMA 5JO9A 3NT2A 3EUEA 3MK31 2HH9A 4E2WA 4DQIA 3H7AA 4C7MA 3SS7X 2NZUG 1SUSA 1GJRA 2XUOA 3N5KA 1CUEA 4CF6A 1MAHA 5EE9A 2QBYA 3H3JA 1LVGA 5HIIA 1BA2A 2BRUA 5COQA 5DM2A 2QTCA 3MAJA 1G42A 2BGJA 2QP3A 3O21A 4MHVA 3DV0A 3JVDA 3RKUA 3STHA 2P65A 4LC0A 5HJEA 3LE8A 2C9BA 5DHTA 3TEMA 3E0FA 1RQXA 3E5NA 4K9KA 4MW0A 3TLBA 3SYLA 1RM3A 3LWZA 4O3QA 4MKIA 1EM8B 1YB1A 1AMOA 4AT1A 4PRZA 4M4SA 3ECCA 3RFFA 1P45A 2P79A 4DA9A 1GT6A 4HNGA 3BF7A 4E2FA 4IGEA 3IJ5A 3F5MA 1JNYA 4EY4A 2F76X 2VNJA 2F3TA 3CMMA 2HWXA 2EXXA 4OYRA 1W59A 2QKYA 4RHXA 4UPDA 4M7OA 5IDWA 5TQVA 2JF0A 2XXAA 4ND3A 5B53A 3ZEIA 4CM9A 5CBPB 3FVRA 5JXJA 3TG8A 4F8JA 4D3YA 4IJMA 3PR5B 2ZZMA 2F77X 1DPGA 5B7PA 4NEQA 3TVYA 2WWTA 4WESA 3E6AA 3IB6A 4P4UA 4DSUA 1ESDA 2B2CA 5K8CA 1T3NA 3K09C 1PGPA 5HMLA 1IHPA 4RPIA 3D4BA 3U44B 1N9GB 4ED9A 7MHTA 2SKEA 3F74A 5EI5A 5EEHA 2DT8A 1GR0A 3CXRA 3N53A 1Z4IA 3DHEA 3VQTA 2I2DA 4DIBA 3ZPXA 1O96A 5HR7A 3CKKA 1QWSA 4JEIA 4L5JA 4YTEA 5BUZA 4PC2A 2J0VA 4DL9A 5D6OA 1GUFA 3ZE1B 2XI4A 3AZQA 1GLNA 3TZEA 5KDDA 3KKAC 3F5AA 3KPUA 4KX5A 2OZLB 4YC7A 3GT4A 3IURA 4NZZA 2FAXA 2XMCA 1HUZA 4IMPA 1KYVA 1K0UA 3TE7A 1KTVA 1JSXA 2VOJA 3ZQKA 2ZQZA 3ISDA 1M6NA 3EOZA 3OIFA 1PWHA 3WAGA 3HJTA 4M53A 3MLBA 4PG6A 3UJ7A 3RG2A 4JCCA 5EWGA 2W71A 1O5TA 3TFSA 4UTOA 2Q9UA 1A9TA 3UH0A 4MV4A 1JR6A 3NBMA 5IZ4A 2PSFA 3FWHA 2I1WA 1QF9A 2ZUWA 1PGQA 5J0WA 1PIWA 3G0IA 1BEEA 4ZZ2A 1X1DA 1RHMA 3HKCB 1PTJA 1BW9B 2LIPA 1QV7A 4EO7A 5F23A 3R6GA 2EG5A 1K5GA 3OBBA 3VV3A 4D3XA 1GG5A 1CUKA 2R1ZA 3WDMA 2R18A 3DL7A 2NSLA 3ENWA 4R1TA 2IX3A 1VE6A 4REQB 2ANBA 3TLGA 4TS1A 4EW2A 1C7YA 2Q9BA 3T9EA 3AERA 3FOEC 1ZU5A 3IOCA 5MN4A 2ODBA 3ROTA 1TVKA 4JJAA 2WY2D 1UEIA 5CA1B 4LRTB 1JHMA 1KJ9A 3GZNB 3T3GA 4KXVA 3LDGA 4JUCA 1NK4A 4JN6B 3ZCRA 1LB2B 2FWJA 1VZ2A 2H7VA 1SHUX 3F7MA 4GE0A 3WBFA 2R2AA 5KDOA 4FE3A 1HMPA 2JH8A 3IOEA 2DZDA 3GNQA 2A0WA 7ICNA 1RCFA 2ONKA 2ILTA 2F44A 3JV7A 4BVAA 5LP6A 5CAEB 1A8HA 3AF2A 3RJJA 5BYJA 5A3VA 2ZRCA 4BKUA 2C84A 5EIBD 2JK1A 3J80A 1PUZA 5KU1A 5CCEA 1P7WA 2VT3A 3EYAA 2EQ5A 3PPIA 1H1LA 4OEHA 2I5PO 1Y80A 3WAJA 1V5FA 3NWBA 2H52A 1I1OA 3JRXA 1SVWA 4DSAA 3DD1A 1NVGA 3FKSD 3HFGA 4KHPB 5DLGA 3UMVA 2MT9A 4RKWA 1P3JA 3HNPA 4PGMA 3SWWA 2UZ4A 2AVDA 2OMKA 1P1CA 4YDSA 1QP0A 1KO5A 3PEFA 3K4QA 3WA7A 5D49A 1PAUA 2IE8A 1Z00A 1MF7A 5H9VA 1ENOA 2EOAA 4N3CA 3BXHA 1DAHA 4ZN6A 2WTUA 2P9EA 2VXOA 5AW4A 4MPRA 5D01A 4KHZA 3IKJA 4LJRA 7ICQA 2JGDB 3NT5A 1ORTA 1P0FA 3EZGA 4S05A 5FOSA 4WFQA 4BLVA 5FUBA 2YWHA 1ZINA 2QX7A 2E4XA 2O2YA 3ZWVA 4MYRA 3LY9A 3M6LA 1XQWA 5JH7A 3WB9A 3RC1A 3PUWA 1CIVA 3ER8A 3X1XA 1OXXK 5HM8A 2NO1A 5BVHA 4L34C 7ABPA 3T7KA 3UK7A 1XNSA 3UGJA 4AUEA 1N9ZA 1PLKA 4I50F 4FLEA 2VZEA 4U0KA 1TT5A 1PU2A 4QBGB 1W75A 1HH4A 1XUOA 3GGGA 2WJAA 4QDXA 1G16A 1VMDA 1L5WA 1TM5E 3FB4A 4ME6A 3HWX1 3ZU4A 5BPCA 2W00A 1TQ8A 4V0MA 3QLVC 3WRYC 4EMUA 2V7QD 4C7XA 3BTUA 3W0LB 2EX4A 4COKA 1TZBA 3IRVA 1DARA 3SE7A 3M34A 4IQFA 4ER5A 3LYSA 3BRCA 1X39A 3R77A 3QKSB 1Z63A 5T7BA 1QYWA 2OXRA 1UZNA 3LC7O 1ZWKA 5BSMA 1W36D 4R2JA 4Z9XA 3W7BA 3MTJA 1H2AS 1Y8AA 4MA5A 3T41A 4FGKA 5EAIA 3VPSA 1PD0A 4Y6GB 3RSZA 1BMFA 4UUMA 4N3GA 2RSLA 1G6OA 4I46A 5BNWA 2GERA 3STTA 4M1EA 2BFMA 4X54A 3B6IA 4YLGA 5AHWA 3SC2A 4ARIA 1B74A 3U4DA 3D2BA 3AJ9A 1NVVQ 4RXTA 2AHOB 4L2KC 4IG4A 1ZFNA 1TZ2A 2I6UA 5JAIA 2PEZA 3F5FA 4IHAA 1RWQA 4AJ2A 4EUNA 1J5EB 1DBPA 1K8XB 2FOIA 3LTNC 1O97D 1DFHA 3CF4A 3HY6A 1IG0A 1CUIA 3FKSA 5C5IA 1X1TA 1LXCA 2QVCA 3F6SA 5C1PA 3EEFA 4Z9YA 3FRHA 1P19A 1S97A 3NHJA 2WZBA 4IDOA 4IQUA 5T64A 1YZLA 4ED7A 2ZZKA 5BW4A 1EXDA 3VHXB 1T43A 2Q7DA 3JQBA 2K4IA 1FUIA 2XVMA 1O87A 2VHEA 3MFIA 4G0XA 1J1IA 3DWFA 4CZ2A 4J4TA 1A50B 1BRTA 2KE5A 5FT9A 4WNAB 4D25A 5K9ZA 2QAGC 4Q3EA 1J2YA 1QFZA 1KVSA 3DMFA 1OBHA 1QX3A 2JCXA 4NCKA 3TRHA 5DN6D 1AUVA 3V2GA 2PVSA 4O3MA 2CL5A 2BGUA 3K0AA 2ZIFA 3IILA 1S4QA 4XD2A 3JARA 4KPUB 2QB5A 3ZQJA 4E5SA 1IM8A 3A1UA 2XBLA 4FGSA 1Q16A 4WTOA 4F6RB 1Z15A 2ORVA 3R2JA 1PVVA 3WWZA 1JV2B 1H2ZA 4F2RA 2GBPA 4RQNA 4EJSA 1CETA 4BUGA 4URXR 2B1RA 2Z58A 4GEGA 2FETA 4GE3A 1Q7RA 3HB4X 4XQ8A 4F84A 2FLVA 4YCMA 2DP4E 1KGDA 1PTKA 1JHXA 3GT7A 4DLWA 2QLBA 3UUWA 1VE7A 1DLJA 1OC4A 1HYEA 1A96A 1KWKA 4FTWA 5HJ2A 4QHYA 4NJOA 4OAQA 3EGWA 1ZU4A 4ZCIA 5E1BA 4GI1A 3PQ5A 3PEEA 5HF8A 3KOZA 1JWBB 4FQ7A 4BYGA 1NJ1A 2AOUB 4K40A 1Y9ZA 4CTJA 3Q7IA 4J7UA 2FNAA 3SSOA 3WOVA 2JJ1D 3JQ9A 2I34A 3LD9A 1N5IA 3UW1A 2NNLD 2ZSDA 4IEFB 4B34A 2CLDX 2CBZA 2O59A 5K5EA 2BV3A 3HRIA 3WQSB 1JDSA 1EUCB 4E2ZA 3HBMA 3MR2A 3KDAA 1UBGA 2CYCA 1ISSA 4LFAB 1LNSA 2BT4A 5FB3A 3B8EA 3GEGA 3O0DA 4N3AA 1FNNA 3COWA 1X77A 3GP5A 3FSRA 3ZR4B 4UQLA 1NK9A 4R05A 2X7HA 4IHJB 1JBQA 1RI4A 4RW0A 2ZSFA 4RY0A 1C2TA 4YQEA 2MOKA 3EC1A 1U9LA 3GFVA 4CBVA 4H3KB 3VPAA 4EOGA 4JR0A 3BUSA 1RLMA 1XCMA 1MABA 1NNUA 5EZQA 5CVVA 1OFHA 2EZZA 2H0AA 1XEWY 3PV8A 3ZHZA 2B7BA 2GEDA 1NI5A 4G9BA 3ILHA 8GPBA 2RGEA 1V7ZA 3KHSA 3H0MB 4GZ6A 5K3OA 4FS8A 2D62A 3JQEA 1OCEA 4IUCS 2HEGA 4TWJA 1D0IA 4QZHA 2P5UA 3L06A 3II6X 1XVTA 1MN8A 2FDCA 5CDHA 4DNXA 3ES9A 3AHIA 4NYJR 1HI9A 1DTEA 5KTQA 3T1NA 5DN6A 1M10A 4UU1A 3WYAA 1PLLA 2JGKA 1LX6A 2JJMA 3OZVA 2E4ZA 4QT0A 4J2OA 2P1DA 1YU9A 1JILA 1LGYA 1HM5A 4I8DA 3LGSA 3ELBA 5LQAA 4JBWA 2WHYA 4W9MC 4OU4A 4ZT4A 3L84A 2GH1A 4LKRA 3UHAA 4NK5A 2KZ3A 3RFAA 4E3ZA 4QBFA 1NN0A 4P3KA 2VDKB 1PWYE 5AWFC 3HXPA 4YJ2A 2P6PA 3WHKA 1A2QA 2IYXA 2FJUA 4G3IA 4ZAZA 4EW3A 3GLHB 1IL0A 3O82A 3V7YA 1GNRA 2CZCA 3QPWA 1T9BA 1PZGA 1ZK2A 5DKWA 4BQPA 2ZIEA 2ALZA 3KLNA 4UTXA 1VG1A 1DL5A 2CCJA 1V7CA 2VP3A 3WQRA 3V72A 1V48A 3K1AB 3OWHA 4XEHA 1SXEA 3LT0A 1W94A 5MGBA 3EBLA 1SPXA 1K9VF 1VGVA 4WIAA 2O8CB 3QMPA 2C2YA 2ZYUX 4A2QA 2RKBA 4ITUA 3KFUF 3R3SA 1AUOA 3LS2A 3KJGA 2LKYA 1KYWA 3RNOA 1ECLA 4YJ3F 1XA0A 4UNPA 4IJ6A 1I33A 5BNFA 4A8JA 5IH7A 3LLCA 5JMOA 4EG6A 1J9ZA 1R50A 1W19A 4QA9A 1TU0A 5CDYA 1Q1GA 3TB4A 3IVCA 3FTDA 2IKSA 3NWEA 5BP7A 4YMLA 5BNIA 2GJAA 3PGJA 1AU9A 3RDPA 2C98A 2X7JA 1IM2A 5L40A 3OAAD 3KVVA 1NOMA 2QG6A 3WLEA 4OFZA 1ZK3A 4AMBA 3FHTA 4DARA 4URZR 5IASA 2QTWB 1ZCBA 4OYYA 1SXJC 4OXQA 2YRFA 4HEHA 4M9SA 5BSGA 2YJZA 3VZDA 3E1KA 3TMYA 1DO8A 1VIAA 4YDRA 1W46A 2J3IA 3NS7A 1M34A 4KGZA 5JFGA 4EJMA 2PLFA 4TM8A 5BOSA 1CUXA 1HEIA 2CB9A 3THSA 4UBNA 4G01B 4BLTA 1RVV1 1GG2A 2BKVA 2OCKA 3ZX4A 4HLDA 1TFRA 2X4IA 1JFSA 5JEDA 2R65A 3IO5A 1W30A 3FY4A 2B0CA 3OLZA 1SKMA 2X8JB 1S2NA 4TWBA 4HLQB 4KNWA 2O19A 5EJAA 2Q1TA 4UOEA 3A1FA 3K9LA 3LXMA 2JLRA 2CY0A 4R84A 3DH0A 5HHHA 5I45A 3TOCA 4YUVA 1KJIA 5KX5B 4O4HA 3DMGA 1HQKA 1DT3A 4YT2A 2DHCA 2Q5HA 5B12A 3OJCA 1XYGA 3K8ZA 2IYPA 1JDJA 3N4MB 2JJQA 3B36A 3BXEA 3L4SO 4TTJA 3VTKA 4GAEA 3ST7A 1RAEA 1S8AA 2OBLA 3WNZA 2XCQA 4PHFA 2NU6A 1ZQEA 3BHIA 2FJ6A 1JL3A 1LWNA 4D4LA 2IYWA 3T7IA 4PLWA 3UWSA 5JCOA 3EFOA 5A5FA 4J7AA 4MVCA 3D6VA 3FF4A 3B3AA 5HA5A 1K63A 1L8XA 4G5GA 1ECPA 5KTYA 1XQ9A 2A1AA 3EQ9A 3NNNA 2R9VA 2XUKA 4PWZA 1M1NA 3B89A 1OGJA 4C21A 2JEYA 1YQTA 1JAIA 5FOTA 4HX2A 3HM9A 5E7QA 4XH9B 1KU6A 3STVA 3NTLA 3LY7A 1UP7A 4LK2A 1TK0A 5KC8A 1S2OA 3K4PA 5C4MA 3QXSA 2DKFA 3QNWA 3LLVA 4IEEA 1MT0A 4XPIA 2A6QA 5CB8A 4C4AA 5I3CA 1U6JA 1JLLB 2Y6UA 5B3AA 5GONF 4UHHA 3Q8XB 3HU1A 5C8DA 3K35A 2CNOA 3MMZA 4QODA 4G37A 1JZSA 1H6DA 5HOEA 3QWAA 4UEWA 1DG1G 5G1OA 3M9MB 2HC9A 3C16C 2VI5A 3ZW9A 3WGTA 3UOAB 1SUEA 1AMUA 7ICJA 1E6UA 4TXJA 1R9GA 1YB6A 3NKVA 4LE0A 4JI1B 2ZTEA 3A26A 1KI8A 2OCAA 1Q0UA 4AYBC 4YRMA 3OZCA 2XD4A 4BZZA 4YYZA 3EIXA 5A3JA 4EQ6A 1YDMA 4O3SA 1GRQA 2FN8A 4RVCA 4M1QA 5AMXA 2OAQ1 1YZ7A 3I9V6 1I4OA 1SKAA 3IE2A 2QYTA 5T67A 1SQFA 5ALLA 4YK7A 3HXKA 1IN1A 2ERCA 4Q24A 3B1FA 2G9NA 1PNQA 5CUQA 3BAZA 3WGUA 3H8JA 4H7IA 3H0KA 2VA3A 2FPLA 1QIMA 4IJKA 1VL6A 3KSZO 3A25A 1ADYA 3E15A 1F5NA 4AUKA 4ZK6A 3IMFA 3B3JA 1QX4A 1NF3A 2REBA 4HLMC 5EFZA 1OU0A 1V38A 3TTVA 2M6LA 4WERA 1YJAA 4G1EB 2BFBA 4JLUA 2IHMA 4KLSA 5CITA 1T34A 2C0CA 3HO6A 1QO0D 3DNPA 2HU7A 2JRLA 5K01A 5H1YA 3QXJA 1D3AA 2J7KA 5DN9A 1NMYA 1JEQB 2Z2XA 3RSFA 2PLRA 2HKIA 3A4YA 4D0NA 1JKXA 3SR4A 2FZGA 1E1MA 1DX4A 3U1BA 1QCZA 3AN1A 1W34A 1JR3E 4FYPA 3G68A 1JFFB 1SEPA 2QUAA 2W6QA 3I9OA 1JQKA 4D9KA 4ZOAA 1JEEA 5E1DA 1V11A 4RORA 2OAGA 5M5BA 4YRFA 2WINI 4ZU1X 1UMDA 3OMWA 2OFWA 2H4YA 2ZI6A 1NF8A 1C0LA 3U4CA 3K1TA 1C50A 4WK4B 4OK5A 3GLTA 4NYJQ 1ODFA 3G0CA 4EGCB 4DL5A 5F77A 4I5FA 2PH3A 1A3CA 1UMBA 3UHOA 3E7DA 3V8VA 2J08A 4K2AA 4BNVA 4Y1RB 3QOYA 4B4DA 3F1LA 4ED8A 5IJZA 3EWAA 2HRDA 4K8OA 2FUCA 4RZ2A 5BT8A 1YVEI 5DHFA 1ETUA 3ZWAA 1Z0FA 1VRVA 1N9KA 3KT8A 3K33B 1DKNA 2V9CA 1NRWA 4B3MB 1M6HA 4EKYA 2D3TA 2B1JA 4E6PA 3FMIA 2Y6VA 1YL5A 4RA6A 2R0QC 4RKYA 5HFJA 4DFKA 4MWDA 3BTSA 4JC8A 4CM8A 2DLNA 4ZV7A 3ZIDA 4P3XA 3OHAA 1GQFA 2XSZA 3AR9A 4ZQBA 1ZQCA 5BW6B 2C5BA 1RMQA 4LXHA 1PS9A 1KVTA 1SCDA 5G0UA 4NG4A 4EGJA 2JGFA 1GA4A 1MW9X 3CZ5A 3REOA 3DDSA 4AQ7A 3ABRB 1QQ6A 4CL2A 1OXVA 1OUQA 3G2OA 3KCQA 2PKEA 1V96A 2ZXIA 1GA1A 1CY7A 1ESNA 2NM0A 1QHGA 4HNTA 3UXEA 4BO0A 3HKEB 1KEUA 4R2WA 1BNPA 4YAEA 3OESA 3EPKA 3WLMA 4J9MA 4QU5A 5F5XA 3RVKA 1ZGAA 1FP4B 3WKAA 1XA3A 5CP2A 1G8AA 1ULAA 1TKRA 1NN5A 1SQ0A 2OXCA 5CDTA 1MR3F 2UVUA 3CM0A 5FNVB 2IBTA 5F7ZA 4ZVLA 3NUZA 5IC6A 3ICWA 4A92A 3EBPA 2X1MA 4Q9IA 4OHVA 1RQGA 1A7JA 2ZE6A 3EDCA 4YXJA 2BEWA 3P52A 2HK6A 1QZ3A 3RFTA 2YNMD 5F2KA 4G0OA 4NBWA 3QFTA 3SIXA 4OJOA 4R16A 3GZJA 3ED1A 2ZUCA 4P3NA 5CJ2A 1NG1A 1CERA 3I73A 4C4OA 2GFHA 2MSEB 3GUZA 2PD6A 5KOHA 3I6MA 2YMLA 4F60A 2RJOA 5ALYA 2B8EA 3H9UA 1WBBA 5LB4A 3BHJA 3QTLA 4HDCA 4LA4A 3PMNA 5TX7A 1I1NA 3ZDFA 5IC4A 4KVZA 4EYIB 1CNFA 5LA6B 3HN7A 4GPAA 2WF5A 4XR4A 4BPRA 1UL1X 2OAEA 5JZVA 2WUDA 1LPOA 2CEKA 2HBRA 1M2OB 3WJAA 3ENNA 1NAIA 4FXOA 3FYCA 1JQBA 5DOVA 4NAHA 5FPQA 4OIMA 4KIJA 4A73A 5F12A 1EXWA 4MQFA 4YR0A 4O2LA 5CIWA 3PC2A 1RI3A 1AK1A 2CMFA 4UASA 3RC7A 1G3QA 1DOAA 3NT4A 3EVGA 4TS4A 13PKA 1Y1TA 2GZ3A 2ODQA 1KMMA 3C2MA 3FYHA 2DJ5A 1M72A 5EHIA 1UXIA 3VVMA 4QNRA 2I54A 3R7DA 4NF2A 1NZJA 2YS6A 3NTOA 5DX8A 1M9NA 2XCLA 1XD9A 3AKYA 2AFRA 2EFHB 3S1AB 2DQ4A 3EZXA 1OV4A 3ML1A 2X0FA 4IF6A 3WOHA 4WECA 3GRZA 4HUQB 4WI1A 5J2GA 1V5WA 3F3KA 5JJBA 4WKBA 1O7JA 2EJBA 3GFGA 1EDZA 4QJ3A 2AMJA 2IHUA 5L4SA 1TO6A 3FFBA 3QBEA 3ZLBA 2HTEA 2AI1A 3KB2A 3T4XA 2A1JB 3FLEA 1Q0PA 3ZY6A 3S2IA 1QPZA 4PE5B 1IC6A 1VBKA 4N7JA 4EA7A 3VH1A 1T2AA 3EZ2A 2VDOB 5CJJA 5FPTA 3LUKA 2OZPA 4UHBA 2JCBA 4JFRA 4OX9Y 3UWMA 4C14A 4ZDIA 2CXYA 3T1TA 1ZXXA 2VXYA 2C8JA 2H07A 7ADHA 2HRZA 3UGTA 1U02A 3NOOA 3BTVA 2Y68A 2ZB4A 2JD0A 3NHMA 4Q1VA 4FHZA 4EYOA 1GL3A 4Q4AA 4BKOA 1RYYA 4MR7A 1IBMB 1H2WA 1YK0A 1SBIA 4AS2A 1M2FA 4I9GA 1R4MB 4EKNB 3CH7A 3Q7TA 3MCZA 5C3MA 2EGGA 4TXMA 1Z6QA 3Q8RB 1VMAA 3GLHE 5KNCD 5H82A 1G8YA 2ZCUA 3OPXA 1SC1A 4PNEA 1JWLA 3IIEA 1WX1A 2G5TA 4MW9A 2HXSA 5CM8B 2P75A 3KBOA 2FSHA 4HDAA 1KI7A 1JX6A 1KL7A 3QVGA 4MW4A 5DQHA 2XKBA 2ACEA 2HWUA 2QZ9A 2DXIA 3IULA 1MAWA 3WADA 5K05A 1A88A 4MLZA 4PGHA 3DBIA 2RGCA 2QOEA 4P3OA 2GXSA 1AN0A 1N3BA 3V6MA 2KOBA 1D7AA 4LDJA 1SB8A 1JQ3A 2VDRB 3AYXB 3IE0A 1H2HA 2BR4A 2QYOA 3RT1A 1G5RA 3H87A 1OAAA 3D6NB 2GK6A 2KS6A 3G2KA 1T0IA 2QX6A 1XKTA 4RTRA 1H3EA 4FLFA 3FCAA 3LUJA 1H5NA 2EW2A 2IYYA 4JLNA 3LBFA 2IITA 4DFDA 5JJ5A 4KFCA 1UKAA 2I4MA 3L02A 1SXJB 4J7CA 4BE7B 1DEXA 5JYBA 4GG1A 1P2GA 4N8DA 4RHFA 2QL6A 5T3YA 1TDJA 4RH1A 3WIOA 3C2QA 4OUDB 5ILGA 1WPRA 4XJSA 5INTA 4BWMA 1UFVA 3BXOA 3PIRA 1E1YA 2X0KA 2AEFA 2WTXA 1RS0A 3PUJA 4CGZA 4P5EA 1AZWA 1VL2A 5KYWA 2YY5A 5B1HA 1V1MB 4FZVA 4LWPA 1HRKA 1JJ7A 3DW1X 5IZCC 1B23P 3WC4A 1OZGA 5IU6A 3Q7EA 3RE1A 1KI2A 1L7PA 2OOKA 1UKEA 2HCTA 3NEAA 1JDZA 4JV2A 3MTBA 2EJVA 1DRVA 2ZYVX 3OP4A 3CUUA 4QAJA 4J16A 1VLVA 4DMGA 4TRRA 4ZMRA 4ENRA 4AZ0A 1WWVA 4KFRA 4FSHA 2V3CC 1JFRA 1KSGA 1IXRC 1V35A 1OH7A 2FTKE 1LK5A 3CZCA 4BQEA 1N2GA 2AFHB 1RYHA 2D2FA 5LDHA 4YS6A 4MEAA 2GF0A 3T1QA 1X92A 4W7HA 1E3MA 2WIDA 1Y81A 3HN6A 5CRXA 5JROA 2VZ0A 4GOOD 4CG2A 1E7RA 1JZQA 3AQEA 1FLDA 2JGJA 1V1RB 1U28C 3FZEA 3KR0A 3Q1LA 2GPBA 4G67A 4TRJA 2QLMA 4BP3A 1H2XA 5FJIA 2WHEA 4DA4A 4GC9A 3IALA 2RMKA 2EQYA 2FLWA 1TMKA 1JU4A 2PZLA 1XDDA 4OB7A 3L93A 2OHVA 2C57A 3H0CA 1LRLA 4GNKA 5DW3A 2QTTA 5TQ0B 2DQYA 3KV3O 4LAFA 2ZUVA 3UFBA 2QN1A 4D4HA 1V2GA 4L5BA 5LXTA 2PTGA 3NOVA 4K88A 3R8CA 4P9NA 4WVFA 1ZXLA 1O77A 3QEBZ 5LYJB 1JT2A 3CZQA 4XB1A 2YIDA 3G0BA 4QTTB 2D6FC 2Q3FA 721PA 1M2NA 2YZGA 1XQXA 2JFVA 2BVNA 3ECSA 1Q7CA 4RF4A 2X41A 2D06A 4RTNA 1QQTA 3OZBA 1U48A 3PUVA 4NZ9A 3H5LA 4ZAXA 1F48A 1KDZA 4D98A 2O52A 3G8YA 2WD7B 5C5CA 2WT9A 5JADA 1U5BB 3DKPA 2IODA 3AUUA 4KLEA 3E0XA 3OM0A 4PC7A 4HD8A 3TCKA 5ERYA 1Z0ZA 1UJ6A 1XA4A 4EPRA 3AR8A 5JCPA 3W5VA 2GQ0A 4JLSA 4AY4A 1RBMA 4QULA 5FYDA 3JYNA 1QNFA 3NNDA 1QMPA 4BE4A 4H6XA 3H2YA 3L0OA 4S0ZA 4A10A 4AUNA 3WISA 5KAMA 3OOYA 3ODPA 2GN2A 4C7OA 4KUHA 4GPIB 3TI9A 1YZYA 2PMZF 3KWFA 3HRYA 1XXHA 2CLCX 4BLPA 3OZRA 2A92A 3R09A 5KI6A 3TH5A 1CVLA 5IHPA 2VSOA 4DRZA 1FCJA 1ZUNB 4RFSB 2QQEA 4CYMA 3FE2A 2RKOA 4CM9D 3CA8A 2CJXA 5HP4A 3PYLA 4QBKA 3JPNA 1UDRA 1TK9A 1GPBA 1TD1A 3HZZA 1IVYA 2O06A 3KFVA 3EXIA 1VGRA 2VT6A 2VEDA 3K0EA 1YA8A 4XCVA 3UK6A 1OLXB 2C7GA 1V8BA 1IBKB 2QUJA 9ICVA 9ICBA 5J4LA 3I9FA 4B48A 1EE2A 5A4KA 4D3SA 3ACBA 3VR2A 3E4DA 4US9A 4OOEA 4BO6A 1X0XA 1MTZA 2NZXA 1DXQA 1E4OA 4IMJB 4U00A 4GDMA 4LZZA 4NCHA 3CTOA 1VIVA 3A36A 3I1JA 3PNKA 2X14A 3MTAA 3A4VA 4EMBA 2X42A 2J6UA 4BB9A 2X9QA 3WNVA 1NR1A 4G2NA 4LYYA 1CJBA 2OTCA 3W9BA 2RHFA 1ZX1A 2P2GA 2ZUEA 2GHTA 2C4WA 2FSIA 9ICUA 4EBBA 3WQHA 2Z3WA 4PG8A 3C5EA 5ADHA 1PJTA 4KLAA 2ZRQA 1HLGA 5BY2A 1XZFA 3TRKA 5DB8A 1LPPA 3M5PA 1UK7A 2BUAA 2J5BA 1G6HA 4GPBA 2VJPA 5DGAA 1NRJB 2WWXA 2FGJA 3L7DA 1PD1A 1QVRA 1EBFA 4ZOEA 3CTPA 2HBJA 1RVDA 4H77A 4ZEWA 4EG3A 1ZGBA 1AKVA 1AKMA 4AY3A 4FYVA 4Q34A 3PSHA 5B58T 5C7YA 5KVQA 4KPGA 2Q6KA 4EECA 2CE7A 4KAJA 2WLTA 1MNQA 1U2GA 5ICGA 2HY7A 2HPZA 4QG7A 1KYXA 4HEA6 1DSSG 3KTAA 2Z5FA 1VPTA 4HDNB 2BZFA 3B20A 4NFHA 2GRUA 4A91A 2YYZA 5IVDA 1IXZA 1UKCA 2BBTA 2E48A 3FJ1A 1E94E 3Q8WA 4BJHB 2NXEA 2E18A 1J2NA 1JHAA 3DPIA 3WJ1A 4H4EA 4NL9A 2FQ1A 4CM4A 4AMYA 4DCSA 5IJ0B 4IICA 4U9IS 1JFLA 1U7HA 4U2EA 2O5CA 1GZ5A 1XHLA 4O5CA 3TUJC 4NJ8A 1KQ3A 4H7JA 4TTQA 3IMGA 4GXTA 4R65A 4MRRA 3IQZA 1EQAA 1J22A 1Z2CA 5EG5A 4BV9A 1O1YA 4EPVA 5CM2Z 4PLFA 4A5SA 3KS9A 1Q19A 5EMHA 3RS5A 3M4NA 5D5QA 4LTDA 2AQHA 1O9BA 3QE4A 6REQA 1Z0IA 2MSKA 4LX8A 1L5LA 1LBEA 1U8EA 4O2BA 5FRDA 4A16A 3FPFA 4P0PB 2TMYA 1WZEA 1EVEA 4QZIA 3L0IB 4ZEMA 2JBAB 2E8OA 1W4ZA 2XB9A 2RHOA 3FN4A 3H9QA 4AX8A 4QDZA 3ANXA 4UAVA 3VR4H 1NVWQ 2Q9AA 1NVKA 4OHMA 4DL7A 3GEEA 5AW5A 2SECE 3AB3A 1RAFA 4MO2A 5JQGA 3LVQE 4PINA 4D9BA 3BGIA 4EGSA 2HNAA 4ED3A 1F06A 4DWIA 3N2GA 5MFPA 2FLKA 4X8HA 4N5IX 4G0QA 1Z5GA 4L85A 4IGIA 1MW8X 4W6ZA 4GX0A 1S3IA 3BCRA 4H7FA 4IIJB 2PUHA 3FHOA 3BQMB 4F06A 1P81A 4LZOA 1KQQA 3Q0TA 2BQ3A 2NTYC 1QSLA 3DL0A 3CEPB 3DOJA 4DADA 4TOIA 2X5OA 4EF6A 4Y2RA 1QS0B 4HNAB 4ZT6A 1VKRA 3JYOA 4QXRA 2PTHA 3QEKA 4X1KB 1RT9A 1Y33E 4R54A 3UT0A 1K1QA 2ZAOA 4II7A 1X40A 4B6PA 5FI1B 3U6KA 4IH9A 4HL5C 3CR3C 3ND6A 3X1WA 2DB3A 1YBFA 3KQOA 4X1IB 4ANFA 3BOSA 5BOMA 3ESZA 4JI2B 4GI5A 1NN3A 4HQNA 1YRQA 1NW3A 4REOA 4C0SA 4HWTA 4UAUA 1U1EA 3KQLA 2MSNA 5T4HA 1EINA 4R8SA 3GPDG 1TKAA 1QGED 3SM9A 4ZARA 1G59A 2A5DA 5B2EA 4MKRA 3GY0A 1TB4A 3S70A 1YO6A 4RXUA 1KDVA 3REQA 2ZS9A 4ZT7A 1AGPA 2WIAA 4ER6A 3QKRB 1NQXA 1ABBA 4KWIA 3BJZA 1MRSA 3RRNA 2UAGA 1P39A 1Q3KA 3HBLA 5AOCA 3GG2A 1BMFD 2IA5A 4RYLA 2WJ3A 1SZHA 1HKHA 5EE3A 4GLXA 4E32A 4HH4A 1P75A 3L4BC 3AXSA 2Z6QA 1U7WA 2ISQA 1T5TA 2JASA 2L17A 3QVLA 1F2DA 4Z4QA 1PVDA 4MS1A 1D04A 4NRDA 2WFZA 4X7MA 3MGCA 3I5AA 5TPWB 4M0AA 2J6TA 4XYMA 2Z9DA 4MA4A 3QFSA 1WAMA 2DUMA 2QYHA 4WKOA 5ILQA 5AW1A 1I0IA 3BCSA 1KSFX 3E3OA 1QLJA 3AIIA 1UHUA 2GD0A 4TT8A 4RMGA 2PX4A 4ZJYA 4BGVA 3DT6A 4RYDA 3RRHA 1Y6GA 1XNQB 3H2BA 2OCGA 4YRTA 3JWHA 2EYQA 4B87A 4P98A 5EIEA 4BCCA 2P2CA 1JHOA 3QELA 2BFCA 2ZI5A 4BV2A 3HWTA 1RLTA 2GBCA 3QIVA 1MH9A 2ZUFA 2O54A 3Q9LA 3PHIA 3BGWA 3UJBA 4DMCA 3ZK9A 2ZB7A 1FPMA 1KEEB 2GS9A 3EQ7A 2NO0A 3UENA 3K3PA 3LDAA 1P2BA 3S99A 4EYEA 2VP4A 4G1CA 4GNRA 4M55A 1MTOA 5BXQC 3QNUA 3JQFA 2WZDA 4YBZA 3FTFA 1G0OA 2CJWA 5G3YA 5EE5B 5A03A 4LPSA 4KLRA 2RGRA 3OZ7A 2C9OA 4OQPA 2IYVA 4NH0A 2I7TA 3N9IA 1YRHA 3JQCA 3ASYA 3CVXA 1TADA 3V7FA 3BWDD 4BBAA 3O2JA 4KC0A 1SXJE 5F3RA 3DUWA 3VR5H 5AIAA 9ICRA 1TZJA 1GQ2A 3AFHA 4D44A 3BXZA 1ZN8A 3QVSA 1H85A 2R6FA 1E2HA 3VYVA 5KYYB 5D3MB 2FF5A 2HXYA 2YWDA 2F3NA 1FRFS 2LYBA 5JZBA 3VC8A 1J8MF 4P7KA 4LW8A 1Q20A 2VPIA 2DBRA 3S4YA 4CV0A 3KSAC 3A9CA 4CMCA 3OM9A 4QOFA 5E1MA 5KDLA 2G9RA 4CNBA 1C3EA 2IYZA 2CFRA 1CR6A 4AJ9A 4ED0A 3VOSA 2O3UA 3BERA 4FNOA 4FE7A 3COVA 2LGJA 3IBCA 4OQZA 3AHFA 2DGZA 4C7YA 1IWPB 2H9YA 4QDTA 4E5PA 2NT4A 5IBCA 1Z7BA 4L15A 2DKOA 2LW7A 5KNDD 2PLWA 4IQGA 2AFHE 3V7WA 1P2VA 2V54A 3DKKA 2QJTA 3B7PA 3AEXA 1N92A 1TD9A 1VLZA 4OMFG 4LVCA 2FR1A 5KQPA 2P27A 3TZKA 4Y7DA 1DMRA 5K51A 1EFHA 2JK0A 1A8PA 4C8LA 4F4KA 4BDSA 1NP6A 1T5DX 5EKDA 4LCEA 1FDWA 1IY8A 3PICA 3T9CA 2A6PA 3WKCA 1KZ9A 4QPDA 3DM5A 4DSJA 2JCGA 4JT4A 1Y3FE 4FGLA 3KL4A 3AV3A 3OI7A 5I8ZA 7REQA 3KDPA 2BCJQ 3OQJA 3PNBA 4JJ8A 4QDKA 3N0WA 4K6KA 1QLNA 1UOOA 3RHSA 1XMIA 2XADA 3SJ7A 5JMWA 4PGYA 3UT5B 1DTWB 4MVJM 2IPOA 2EYUA 2NRTA 1MO6A 2BTEA 4X3CA 1T0JB 4MRNA 3HEMA 2W6NA 1XR3A 10MHA 3B6EA 3H2IA 4MITA 2OZKA 3VKUA 1PX2A 1XCJA 2QVXX 2VOEA 3ORSA 1LC3A 1YHZA 3AZOA 1KGSA 1R4NB 4MX8A 2XV1A 1P4SA 1VYVA 1UT8A 1V8OA 5GVSA 3UHPA 1P61B 4F5QA 4YMWA 1QHHA 3TOXA 3C3YA 5CCDA 3OPYI 2A30A 1QBGA 3FMGA 1B00A 3EB9A 4MOWA 3UVEA 4F4FA 5DJ5A 2WZCA 4P54A 3UFXA 2EFJA 4UHKA 3F2DA 1QFYA 1URJA 4PFQA 1X2EA 1AF7A 1PDVA 5DCWA 2KICA 3WGYA 4O3PA 3ISBA 1IAQA 2ZRLA 3AVTA 3WY9A 2ZSEA 1VHQA 2HPAA 1GTVA 4ZOBA 5K0NA 1KAHA 2XCOA 4KGDA 4QGAA 4F9EA 1ZQPA 3KYDA 4OCZA 1D0VA 2W9CB 3JZMA 1A1SA 1ODKA 2JVKA 1YFKA 4EKDA 2QUZA 1SBTA 4JVMA 5A9SA 2ODTX 3H1PA 4DLNA 5CB4F 2GPNA 2YWFA 2PH5A 2PMFA 2WIKA 3SXJA 4NZPA 2PZEA 3GPIA 3MGAA 2ZYHA 2EQBA 1B41A 4B9EA 3HS3A 4D9CA 4CKBB 2VTVA 5ALZA 1LNZA 4LJAA 4KQGA 3JAMA 4DJFC 3MNFA 1F3OA 1SEVA 3RFVA 3GLFA 4MLPA 5E4JA 2IX9A 2COKA 4GX5A 1BNCA 1LWOA 3RFXA 2XUGA 1B2LA 1E1CA 4H9GA 4JOQA 4JBIA 3W5JA 4BN4A 3U4HA 1ZRSA 3R7BA 5KNDA 4TV8A 3O4RA 1E64A 4R66A 2X9LA 3D3KA 4I4IA 3HPOA 3N07A 1U7ZA 3FKQA 3FVTA 3BRWA 4LHEA 3RLFA 4EG1A 1WQ1R 3IXMA 4ZHSA 4QUAA 2WSSA 5TLSA 2PQ2A 2QG9A 3C43A 1UM9B 3MBIA 3ILXA 1SVOA 4OMCA 1FTWA 2Q21A 4E1BA 1K7YA 5LNK1 3A6FA 4L0TC 2BPOA 4HQ0A 2PMEA 3W77A 3CT4A 4NE7A 5LM3A 1C4KA 4LTNA 2XCPA 4QARA 4IX1A 1JXLA 5K09A 1QE0A 2GLTA 3HA2A 3Q11A 2G08A 4OH7A 4QOEA 1NUQA 1X7WA 2ZCJA 2LV8A 4IJ5A 4RVUA 5DV9A 4X8LA 2GR9A 2AQKA 1VPWA 3B1ZA 3CINA 3UMCA 3HI4A 4WFKA 1HL3A 1WM1A 3NI2A 1CUYA 3DAOA 1QIHA 2FKNA 3HWWA 1JTEA 2D2IA 3UMFA 3EH2A 2RGUA 3IM1A 1VSTA 1HF3A 1NQVA 4YN3A 1IQUA 3WGJA 1KDHA 4EH1A 4ZI3A 4GDFA 4E51A 2EBHX 3O38A 5BWLA 2FEOA 2R4TA 3MFHA 3JPPA 5KKAA 3W5BA 1G2QA 1KKUA 2ZYWX 5JIBA 2AG1A 3WJ7A 1O9HA 1LK0A 1QP7A 5BN5A 3D7SA 4G85A 2IXEA 1WSWA 2XEXA 1QZZA 1I13A 5I01A 3GYGA 4UKDA 1TV9A 2MSWA 2BKXA 5FUMA 1MO4A 2QTGA 4W8HA 4D82A 3QX8A 1YJ8A 1V9SA 1L8QA 4LBZA 4DLLA 1D6MA 4XAQA 2NO5A 5EIHA 3F2CA 4ZAVA 4JXKA 1I2MA 4BFYA 3OO1A 1C0IA 3DVQX 1ISHA 5HZMA 1P0CA 4ZGGA 1E2EA 4HFJA 2FRDC 3QX9A 2WNSA 2RGYA 1Z6ZA 4M9CA 1EUDB 3T3IA 1IQPA 1YCHA 4DMFA 2BEUB 4BNLA 4NBKA 5CNJA 3SOZA 2G5IB 2XVTA 3WSTA 5IIKA 4G41A 4MKXA 2ISOA 1I10A 4HQOA 4M9GA 1RKVA 2FUG1 5H0IA 3KU1A 4FZRA 3JQDA 1LV5A 3NVMB 2B6NA 1F8FA 3ICQB 1K08A 8ICKA 3NO4A 2WF9A 4EYSA 1NJ2A 2HIAA 1X2BA 3LL4A 1EB8A 1J2MA 2HWKA 4ZEXA 3H5VA 4FFBB 3WYDA 1S3GA 4JYCA 4ZZ3A 5EEGA 3T3HA 3BC1A 3MS7A 1OTXA 8ICVA 2EAUA 4BL5A 9ICFA 4HAIA 1TK3A 5KFMA 4H6WA 3OMXA 2DM6A 4RAQA 5ALIA 4G5FA 3AQIA 5B7GA 2OD7A 4MRVA 4L16A 5IW8A 3SZ2A 3H9CA 3WTBA 2ZRDA 4L2FC 4I50B 2AMLA 1VBMA 3HCRA 3ZTTA 1UBLS 1F8UA 1YE8A 4XM0A 1RP1A 4L3WA 4EHNA 3LKBA 2CNDA 4PVDA 1OVGA 4DDMA 3TEJA 1TGVA 2WSMA 3ZV3A 1E7SA 2P40A 3O9VA 4CM3A 3PLNA 2XVXA 2QLNA 1EPUA 4N5NA 5PNTA 2VK1A 4F04A 2XXJA 4ZQGA 4C3VA 4LZNA 1S0MA 1L3SA 1TO2E 1XZBA 4UBCA 2QQFA 2FQWA 1BN7A 1X6IA 2EL7A 3CH6A 1QRSA 1IIRA 1SUAA 1XWFA 4NBNA 1H22A 4QW9A 3KJHA 4DPMA 3S28A 3WIEA 4GR9A 1JQJC 1VM6A 4BWFB 4H4CA 3LH5A 4LJXA 5IIIA 2J48A 4CI9A 3PC7A 3AETA 2X86A 3HJHA 4LCJA 1HTWA 3PE6A 3GWGA 4JWKA 3CRXA 2YJ5A 1HNNA 3EG9B 5JNLA 1SKYB 1V7QA 1LBSA 1C30B 2XYGA 4QWAA 1ZMRA 4H08A 9LDTA 2Q3HA 4C8OA 1HT1E 1UDXA 2PX8A 2CVPA 4EZEA 1U8TA 3U1TA 2K4PA 4DLBA 1PJ8A 1RQPA 4MVJI 1T0PA 3PD7A 1XC9A 2V4UA 4MLDA 2FW9A 2HLPA 4OHWA 3R9WA 1A9XA 1J0BA 2EBUA 1BYUA 3L7BA 3L3BA 5DB9A 2XY4A 4Z49A 3HNOA 2PBLA 3C6KA 2GTHA 4LYDA 1CU1A 2CMDA 1KI6B 4HPWA 5FOUA 4WA8A 1POXA 3AL0B 2H5JA 4EFLA 2HHTA 2LMRA 3TF5A 3P0RA 1BS1A 5EKSA 3BREA 3WBBA 4CKWB 3EGOA 4KZQC 4YRCA 5I9SA 1L8OA 2MSDB 4NMWA 4RK1A 5CA0F 2W58A 1U49A 2WUVA 3NBAA 1NQOA 2JIBA 4B80A 1N5OX 2B4YA 2HADA 4GT1A 4DUYB 2A78A 5IAJA 1RLUA 1X38A 2RBGA 2VJNA 3SMVA 3NHAA 4HVCA 4D97A 3UPDA 3VR6D 4CEHB 4Z0TA 1YRAA 1JS1X 1DNPA 2PR2A 4HWGA 1S10A 3MMNA 1KYQA 3ZUPA 4DY4A 2F64A 4QQFA 3R7AA 1R6AA 5IMSA 2LPMA 5F76A 2FWBA 4EPWA 1I1QB 3LC1O 4ZV4A 1AT1A 2QTNA 4AJKA 4G09A 4KSYA 4M3NA 1WUYA 5ADSB 4UB2A 1TYZA 3RUDA 2R1TB 3QUSA 2XZDA 2IS4A 1BKDR 2B1IA 2QZJA 3LQFA 2UVQA 2C99A 2XWJI 1FY2A 3D0OA 4HHEA 2GK3A 2XSZD 4EYQA 3TXXA 3RAFC 4AQYB 4JIGA 2H1FA 3G2JA 4A2WA 1OU4A 3DO5A 1Y4UA 2E5SA 4GXQA 4CNQA 5K0FA 1UWVA 3OHBA 3T3FA 1ULHA 4DRXB 2R47A 1GUDA 4QLOA 1N1GA 1WL8A 1ORDA 4ZHQF 5ADWA 4QZAA 2VG8A 1BPZA 2YZMA 2RG1A 1GFZA 1AGNA 3N05A 1OFVA 4YRRA 5AKHA 4MKGA 3IMKA 4PYKA 5AI9A 2JAPA 7GPBA 2JFUA 2C58A 2XGSA 4DF3A 4WL0A 3AU2A 4HWRA 5C53B 2IEAA 3CZAA 3TIFA 3RIMA 1RE0A 2AGVA 3OIVA 1YIDA 5FAKA 1T2CA 4NBVA 2BJHA 4RD1A 4Z2YA 4G81A 2CL7X 4NJEA 4WXPA 4KXYA 4MHSA 1B16A 2Y99A 2GVZC 5EJ9A 2V1XA 1NSFA 2MINB 2QNRA 2BHLA 4RGQA 3IVGA 5KJEA 2P62A 3ZJUA 1Q22A 5AJWA 4XDZA 3ME5A 3TOVA 1MZVA 4KPYA 3HVKA 5L3SB 4B35A 2XOKA 1XPOA 1C9MA 1AQLA 4M89A 2RGNC 3ZCXA 4L4UA 5BN4A 3S2ZA 1QNLA 2DULA 3NORA 4V1CB 2BFWA 1GGFA 2ZDQA 5CYGA 4W5TA 4KXNA 1R6BX 1U1IA 5DP2A 1RYEA 4R71A 1T1EA 3JPYA 4J8PA 4ROSA 1RLIA 3F98A 3C1ZA 1A0PA 2B1QA 2XNHA 2FWAA 2AOXA 4HJXA 3Q2IA 2WJJA 1RKQA 3BZWA 5FI5A 2H57A 1ZJZA 3O8QA 4J9SA 4CL3A 4NQZA 4LHWA 5AUQA 1WXXA 5K0GA 5F2OA 2OCDA 1C1YA 2IPMA 1BE8A 3HVRA 3QE3A 1PJQA 1T6YA 3DV2A 1SUWA 1HFKA 1IAVA 2XKJE 3AVQA 4MROA 5H80A 3VR6A 4POAA 4U63A 3RUHA 2AD5A 3QQ5A 5HCIA 1PR2A 2I4OA 2G5PA 4OB6A 2I4TA 5CG1A 3F9IA 2HEIA 4IM7A 2KIVA 1WW8A 2X7XA 5CH3A 1ZI6A 2R97A 4OKNA 1E0DA 3SLRA 3H8WA 3OE7A 4RE5A 2GN9A 4BGDA 1A8UA 2ZWIA 4BS9A 5BWOA 4J7XA 2OHFA 5AJZA 2AWOA 1ZH0A 1ZQXA 3QY0A 2NUAA 3OX3A 4Q8EA 3ANTA 2W0MA 2EVWX 4CKEB 4FB5A 1V71A 1MV8A 2D1SA 4AO7A 2CUZA 1C1XB 4DDWA 2ZYAA 3SC4A 1Z3EB 2D1FA 1Q2XA 1MX3A 4LMPA 2OLKA 5KOJA 5A71A 4CT0A 4RDXA 1Z7GA 4IAOA 1BD4A 2Z4RA 2QN7A 2DKXA 4FILA 5AVUA 2EZTA 1T9GS 2XUPA 2F4NA 3RHZA 3ITNA 3LUGA 1K0FA 1LDBA 1SIUA 5K6AA 1M75A 1S76D 1ATZA 1OAOC 1QCCA 4EY7A 3JX9A 2PL9A 5DKFA 1UMCB 1G8SA 1R66A 1YWGO 3KLBA 4EG7A 5KG1A 1BXZA 3I76A 3WGNA 4KP7A 4BQSA 3ZU6A 2A7QA 1UDWA 3O1LA 4LJYA 3TTSA 3F5DA 1L5NA 4LYAA 2VJOA 3R1IA 4KLHA 2OV2A 3M1LA 2YASA 4YJ3B 4PTYA 1KJQA 4P1ZA 3LF2A 1KLNA 2GZSA 2Q8QA 1UKBA 3C3EA 1D4FA 2HBMA 3VDXA 2DWCA 4IXNA 4JV1A 2AUMA 4IH4A 1EU1A 5KC9A 2E55A 1QKKA 3KZNA 3K0BA 5IULC 5EQFA 3HJBA 1IUOA 1ZCFA 4G56A 4LYFA 5JS2A 1OXBB 4MUXA 5I9BA 1CUJA 3Q85A 3K0KA 1B15A 4QDJA 2ZDGA 3C5CA 1FU4A 1JAZA 4R63A 1HETA 5KPDA 4MP8A 2VNKA 5BYKA 1U5AA 3F78A 1E7MA 2IYUA 4G4JA 2F3UA 3W4JA 3LIIA 4F8EA 1B0ZA 1TUBA 4FC7A 4YT4A 1OF1A 2G4CA 4HG2A 3IVAA 1ZW1A 1L3VA 2O3SA 5JAHA 2JFHA 1GV1A 3B48A 3PE3A 4D46A 5AKXA 1WDTA 3NVWA 5F2EA 7ICOA 4RMHA 4TSKA 3I8XA 2PIDA 5CNMA 3TQOA 2QD2A 1II9A 1NZPA 1MLDA 1DCMA 3AF6A 1FTGA 2ABWA 1B0XA 2FDRA 1G5FA 4CXMA 5JBIA 1P3Y1 5KWIA 3WYEA 3RAGA 4ZH4A 3OWOA 4RQBA 4B17A 2MUTB 2PXHA 1N5KA 3VH3A 5FWDA 1R8QA 2HNKA 3LYLA 4NFLA 4O1HA 4P4SB 4GHWA 3NTXA 4X93A 1XXLA 3L01A 1UA1A 1JQEA 3DPSA 5FX2A 1ZBQA 3V4PB 4BN0A 1DC5A 1MDBA 5JSFA 4PSAA 4D4MA 1XYYA 4FFLA 3ZY3A 4WBNF 3PTAA 5G02A 4Q15A 3MJTA 4MYTA 4MIEA 1CY0A 4J1QA 2NRVA 3ZY2A 1NZBA 4D4KA 3V2IA 1MD9A 4Z86A 1GYQA 4IRUB 2X2EA 4NLGA 2JHDA 5DK4A 3MXOA 4EITA 3B60A 4IDPA 5FBKA 2FPIB 3N0RA 5CA0B 4M0LA 2HV9A 3CF2A 3ZLJA 4HDKA 4HGPA 4HYTA 3OZWA 3PJFA 5IK2A 1WV0A 5KG6A 3FM9A 2Z83A 4YT5A 2PM8A 1ZY2A 1D4ZA 1XMQB 3PEVA 5BPFA 2XJ4A 2O5RA 3NALA 3IIKA 4HLKC 1XTQA 1U2ZA 2JDIA 1E6KA 1GGNA 2OHJA 2QPAA 5GJWC 1UDAA 4F2SA 3ZZNA 4QQ8A 1NI4A 4LZDA 3CBGA 4PGFA 5JPIA 2YIJA 5IIOA 2MSLA 2IQIA 5GONB 5TQ2B 1JVNA 1L5HB 1VDMA 3O95A 5GJCA 3ZV7A 4AJEA 3MELA 2NYRA 3N0XA 4EJ0A 2FFHA 2DX7A 2QMUA 3ZTWA 3QEOA 1YD7A 1T9CA 1Z16A 1S77D 1PZNA 1VJTA 1LB1B 2HI0A 2LD4A 1NXTA 4QZFA 3CVUA 3TKYA 2GJKA 3QKWA 4BLUA 3JPQA 1GCUA 1KS9A 2VRBA 5KKCA 4ZVKA 3SFZA 4S04A 2EC5A 2V58A 4D6YA 3I3OA 5BVGB 5HCNA 3K73O 2KSQA 3BS5A 2CLSA 3EZ9A 4N6GA 1X8LA 4F12A 3SIWA 4E33A 4U7PB 5BYBA 3KKZA 2HA4A 4RD6A 3X2SA 1E1DA 3EDRA 1XLWA 3IIMA 4KN6A 3GLQA 3PLRA 3T5KA 3K0FA 5JHGB 4HB3A 3IH5A 1CI4A 3CW2A 5AVTA 3KE9A 3QFCA 5E38A 2PMZC 3FTNA 4ZT2A 3W05A 4QQRA 2BONA 2NU8B 4AP6A 4Q9DA 1E9BA 5CDGA 2AGQA 4QGBA 1GV0A 1HQCA 5JS8A 4P3PA 2VDWB 1FTNA 1X9WA 4UD2A 1IDOA 2ODPA 1C3LA 5C1BA 5KT6A 4XWKA 3OJEA 4IDDA 3BDIA 5HW0A 1NMQA 5I47A 1RYBA 2PH1A 1VSBA 3R9XB 4AZSA 1VMIA 2I9GA 3VAAA 1IJEA 1V45E 3EISA 4YPOA 2ZM6B 3HUUA 3UICA 2PMKA 4UD6A 2OZVA 3AJEA 5JD6A 1ZOIA 3UTDA 4CODB 3HDGA 4M0EA 3JR7A 3LRXA 1M5UA 4E1AA 3KQVA 5TEVA 4DXAA 4GXRA 4YMHA 5KJ6A 2Z8YM 1O6ZA 1ULSA 3ILYA 1Y9JA 4DR4B 5EJIA 4LE2A 4DKXA 3O1IC 3MILA 4DG8A 4BO7A 2ASJA 3UK2A 1MJGA 4PLYA 3CQ9A 3GRFA 2BP7B 1Y8CA 4JFAA 2LRHA 4P83A 4LY6A 3W2EA 2EDCA 1LPBB 3IT1A 2B3DA 2VUTA 3PVXA 1DQZA 3IV6A 2DFNA 3EAQA 4ZREA 2YXPX 5IUKC 1N5DA 3MPUA 2DVMA 1SKYE 4RAOA 1TE2A 3KOUA 2JZCA 3M70A 3IUMA 1DAIA 2Y0SF 1E92A 4B3JA 1RC8A 1BMTA 3VR2D 5CVCA 2PZFA 5C3UA 4YAWA 1FLAA 3UATA 2Q46A 1G2IA 4A03A 4DDHA 2JLWA 4E0BA 4AJNA 2FK7A 4MV0A 4USAA 2OC4A 3LDHA 2OK8A 2Y1FA 1NF2A 3OCZA 3BMQA 1O08A 8ICWA 3F5EA 3O7WA 9ICAA 1K7CA 1OIVA 2FG7C 4LDPA 4XSHA 4A6DA 1BE6A 3OZDA 2NZYA 4I8IA 5FL7A 2IUSA 3DOOA 3A3KA 1N2XA 5ISMA 3BRSA 1WA5A 1J2EA 1MA0A 2W2TA 2BFFB 3OEYA 4NL4H 1PFQA 3CLTC 3B9BA 1BVUA 1U7XA 4QGHA 1P1BA 5AVSA 1DAMA 5EWMB 2EJCA 3SAFA 1Y37A 3EQ6A 4GI2A 4AZWA 3EVEA 3BJMA 4GIBA 4RVHA 1F7VA 4AF6A 4L4RA 3UWKA 4GECA 3K9CA 3NMUF 3U7QB 1SWWA 4NNPA 4PGGA 2NXNA 1PJBA 4JXXA 5AOVA 2H5EA 3ZVLA 3HBJA 2DWUA 4A3SA 3LT5A 2AJBA 2ECOA 3AF0A 2V03A 4EB0A 3MD9A 1IUNA 1ZQRA 3WGGA 2P67A 2AUTA 4XEUA 5JBNA 3DOIA 1IFXA 4RK0A 3PGXA 4FBMA 2NAFA 4RCYA 2EGHA 2CDNA 3T3EA 4F4WA 1LEHA 3VJRA 1G3MA 1U0EA 2ACVA 3JZIA 4L33C 4XA8A 1JMKC 3UGQA 1NPYA 4HLHC 1MFPA 4KQ9A 4C7VA 2HGSA 4UOQA 2AK2A 3AUTA 5JFTA 5DASA 2PU7A 1JQAA 1FX0A 3FCSB 2V3VA 4HB0A 3HJFA 2CGEA 3MT0A 9ICTA 4AK9A 2W37A 1RIFA 3GRYA 3IJPA 2BZ1A 4OGKA 3SSMA 1FTSA 5KSWB 4UAYA 3FRIA 3DF9A 1Y3CE 2QRKA 2X19A 3FWZA 2RHJA 1L1QA 4OHZA 4R2MA 4ZLXA 2IC5A 2IXTA 2YY7A 1L5SA 2EARA 2JIDA 2E7ZA 1T3QA 3MTIA 3FDIA 3Q6MA 2OVBA 2QDKA 2QW1A 4GD3Q 4BWYA 3TM4A 4IQ8A 4X00A 1VZ3A 3D8UA 4L8YA 4HAOA 4M0MA 4QZVA 1XS9D 3WWYA 5DH9A 4OJNA 5ENDA 5BRJA 4GLBA 5KHAA 4EVSA 5FTWA 3K8YA 4XVHA 4B9NA 2O8EA 4YV2A 5CB1A 4A0HA 5E2IA 2OLEA 4G8DA 4ZDJA 2XE4A 4NNOA 2JLZA 5GINE 2ILVA 3BK1A 1L5GB 4ECZA 4QSHA 5KT3A 1N33B 1EP1B 1YQ9A 1ESMA 4DEVA 1H93A 3IHWA 4OF4A 4FBGA 2BI7A 5AKJA 3MINB 4JT8A 2JFGA 4P8RA 3T5TA 3CX7A 1PUJA 3RJFA 1QE3A 2RC5A 2YINC 1A0OA 3WGVA 2KVSA 3E82A 4QEDA 2BMAA 3VAZA 2NQTA 2CVHA 1JVBA 4CQLB 4YP5A 4PBSA 5KFUA 5HVNA 3EAGA 2GB4A 2YBEA 4RVDA 1M6EX 2PVPA 4F8RA 2BEVB 2ST1A 3U81A 3CRVA 1R9NA 1W76A 2XTMA 2OCEA 1ZNXA 1GPH1 3C41J 1SQ6A 2Y2UA 4NFYA 4LY0A 4XIIA 2HAEA 3GOHA 5HFAA 3GAAA 2G9ZA 3DMDA 2ZBFA 1OOEA 3ROKA 4CLOA 2XI9A 2NRXA 2HOQA 5AJYA 1SELA 4XUDA 4KMUA 1SB3C 3RUCA 3ZHQA 2XY7A 4MCJA 3RB3A 1JXQA 4Z8YA 4XVQA 4TUYA 4PQYA 2JAHA 1ABEA 3M3PA 4ELTA 1K66A 3VHRA 1B73A 3D2LA 1OB2A 2XB8A 4MUIA 1CJKC 2NP7A 1SZJG 1IN8A 1KFSA 4YRDA 3Q9UA 1CJUC 1E2QA 3DBVO 5B57C 1E1NA 5AP9A 3LAWA 3WRVA 1HDXA 1F2TB 3K6QA 4ZI7A 4JQOA 2H65A 1OYVA 2WWWA 3NRBA 3I12A 4OB8A 1WCLA 3SKYA 4B31A 1SG6A 3KALA 3H2SA 1F0PA 2D8CA 3EVZA 1NUPA 5E95A 4D8UA 4OKSA 1H0RA 1UFQA 3V2UA 4LF7B 4HVLA 2F43B 2X15A 4DEZA 3GH1A 3ROFA 1P72A 5MHTA 3IPXA 1DB3A 4BMDA 1XTJA 3AEKA 3E3NA 4JBGA 4C43A 1XAIA 4B9MA 3T35A 3HXQA 1VL5A 3IKMB 2DPMA 2R8XA 5L6LB 2NPIA 2FSGA 5ALTA 3BTOA 5KL8B 1R27A 2ZAIA 2HLHA 5MGNA 4UCQA 1MFZA 3EFEA 2ZIUA 4US1R 1F2UA 2NUPA 4UU0A 3NTVA 1LH0A 4I4TA 2YH2A 4BIMA 1KK1A 3OQPA 3CLS