2ZIXB

Crystal structure of the mus81-eme1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
322
structure length
259
Chain Sequence
ECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQESRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGETSRRIGPELSRRIYLQMTTLQPHLSLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Crossover junction endonuclease MUS81
total genus 21
structure length 259
sequence length 322
ec nomenclature ec 3.1.22.-:
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zixB03
3.40.50.11760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zixB02
3.40.1620.30 Alpha Beta 3-Layer(aba) Sandwich YefM-like fold YefM-like fold 2zixB01
2ZIXA 2ZIVB 2ZIWB 4P0PB 4P0QB 2ZIXB 2ZIUB 2ZIVA 2ZIWA 4P0QA 4P0PA 2ZIUA
chains in the Genus database with same CATH superfamily
3MJFA 5G4KA 5FYQA 4IR7A 4JBWA 2XCTB 4AX4A 1VCMA 2GZ3A 1F20A 1EFVA 3O3MB 1E2JA 4O4LF 4R8SA 3M6ZA 3T95A 4AWBA 1GUDA 2FRVA 4RA6A 3FWHA 5AVXA 3FPGA 4QTTB 4YRCA 3TADC 3F7MA 3PPYA 2VSNA 2PY6A 4KQCA 2O52A 4V02A 5A7HA 4DMLA 3TECE 1UBEA 3R44A 4HBGA 3N07A 2G1PA 4IC9A 1Z45A 1DRUA 1R6BX 1UPHA 4R6XA 4XRHA 4L0BC 1QB8A 3K9GA 1NTRA 2R6DA 3AONB 4MW6A 4NBRA 2PR7A 4R1NA 4AP6A 5JSHA 3N76A 1L5WA 4LYEA 3NJ8A 3FSEA 5CLIA 5A3SA 2RGNA 3E58A 2R2AA 2F59A 2CBXA 2X5OA 5G41A 1XPOA 1Z16A 1ABBA 1SU6A 3NZEA 1UC5B 1QANA 1S2MA 3R1IA 2QKQA 2P2YA 1JHOA 3D7SA 3H1AA 5JIBA 5JSQA 2QJOA 3CO0S 3TL2A 5C1OA 3A3NA 4FOTA 3H9BA 1KEZA 3X0DA 5JNWA 1VPLA 2Y66A 1ZI6A 3WKEA 2ZXIA 3D0KA 3RRJA 5CFZA 3EARA 4MHVA 4MHSA 2R68A 3AINA 3C2QA 3A0BU 1WMEA 1QOZA 2AOUB 5AI5A 3E3NA 1Q84A 3R3ZA 4IDAA 4C2BA 1F0KA 2ZR0A 2DYKA 4EG1A 5BOMA 4U63A 1A8IA 3QUQA 4DJEC 2GPAA 2JJ8A 4ZOAA 5D3QA 3LVWA 2LCQA 2HMYB 2Z2JA 4JITA 1K7XB 4ESVA 4BUZA 1FJ2A 4DVGA 1Q7TA 4TQRA 1AUVA 2XKJE 2B5OA 3E9MA 2DH5A 3UWDA 5EHXA 5HFNA 3RD5A 3R74A 3NRJA 2XMDA 4C3VA 5CRIA 4JC0A 4NYMR 5HHTA 1KFKB 1SUEA 1D8AA 2C9OA 3CX8A 3ELBA 5EIWA 2HHQA 1ZUHA 3Q87B 5CGZA 1P39A 3PICA 1PLKA 2GUWA 5GMOA 3SBXA 5CRXA 2PGOA 2PH7A 3OKPA 5AW4A 5BNWA 4GU5A 3TL6A 1UFVA 1B14A 1MO2A 5EEHA 5FH9A 1Q1GA 3R6GA 5HFJA 3QVJA 2BGRA 1JROA 2SECE 1TIKA 4LXHA 4PBTA 4RZRA 3TAUA 3ZW9A 5BMVF 4QOGA 3IDFA 4BVJA 1NN0A 1LSJA 2G6TA 3JU3A 1XIVA 3OQBA 5E1BA 3GV8B 3VR3D 4E5DA 2JD1A 4YMHA 2D0DA 1VL8A 2G9NA 1A0OA 1KR2A 4HYYA 3TQSA 4EJ6A 4TYYA 3U49A 1LK5A 5E2AA 3SR4A 2XGSA 1G5TA 5DM1A 4YCJA 3KX2A 4WY8A 4YV0A 5CDGA 1BU8A 4O3OA 1T6XA 1F44A 1VIAA 2DQZA 2LXNA 2O0MA 4MQLA 1GNRA 4ID9A 5EUCA 1H4SA 2O14A 2XB6A 1PK1B 5DN6A 1X42A 1NK0A 1OGYA 5KINB 1KH1A 4L10C 1C7FA 7ICUA 5HF9A 3ZG6A 2ASLA 1PFGA 1TX4B 2QV7A 3QJYA 3IT1A 5JJCA 2YIMA 1DXOA 1XJCA 2RMKA 3GMIA 5HUJA 1OFVA 5JAQA 4KR3A 1IULA 4JT2A 4J9PA 3EFBA 1RTKA 2C2YA 4BJHB 3IODA 4XJSA 1J33A 3F2BA 1Q3KA 1JNYA 1UBSB 2IQIA 4ZOLF 4DSJA 5AJTA 4WK6A 3SDBA 4B2YA 3A9RA 4TXJA 1TCBA 1RAFA 2W2VA 4EG8A 4OXNA 4PG8A 3U3RA 2CUKA 4W1PA 2YFQA 1ML3A 4BECA 1JG3A 1W5BA 1UXHA 4LQ4A 3WK6A 1JKJA 3DBVO 3PLNA 1Z2OX 3FAZA 3JQQA 4Y2PA 3DDZX 1PZGA 1CQWA 5FI5A 3PCXA 4CNQA 5IDYA 1OPXA 4X7RA 5ETJA 1AJEA 2OT3B 4AKTA 1HMPA 4F3CA 1K27A 2KFZA 1QYWA 1NWCA 2CDNA 2WSYB 3K1AB 4LQDA 3P19A 2XMSA 1RZRA 3ELYA 4C03A 2HF7A 3ORRA 4BKOA 2WSMA 2PMWB 1JG7A 1I6WA 5JXHA 2YWHA 4U3JB 4W8HA 1LBSA 5IDVA 3PQ7A 4W9NA 1EFLA 1PJ8A 4L9WA 1GUYA 4HUQA 3L40A 4XJTA 2C03A 4P36A 2FJPA 2I29A 2LKCA 2NYUA 1X7XA 1XCOA 3IP1A 1D9DA 2GEDA 2R2GA 2IYLD 3PGXA 4ZQGA 4OSOA 2QZSA 3TGWA 3KWFA 1PQUA 1J8FA 1H0HA 1V38A 3L8ZA 1P1JA 3K53A 1TZCA 2R8ZA 2G83A 3EDQA 3QF4A 5KKNB 4WXRA 4JVSB 5IT5A 4AKIA 1KRHA 2DLDA 3HFJA 5CMLA 1P6QA 5JRZA 4B3FX 5EWFA 3TUZC 1KI2A 4N12A 2E4ZA 5LQMA 3MFQA 2QENA 2EFDB 1C0LA 2F44A 1FNNA 1VIDA 1P1IA 2PD6A 5AWFC 2BMDA 3JAMA 1BROA 4QFDA 1DAMA 2HADA 3W5SA 1RKXA 4E51A 4KN6A 3KU4A 2FVYA 5LZ8A 3WO1A 5AHKA 1E2PA 5J4YA 1PR0A 5T8KA 4GKJB 1AM4D 3MTJA 4LVSA 4MVWA 4YRFA 2D8AA 1U31A 3L1VA 5KHLB 1FP4B 5FFNA 3EOAI 4HUQB 1SKRA 3SZ2A 4TXMA 1UA0A 3LFTA 3NEYA 5KG6A 2WFZA 5TY0A 4BQOA 4BWFB 3A6PC 2XMPA 2P0YA 1G8GA 2V3WA 4LRUA 4S3MA 5KOHB 1TI7A 1RXVA 1HXHA 1Z8NA 1EGAA 2MSKA 4IRXA 4J8PA 4NBLA 3TCKA 5DSXA 4CL0A 2YOHA 2NG1A 4N0EA 4PGGA 5E6SB 4EK9A 5MN4A 3KU1A 1G2PA 3OFNA 2D59A 3EVNA 2BTEA 1HL3A 4ZQHA 3EH2A 4BNWA 3V8RA 4ECXA 4UHKA 4BGIA 3CISA 1ZM4A 4J9VA 4FDVA 1QKJA 2IZOA 3WLNA 1SQ0A 1M7HA 2QPAA 2PV0A 4O5KA 2YNMD 4EZ6A 3JQ8A 3RS7A 2VTBB 3BFVA 3C23A 3UQYS 3C16C 3ZVLA 1Z37A 1CDZA 4ECVA 3FNFA 2A5YB 1TU4A 5CNIA 4NXNB 1PNTA 2EYUA 2CB0A 1HE1C 2I67A 1JDJA 3NOXA 2AGVA 2BW0A 3DV2A 2D5AA 2FB9A 1VHLA 1EJ0A 1N8KA 4TV8F 3S1LA 5I8PA 2OY0A 4PBRA 4PONA 5B2FA 3ER6A 5DPMA 2J08A 2JD2A 4KUEA 1TAHA 4K9LA 4W7IA 4KRGA 3OUUA 4QOFA 4Q44A 4LAFA 5BR4A 3TSWA 1RC8A 1S8OA 3F5AA 1J25A 3MGHA 1KLNA 1A71A 2CHQA 3B3JA 1JILA 4GPBA 4BQFA 3PX7A 1XQYA 2YICA 1IWPB 4V3BA 4KDCA 5GVSA 3HHEA 2OD9A 4GPEA 3V3TA 3I04M 3M8KA 3NBYC 1SXDA 2EW8A 2Y9PB 4FGKA 4EAQA 1UJNA 2HBMA 4YVFA 4Z3DA 2G77B 4MW4A 5IVDA 3ZQJA 1GV0A 1K7SN 1NQTA 2H7CA 3GOQA 4IIYA 3DMNA 4PNZA 5KQSA 1KMHA 1UK7A 4UUPA 3X1YA 1RM5A 4BCCA 2AVNA 5K0FA 1POWA 3CB4A 1XWLA 2FUCA 3GZNB 1JNXX 2AYZA 3TSOA 3W5HA 1JEQB 1N1EA 1TPZA 1ZY2A 2OD7A 2WHXA 3K32A 4KFSA 4YJ3B 4R8KA 4BP8A 1QWSA 5J29A 4P3OA 3U7FB 1WVMA 4RZSA 1ILEA 2ASJA 4RM2A 1LD3A 1QHNA 2H07A 2Z5GA 3RROA 4GOXA 2G1UA 5T4HA 3BD7A 3QELA 4HUTA 2CWWA 7ICIA 5IKXA 2KJ9A 3VR6H 2N1BA 2ZTMA 4HZUA 4LVOA 3WLRA 1GNQA 2VS1A 3N5KA 4JP2A 2FOLA 4TVKA 1M74A 3M6MD 1LPOA 3F78A 4JLWA 4RQMA 1N75A 1RKUA 3C8HA 1ZINA 1TUBB 3S40A 4X1KA 4UU1A 1OF1A 1L5ZA 2HA3A 4AJ2A 4CG1A 3E8SA 3NO4A 2W4IA 3U7RA 2W98A 2GLEA 1E9DA 1P7PA 4M47A 1N60A 3I6IA 1SGWA 3G88A 1D6MA 3OZIA 1Y9DA 3WFJA 4BNNA 5IYZA 2VHVA 3SXPA 5KNCD 4XWYA 5HX7A 2KG5A 3PUXA 5D87A 4FB4A 1KZYC 4Z0HO 4UDNA 5ALGA 3BQ0A 4D3FA 2F76X 2HIAA 3INRA 3O9MA 2AR7A 4G4GA 2YY7A 4A1FA 2FW7A 3L3FX 1QX4A 2QM7A 3HJGA 5KKAA 2R8JA 5EAIA 3V3KA 2YXNA 1CJVC 4BWYA 3O9ZA 1A5AB 1AK2A 2WAMA 1J6UA 1C7IA 4RORA 1VBFA 5BSVA 1SXEA 2CHVA 4KB5A 5CR9A 5ER9A 4D82A 3SY8A 1U90A 5KT2A 1FPQA 1NXXA 1SHKA 5KDOA 5JH7B 2YVUA 3CNQS 2ZU0C 3OZUA 4ZCTA 3WR5A 3E35A 3PHJA 4H7PA 2C7OA 1SIBE 2DBVO 1SK8A 2BV3A 1YNOA 5L9XA 4NICA 3GCDA 5HK8A 1C1YA 3E5NA 1VMEA 3EF1A 5TGDA 4DRXA 4ZK2A 2XMZA 1RRFA 2PIDA 4K6HA 4ZEWA 3V1NA 2A14A 4BLVA 3QJ5A 1Z7EA 1VHTA 2IIQA 1T9AA 2N9UA 1EJ6A 2RDMA 2XAAA 3KCQA 1E5VA 3TYXA 2J6CA 1J24A 3IDSA 3ZDEA 1VG9B 1QMGA 3EGEA 3U3OA 3C1UA 4CM5A 3STWA 5ISMA 3QE9Y 3COZA 2Z4SA 1ULBA 5AW3A 1RAHA 2YDXA 4XRRA 1TYEB 1YGYA 4RT3A 3OQ6A 4R31A 3SEAA 4H4DA 3TIGA 5KJ6A 4BNJA 4E5YA 4WI1A 4ETIA 4IGKA 4ED7A 2X7JA 3MCAA 2W2NA 2Q0ZX 1GYRA 1NBMA 1X39A 4IDHA 1YDGA 1NVFA 3EBPA 2OCXA 4JB0A 1ZITA 2A35A 3IOYA 3S70A 5EXPA 4QYXA 4RXTA 4YAWA 1QSLA 1MG0A 5J59A 1D0SA 1WZCA 1W30A 1A88A 1ILWA 1QK3A 2A57A 1R18A 1I8TA 2PWBA 3EMDA 3GFTA 4IGIA 1WCIB 3ISVA 1L9XA 3ZDYB 4O8ZA 2J46A 4UMVA 2BH9A 1ZCJA 2YJ6A 3GEPA 8AT1A 2Q1XA 3VPFA 2CSXA 2B6HA 4WRRA 4IS7A 3TBFA 2ODAA 1TKCA 3G9XA 2Y1KA 3OMWA 3NHMA 3EXHC 1VKRA 4WOCA 4RPXA 1QJCA 2QQGA 3CEAA 3UXEA 3W8DA 1BEEA 2IDMA 4YV7A 2VPIA 5B37A 4Z2AA 5F23A 2HA7A 2RI6A 3NG1A 3ODGA 3QUSA 2GFQA 1UIMA 1XXHE 1GV1A 3CG4A 3IR7A 1WBDA 2BM8A 2P68A 2VHZA 2C2RA 3T41A 1XK6A 3FROA 2QAGA 1RWNA 3GBPA 2Y9UA 3L0CA 5BUZA 4IVRA 4GI3A 4EY4A 2C9YA 4MGYR 4P9NA 1L5NA 1L5YA 1JL3A 3GFSA 4ZI7A 3R0IA 1DIGA 4V1CI 2GO7A 3PO5A 1XMXA 1MOQA 3FKQA 3KNZA 3ND7A 5HS4A 5AKIA 1K68A 2DFPA 4RMJA 3SQMA 4YPVA 5C0YA 4IX1A 4DLKA 1S2DA 4ENSA 1G5IA 5EIEA 4YR0A 1VGQA 1WZIA 2ZJBA 3WZMA 4DR3B 1SC4A 2P77A 4ZJUA 1TEVA 3RUEA 3OOHA 1CLUA 1XCMA 5BWNA 3TNYA 3K33B 4R69A 1QHXA 1I0LA 1X1DA 4FYXA 1RWWA 3ZE0B 3TXAA 1BW9B 1UZLA 2QTTA 4DA6A 1VC2A 2RHCA 3NHAA 2GJ9A 4AZVA 1J2YA 2XF2A 2VP4A 2P2ZA 5E1OA 4Q24A 2WU8A 1NV9A 2Y27A 2CXRA 3H99A 3OTIA 3R3SA 5HF5A 1T5HX 5LC1A 1PV1A 3OZDA 4MNTA 4LHZA 4YACA 4AUMA 2R97A 3V46A 1JKXA 4TTSA 1L7NA 4WXEA 3PF8A 5AJXA 8ICRA 3AJ9A 4DJ5X 5TQ2A 1MFPA 3NTVA 2O3QA 3VDMA 2F1OA 4OB6A 2YQ5A 5L4NA 1KQQA 1A2KC 2IYXA 2J9XB 2OKCA 2W3RA 4KIJA 2GD1O 4OQLA 1GZDA 3FUTA 1SV4A 1BDJA 3ZCSA 4B3GA 4GLXA 1IJKA 3GPCA 3T9FA 4QULA 1TO1E 2PH5A 1R66A 3C5EA 2ZDHA 1WCLA 3CZPA 3IOCA 3PR3A 2FUEA 4ITRC 2Y71A 4OIFA 3G2MA 4A0HA 4EJ2A 5IC4A 1RQ7A 3DOCA 2P9HA 3LY5A 3MYYA 1FFCA 4OHCA 4YFKA 1UIRA 4TX1A 3A04A 4MRNA 4BVHA 2DERA 3ENQA 2RH4A 4Q9LA 4X1IB 4YJ2A 3PQ5A 1S5LU 2PFQA 4TKZA 4YYEA 4CHGA 4AVYA 1VKHA 5A6VA 4YR3A 1YZ7A 4NONA 2B3DA 2IV7A 1QDEA 1TJYA 1XD8A 2NO1A 2PPLA 3A9CA 1J9EA 4TWZA 1E1KA 1GRRA 1NHGA 4MS3A 4OXQA 4R01A 4RQTA 4EPWA 3PEYA 2ODWA 4P34A 2WV7A 4ZEMA 4R3WA 5AMXA 1QZTA 4V0LA 3D8HA 2VH2A 4YUVA 4XYGA 2JCSA 4AP5A 3QE3A 3D4IA 4WOKA 4F1JA 2W8BA 4M0LA 4Z49A 5HZGA 1ZICA 3LVQE 1LLFA 4GC5A 3H87A 3QP9A 1DUIA 1NZDA 1AQ6A 5KG0A 1R3DA 3V8MA 4BNZA 2PWYA 3L0ZA 2FSUA 4F6RB 4EGCB 3TLAA 2PZ8A 4MAMA 5CBKA 1ZNQO 3R0JA 1AOXA 2E18A 1QS0A 1BEUB 3M2TA 4BGVA 5LYJB 4MPRA 3T3HA 4ZI3A 2EERA 2QD5A 1NUPA 5IJ9A 4AN0A 4DZZA 1B3BA 1E3WB 3T5KA 8ABPA 2O8BA 3OCCA 4HL6A 1VPDA 4NCIA 4NU6A 1GZVA 5HOEA 2PUGA 2LYAA 3BS5A 1CR2A 3WGTA 2EBHX 3TW8B 3H6GA 1JIHA 5TB5A 1R4AA 5A5EA 2CYAA 3VMMA 3C3KA 2PUFA 3MOSA 1C8KA 1ZQLA 2ZJ0A 1T34A 3V42A 4MINA 1XA4A 1YE8A 1RJDA 1KQNA 4RVNA 4ESEA 1KYTA 3BTOA 4JROA 3BOSA 2LZ0A 4YC7A 1BXKA 1FXSA 3UPUA 2DHRA 3HDVA 2Q9UA 3AUAA 5IARA 4X5VA 4YP5A 3TQOA 1GA4A 4Q4HA 2VF4X 2XECA 4MW9A 4PX5A 4CDRA 4Z3KA 3CNNA 4FDUA 1WULS 5ARCA 7ICVA 1X8KA 4A5OA 2X77A 1LPSA 2B36A 1L6NA 3CM0A 3P9SA 5HIJA 1USVA 3FNBA 2G08A 3EW9A 5EHIA 2XCSB 4JHXA 4LJ7A 4CU2A 4PLYA 2AIRA 2P9ZA 3EXFA 1LBTA 4RL6A 5KJEA 1DB3A 3R9WA 2VYVD 2BCSA 2P5SA 3HNRA 4KXXA 3C3MA 1MGOA 4E1BA 3PL5A 2PGIA 1D9XA 5DBCA 4G0OA 1CI4A 3Q7SA 2WWVD 4RJLA 3BZKA 1NK4A 4FD2A 3UUWA 5H0IA 3BSSA 4KLTA 2WTXA 2H08A 2X8JA 3IALA 1FU4A 1W36D 2DUNA 2ZVQX 2ASVA 2H5EA 2ETXA 3OETA 4QPPA 2BHSA 2Y9TA 1V16B 4OHKA 5FPHA 1CUWA 2QLMA 5A1TA 1ZAYA 2OHIA 2Z6QA 1TMYA 1L8LA 2X6QA 3K4PA 2NSYA 3KKEA 3O8NA 5IAJA 1BH2A 1XQ9A 3ACBA 2BTOA 5AOBA 1M2OA 1C3OB 1EVEA 1QONA 1N5OX 4UTZA 2ZWMA 4ENUA 1E7RA 3L01A 3K8OE 4HK4A 4DQRA 4LRSB 1RHMA 4QJ4A 1FQWA 1HKHA 1A97A 4U0KA 2H2HA 4IQTA 3H9JA 1V47A 3GEEA 2FG5A 5EVJA 4KI7A 1CVLA 1I24A 4NOJA 1ODJA 1M83A 5LM3A 2I3BA 1PFUA 4RZXA 1TEZA 4LECA 2ONKA 4R2WA 2NNLD 4O3RA 4HDQB 5AK4A 1O0SA 2FPGA 4OUDA 1W4CA 3NVDA 4TS9A 1E9SA 4UBNA 3TPCA 5I51A 4JEIA 3DLIA 3WK5A 3ZHQA 2PZAA 3TR6A 2IYRA 2R62A 2V6MA 3LYUA 1Z00B 1GDDA 1XYVA 1ND6A 3M89A 1NJZA 3BEOA 4HH3C 3KOOA 5CT5A 4CBVA 2JD0A 3MGVA 4KR0A 3GAMA 1NVAA 1ZCAA 2VT2A 3QBJA 1PHPA 1W8DA 5FPSA 2BVNA 2BISA 2P6PA 2PXIA 1L7OA 4BOYA 5CDYA 5CXUA 3JTEA 3K70B 4HDRB 4R63A 2HA0A 4LC0A 1YIDA 2IZZA 4DLUA 5FWDA 1PSZA 1PKEA 1Q3HA 2BMWA 4QZ8A 2WEKA 3QWBA 4V0RA 5CM2Z 4BLTA 1OFIA 1RRPA 4AD8A 5BW4A 1QHIA 2WHPA 3TRIA 2PMZC 3W1EA 4O59O 2D5LA 2DLNA 1EIZA 2OO3A 4G2TA 4K9KA 4YJFA 5TMPA 1OZ0A 1KW4A 3OPYA 1T4CB 2A7QA 4WBNF 3G0OA 3UPTA 3T5PA 5CEJA 5K8VA 4OHOA 4JI8B 3FWZA 3NX4A 5L53A 2G0TA 1O0CA 4DE5A 4QPJC 5CJ2A 5BSMA 5IZ4A 4W9NC 1Z08A 4MR8A 1A4IA 1MVNA 1UMBA 2I4LA 2GF0A 2O0JA 3GA5A 4K0RA 2E3JA 1COOA 3KQHA 2XDAA 1H9CA 1T1IA 3G9QA 2QTAA 1D8TA 1P31A 3DWGA 1N6RA 3AF1A 4I5GA 4WQMA 1XLWA 3R7NA 1ONPA 2RIRA 2FCAA 1EJ2A 2ZIEA 2FEXA 1N6OA 1DKUA 4J1TA 2X5NA 4KQ2A 4RA6B 2O8EB 3FA2A 2EHJA 1F0PA 4MWCA 3KLMX 5I9IA 3T5GA 3LP5A 1G5FA 2YVAA 1WR8A 2OFOA 5JW6A 4U02A 4B2IA 4N49A 1XVVA 1P5ZB 3GG9A 4F6CA 3DO8A 1RSZA 1KFBB 4KREA 3A1VA 1X38A 1YO6A 1N2IA 2GVZC 5ADSB 1U8CB 5HKKD 1UBNA 3WL3A 2F8SA 2QM3A 4BVAA 4OPMA 4MR9A 3THWB 4Q3DA 1C7QA 4KXLA 2CLDX 1P1BA 3PFGA 3BJYA 2H11A 1Z75A 2C2KA 2FPOA 4MVJA 5C46F 3AGQA 1GPKA 5JD6A 4CFYA 1FNMA 1HE8B 2HX1A 2O3JA 1LDEA 3TIXB 3VO8A 4JLJA 5L51A 4R81A 1VJCA 3IQFA 2YMLA 3U7IA 1X7WB 4WXYB 1ZHOA 5J40A 5EZYB 4OD0A 5ADQB 1OU4A 3GEDA 1JXOA 3IUSA 3QEMA 5CA1F 1DP4A 1K4YA 2QD2A 3EG5A 1E0JA 4G8CA 2JXJA 5AK6A 1TM4E 2KN7A 3BMNB 1FTWA 5J2HA 4N5HX 2JJQA 2P9TA 5D5HA 5EXEA 3T7CA 1YL6A 3C41J 3CQ9A 1UPUA 5K4AA 3RYFA 2C3UA 1B8OA 1ZMRA 2XQIA 3I9V1 4OUKX 4DV4B 2ZJOA 3EMBA 4DOMA 3BZCA 2O1WA 3LW7A 4ECUA 3TDMA 1CUCA 1TKRA 3EIOA 3PENA 5ELMA 4CCWA 5JU5A 4OBBA 5B4VA 2Y1IA 4YN3A 4C20A 3UB4A 1E3JA 2VDWA 1U7UA 3PHGA 2XR1A 4DBLE 1W85B 2XY5A 2IHUA 1QNLA 3QKSA 5CX1B 1WCNA 4CW7A 2WU0A 4ES6A 1GHTA 5KYNA 1DBPA 5KSWB 2GD0A 3RH4A 1U04A 3TLMA 1TADA 1BGVA 3A27A 1Z6XA 4HLKC 2AFHA 1RYHA 4Z8XA 2Z5FA 3MDAA 3A25A 5FOWA 1OFUX 4QPNA 3VTKA 3WICA 5J2FA 4X41A 3ZWVA 1D2EA 1ZQEA 5LMCA 1SVNA 1U9IC 3D7LA 4CL2A 4XM2A 4ETWA 5CT8A 3EVBA 4TT3A 4R3UC 2RKOA 2VDNB 3GHYA 3GJ5A 1WWVA 1MQSA 1T29A 3F7TA 3REFA 4A2WA 3PZPA 4RTPA 2GAAA 1JH9A 4ZLXA 2AQ8A 3P71T 4IEEA 4LJ9A 4ZAWA 1CRPA 1K0UA 1Q3VA 2BEVB 3D8NA 1U0JA 3AFIA 3LKBA 5KTQA 1T9HA 2QK4A 5B53A 4YMSA 1OX4A 2AF3C 3GLFA 2ZQ5A 3ANLA 3NS1A 3QG5A 3VU3A 4BKUA 3VZBA 4AYBF 4RVDA 1TLLA 1DAOA 1E2EA 4FFMA 3MCTA 1I10A 3MWJA 5TQ0A 1ZSNA 5LA6F 1Z6TA 3PNQA 3I58A 1XNJA 4PGAA 4IHQA 1NN1A 3N3BC 3UGJA 4DWOA 1LRKA 1J9GA 1NW6A 1DEAA 3C3CA 4HQ0A 4F4WA 5TF4A 3VYSB 1AO3A 3SCZA 2W4QA 5KJCA 1KDYA 2YY6A 2ZITA 5AOAA 3IQZA 1EUYA 3LCMA 1F9EA 1G20A 1T8TA 1J2TA 1YA8A 2OE2A 5ALXA 3BGSA 4H6PA 1YS2X 2B92A 4R2XA 1ODSA 4NVRA 3FFXA 4DCOA 3QENA 4J0EA 4CODB 1F8GA 3NWJA 1FRFS 2R5NA 3VHLB 3D6MA 3WE7A 2A8YA 4I8IA 2C3YA 4LS3A 1JLKA 5L1KA 2JARA 4WAUA 1TZKA 2ACKA 5B1HA 3FYUB 2WM2A 1M2EA 3PC7A 4B9LA 2ZE6A 2YZKA 4E5VA 5DBIA 4LHVA 2J0VA 1GPLA 3G23A 2FFRA 1F48A 1KOJA 2LWIA 3DEKA 5HZKA 4KVZA 3EZ7A 2ABWA 3KPYA 3FNGA 5HQ3A 5EIAA 2OAGA 1HLDA 4BJ3A 2VJ4A 2ZJ3A 5BT8A 3THYA 2YMMA 5J2EA 3B1XA 4R8UA 1SH7A 4HTFA 1R8SA 3QW2A 5GJWC 3OLYA 4E5PA 2PFOA 3LX6A 3PMLA 3HUTA 2HF9A 4K9PA 3RLFA 3VYRB 3LUDA 1OIWA 3DT9A 1ISRA 1K9VF 4QM7A 1M1NB 1MD9A 3MJDA 4W9RA 1SUCA 4RS3A 1RABA 2YVQA 4CQLA 1UC8A 3TANA 2D8CA 4MZDA 2B9VA 3KZIU 1PTJC 1A1SA 1LDGA 1OKKA 4HSEA 3W4JA 4BMOB 3QX3A 1OT3A 1XZAA 2OV1A 2P9GA 2YZMA 3MUNA 1LF5A 1PE0A 3AUFA 3IUPA 4GWKA 1V7ZA 2Q0QA 5B1DA 4Y9TA 5K3FB 5F3DA 4LE0A 5IJZA 4UI5C 1TAMA 1F3LA 4QSHA 3C7CB 4MS4B 3E9RA 2RSLA 1EHIA 3O47A 3ZIAA 1XXHA 4TKMA 5EKDA 3DB2A 5C7IO 1SA0B 4JUDX 1ZQMA 5CEFA 1Z73A 2IVZA 3QE2A 3IFSA 4W5OA 1L4BA 3KV3O 3SXUA 3QXHA 4HDMA 3TBKA 4COOA 1EX6A 1I3CA 2W71A 1SO8A 3FHJA 3NIWA 4UNSA 3V4RA 2ZIFA 2ZJ8A 3GFQA 4TLEA 4UBBA 1ZOPA 5CFOA 1B6GA 1JDPA 2Y0SF 1UT6A 4ESOA 2OLEA 3LZCA 5KUTA 5AKGA 4ECWA 3DZDA 4M49A 4OOEA 4DMMA 3KZVA 1JV2B 3BH6A 1TK9A 1ZQ9A 5B2ZA 1W88B 2G9VA 4I5FA 4KQWA 1RC1A 1W9MA 4TXHA 3D2SA 3LWLA 2FDRA 3I76A 1X40A 3QVGB 1DFGA 4S1VA 2IHJA 4KUGA 3T7IA 2H7VA 5CB1A 1NJWA 4Y0NA 2ICAA 2IFTA 5FF9A 4JJ8A 3MJ4A 4S35A 2JEIA 5DHQA 5C5IA 1E7WA 5EKTA 2CXNA 3HJUA 2Y1DA 4ZGWA 2FN3A 2HNBA 3TAHA 5LFAA 1LLDA 2LKDA 3K70D 2XNJA 3FHCB 3GLKA 4F5NA 3ABZA 4HNQA 4J49A 2F8KA 1OGIA 3JARA 3W4KA 2PMEA 5J0YA 5EWJB 4LZDA 4XIJA 4X90A 3OG9A 2FX5A 5TJ9A 4C4AA 3LP8A 2AZXA 4RE5A 3NTOA 1KSJA 3BG5A 1BX1A 3LWBA 3A1TA 1PNVA 1PSWA 2ZCVA 4FKBA 5ANRB 1LUAA 1UDWA 1WSWA 3IP6A 3W9SA 5HZMA 3RIHA 3HGQA 3CSDA 1VE3A 1E6KA 1EM6A 2H2GA 1MQ2A 3DW3X 3PD1A 3FNHA 1V97A 1S9FA 3IT3A 1IHDA 4DM3A 9GPBA 2QRQA 1AO0A 1FW6A 1ZXLA 5THQA 4DQ0A 3NP9A 4C08A 4PWZA 4MWSA 1ZETA 1QYIA 2I8AA 3OZBA 4RK4A 4QFBA 4A6XA 3G85A 4DDMA 2WUGA 4F2RA 2HGZA 3FDZB 1WUHS 1WZNA 3PY8A 4RVGA 2WC1A 1FXWF 4IXTA 5DI3B 4B9EA 1G3QA 3I23A 4EZEA 2I91A 2W54A 3MR5A 4BX3A 4CF5A 2HVHA 1T9ZA 1XCJA 3RU2A 5TC4A 1PTKA 1XTBA 1ICEA 3EFOA 1UQVA 1PK9A 1DJLA 2PUWA 1JU3A 2QRGA 4GVXA 1RQPA 8ICYA 2C5LA 2WDZA 1I2AA 3IAS6 3V7WA 4F5PA 5HEKA 3C1YA 3FAHA 3OT5A 3R5JA 3R5XA 3ENNA 2IGTA 4LNUA 2A0WA 3H8VA 3O9VA 4GOJA 4OQXA 1GWNA 1HE2A 3TTTA 4CXMA 3LA8A 2RHTA 4B4DA 3AG6A 3G82C 2WKPA 1DPFA 1C0KA 5LBIA 2F8LA 5FJJA 1KYVA 1HWYA 2Q8QA 2VPYA 2XTAA 3G2OA 2KICA 1W8IA 4O4IB 3SEQA 4EPXA 3RC3A 4PN3A 3HS2A 5JHHB 2XMBA 4O3MA 3GLIA 3RR2A 1YDEA 5F21A 4CMKA 1W35A 4RSGA 1JR2A 5BVHA 2ORED 1VZ3A 2AI2A 1JGTA 1ULUA 2FPMA 1B8PA 1X9HA 1VFPA 3M34A 2X76A 1X9SA 2FY8A 3LK7A 4XUEA 1S1MA 3FC4A 2BMFA 4Q1FA 4UHJA 1WHTA 2Q5IA 1I7DA 4A8EA 3M1YA 1NYLA 1QBKC 1QV7A 1M9NA 3F3SA 2IY8A 2CLCX 2HIMA 1RPLA 3PNKA 1Q57A 3HI4A 4GR9A 2EV9A 4AO7A 4BB9A 2ZM5A 2JH9A 1CUBA 1AS3A 3Q7TA 2POQX 4NMLA 1S01A 3UTDA 1F7UA 2O1XA 3BIOA 3K9CA 3KDAA 4KPGA 2K5UA 2GA8A 3H7AA 5FUYA 1PNRA 3HB0A 3ZIAD 5T7BA 4ZMBA 1NY6A 2Z56A 3ZV4A 3UAOA 3TADA 4TLBA 4C3ZA 1JQEA 3KTAB 1T5OA 4I14A 2FU5C 5SICE 2DXIA 4CNBA 4U7CA 5A06A 3FNQA 2MYNA 2PT7A 3CEHA 2QTRA 4Y2RA 1KVSA 1YJ5A 4R98A 2EFCB 1FUYB 2GBFA 1QK5A 4TQGA 4Q3EA 4K4HA 2PU5A 4DLGA 3PFBA 4BFTA 4YJGA 3PW0A 2HQBA 5I8ZA 1RJ9A 4DSZA 2GKSA 2AZDA 3FCYA 1OLXB 1ZQDA 3O4IA 4J75A 1HTWA 5FBLB 4X92A 4K28A 3L0DA 3OO0A 2ZXEA 1RHQA 2DBRA 1DNPA 2AZTA 1EWTA 3THRA 1DWOA 1L4EA 2DSNA 1BMDA 2CHUA 2JJ2D 1WHTB 2IL1A 4AY3A 2ATEA 5CDHA 1PFVA 3MILA 4MV5A 4ND1A 2VA2A 3AMZA 4KMUA 2AOTA 3LCCA 2BRUA 3WFIA 3LNCA 3ABQB 2W7OA 1F5SA 1CQJA 1TUBA 3JZAA 4MWOA 1IC6A 4AKSA 2X0IA 1EFRA 1RQGA 1U2QA 1OT5A 3TSAA 1CJTC 1IFXA 4Y2XA 1RXEA 2AQIA 3K5WA 1ED1A 4KTQA 1QE0A 3GQVA 1JVNA 2FMKA 2WYVA 1O87A 2HXSA 2OCAA 4ZKDA 2W2LA 3LDGA 3HRKA 2F9FA 2K87A 2O2GA 1UEXC 1ZVKA 4YRAA 5J2TA 2W8ZA 4X20A 5D8DA 2EBFX 2P3SA 2OA0A 1IZYA 1F8YA 3NJ4A 1BMFD 2Q4BA 2IYPA 3FGNA 4UE2A 3ZR4B 1DEXA 2VJNA 3L0OA 4ZVVA 4CM6A 4N41A 3R4CA 1MAWA 1KEKA 2RH8A 4IS2A 4GMFA 4PGHA 4XVHA 4KPYA 1K8RA 4P7FA 5M34A 1YZLA 4IMIB 2CHEA 3GUYA 3EZ6A 4MIKA 1QTRA 1U8UA 4E07A 3P2KA 4MDYA 1GCIA 2NVWA 1B4DA 2HB6A 5BWLA 3U60B 1A7AA 2FCRA 2ZAYA 5GZ1A 4YCXA 2GM3A 3ILSA 3U16A 2G63A 1J0AA 2J41A 1IXYA 5TPWA 3WRVA 2VWHA 4Y9SA 1F1BA 1E9RA 3QM1A 4N6GA 1HUOA 3FMVA 3NBUA 4KMOB 1Z19A 2GLXA 3ANTA 3B1FA 5FA6A 3NI2A 4V38A 1GXSB 4ELTA 1K08A 3A9UA 1Y88A 3DAYA 4BFUA 3EZXA 4ETNA 5IX8A 5JEEA 3AKYA 4YQZA 4Q7QA 3E2PA 2GN4A 3QA9A 1IQRA 2OCGA 5CYPA 2X9QA 2NO4A 2Y1OA 3OURA 4BLUA 3TIVA 3R0QA 4TV8B 4AY6A 1LDBA 4N5DA 2AJDA 1Z63A 4KO8A 3IDWA 2VYQA 3BJZA 2BUBA 3F6EX 5K4LA 1J21A 2A2ZA 3JRXA 3A0UA 3OZWA 1EM8B 4JWKA 4R1MA 3PTLA 2VWPA 4RFVA 1VCOA 4GGMX 5KNBH 2X5KO 2DBYA 4FR5A 1CR4A 2H4ZA 1X9WA 4MVJM 1SB3C 1P81A 2PR2A 3HMQA 4WERA 1WNFA 1CDOA 2FMFA 2HMUA 3RS9A 5IAAA 5F3XB 1SKAA 5HKLA 3M6UA 2C1EA 5J58A 4QNLA 2HPHA 3FPKA 3K0CC 5AKZA 2YTUA 3ONEA 4ZQFA 3AUSA 5J2UB 1Y3FE 2V5UA 3C6BA 3E1KA 3NLLA 4PFJA 4D96A 3AF6A 1V45E 1FFDA 2CD9A 1SPXA 2KE5A 4UTPA 3C4VA 2KB0A 2O3TA 8LDHA 2HOIA 3L49A 5DW0A 4MQUA 1SUWA 1VE5A 1HLFA 4MI1A 2A5LA 1GTZA 4WSOA 5C18A 5BN4B 2PEYA 2UU9B 1OX5A 1JDNA 3AM9A 1Z5PA 3QOYA 2QKYA 1UAAA 3QOWA 4ZFNA 2DR2A 2W6ZA 1O89A 1H4QA 4FIDA 1MOPA 1XZGA 1B6RA 2CLMB 3BB3A 2ORWA 1Y3DE 2DJ5A 4AJLA 9ICVA 2YASA 5KFTA 2A30A 1G5HA 2FK7A 2JL1A 3ZGNA 2XZTA 2HAEA 2RGEA 1DMSA 4M7OA 4MO9A 4NBKA 4RK5A 2DFDA 3OLZA 1E62A 4O0LA 3JALA 1MAHA 3PYXA 1TYBE 3GLVA 4IUCS 4TMVA 5JMTA 5E9AA 4ED2A 1EP9A 4JYMA 1ENOA 2O2XA 3MCZA 4RLHA 2QE7A 2RE8A 1FA9A 2C7VA 3QLTA 4CF6A 4HV4A 5BR7A 2KSOB 4NECA 3ZI7A 3GLGE 3JAWA 4UEOA 1X8XA 4EBEA 1UBMS 4YJHA 4F84A 3LO8A 3ITKA 2RGCA 2C7RA 2X6TA 4OTZA 4KFUA 3U2QA 3A6KA 1D04A 1E2DA 1T5LA 1WBJB 2GTPA 3MWYW 5GM1A 4B9AA 5JANA 2AGPA 1Z74A 1Z28A 2E8OA 3L1HA 3QI2A 2XIDA 1I4OA 3LUAA 2WVGA 3PJEA 1FLNA 3U26A 2FX3A 4FZVA 2Q4TA 2Q6VA 1PJQA 2IUUA 1SGGA 3VJRA 2YXBA 4BGDA 4DEZA 1A4XA 4FDAA 3M6WA 3RJMA 1HNWB 5MHTA 2GAJA 2LDBA 4ZDIA 5IDXA 3SGLA 1M6YA 4XGIA 3AILA 3HZRA 1GYQA 5FQNA 3C3XA 4PAOA 3ZVRA 1KFDA 4EOGA 3KOMA 1L8AA 3GAAA 4UAJA 4QQRA 1WY7A 3LTEA 4R1TA 3C5GA 1KK1A 3I83A 3HWTA 1RU3A 3ONVA 2YYYA 2IEIA 3HPRA 3CF6R 1UKVY 5LQNA 5JROA 2JW5A 1QM5A 3INGA 3Q7QA 1SXIA 1Z0UA 3DEEA 1C7YA 1M34B 3EFEA 2DM6A 2FPPA 3O5AA 3H4VA 4GXNA 4M0MA 4U9IS 2JFVA 5K0NA 3DHNA 2BGIA 4C0HA 5E7MA 1N4AA 4G5FA 3HC7A 1ZEMA 4ED0A 4BO3A 1PS8A 2RP5A 1I33A 5GGXA 4PS0A 5BRAA 4UULA 1NJ2A 1V7QA 1Y1PA 2JGRA 4QUIA 5T6MA 3ZW8A 2GH1A 3BF8A 2BGTA 4YMWA 2O50A 1JE0A 1HC7A 16PKA 1LX6A 1U2PA 2C57A 4HWKA 4ED9A 3G17A 4B9VA 1Y3HA 1QO0A 2AJCA 3NHFA 4Q3OA 4EF5A 1YFZA 3BL6A 3GCZA 4LCEA 2FJ6A 4NY1A 3MTQA 3GRRA 4BCBA 2WKQA 4C6SA 3VHRA 3B3GA 3O21A 3VHQA 2JJMA 2WU1A 4ZVMA 5ALYA 1T3QA 5J0UA 2B94A 3GGCA 3KYCB 3KPUA 5AHXA 3RBEA 3F5EA 2WIJA 3FF4A 4YJFB 3O1HB 5KG3A 2BCRA 3HZHA 1ONSA 2A9OA 8ICQA 3I3SR 4V2IA 2ZDQA 4EF4A 5JO0A 4EY6A 3W7AA 1S96A 3W7BA 4QJBA 3EXHB 4XQEA 1LNSA 3ZV5A 4G81A 1WZ2A 3H1TA 4FMDF 4JBIA 3I1JA 5CLQA 3SOZA 2F55A 1T1JA 1XSPA 4P3XA 1IG3A 5HM6A 4Q39A 1ZQJA 1E2HA 1PR2A 2DE0X 1AU9A 4Z9YA 3IDZA 3RTEA 2VXYA 2BSQA 4G5OA 3UATA 5HR7A 1W581 3AV0B 4DF4A 2PGLA 4O33A 2ZT5A 3HLYA 3GZ4A 5JYEA 1XZFA 1UWLA 1MX9A 1Z07A 2QL7A 1JTFA 3W2TA 4KXNA 4QUBA 3SXUB 4MW1A 4GEGA 3AU9A 4UQOA 3E2IA 1X80B 1YJAA 2Q6LA 2EFHB 3DBLB 2VZEA 3H17A 4PN7A 4P84A 1V9PA 4GG1A 4BCDA 5BV8A 4XQ8A 5CH8A 3UMBA 1KYZA 1FVHA 5E9WA 2DPXA 3D4LA 3W04A 4DLBA 4E4YA 3UJDA 1MB9A 4RQ2A 3LZ6A 1HG1A 1GCGA 4HYKA 3GPLA 4GMGA 1APBA 9ICJA 2XNDD 2QV0A 4MKZA 1IBMB 3QUAA 3TIIA 4RETA 2QSZA 4G36A 1ZEJA 1GNSA 5KYWB 4X7MA 4GXJA 2YHSA 4IF6A 3OCZA 4RHCA 4E5MA 1PJ2A 5ENZA 2D1FA 2R60A 3WXBA 2W6JD 2HUNA 3C6YA 1IXKA 4LBYA 3E5RA 3PHHA 4XDYA 3WDSA 3KUKA 1T2UA 2C3MA 2XJ9A 1IOZA 1UMDB 1IAQA 2CFIA 4KXMA 221PA 4ZXFA 4AUEA 3BGVA 1C7ZA 3ZU5A 1IEVA 1RXIA 1G6Q1 2ADMA 4D9JA 4QGGA 4ZH4A 2CK3A 1D4FA 2E8NA 1JHRA 1ZIYA 1HL7A 1C1DA 2O07A 1B1AA 1XZDA 1F60A 1G4UR 2QEQA 3G9UA 3QHQA 2EU8A 1BNOA 1KGDA 5CB8A 4C0ZA 3X43A 5EKXA 3T7JA 1AH2A 1OTHA 2FN8A 1EVKA 2HPAA 4I8XA 3SICE 2X8LA 3I61A 4JGIA 5JALA 2PL9A 3DTYA 2DHEA 1XCLA 4WFIA 1VG0B 1YRHA 2G5CA 2VJMA 4U7WA 1TA9A 4QHSA 4NU8X 4ZVNA 1QIFA 2YCBA 3GP8A 1Y6ZA 3CNHA 2J3DA 3PXXA 5FNVF 3WYCA 5J43A 1DXSA 1RJGA 2BE7A 4ZZIA 4CV1A 3OOYA 3HP4A 3Q9UA 3QEBZ 4IW3B 5KPDA 2ZXUA 3HXMA 4P4LA 1NULA 3N8HA 5BORA 4FS2A 2ZRMA 4OBWA 1GAQA 5IJAA 2OYCA 4LOKA 4NNJA 3B8EA 1X8LA 4I2CA 4NBWA 3RFVA 2HRCA 5B2EA 4FYIA 2P69A 4QGHA 5KFDA 4KPUA 3NAQA 5G4KB 1QRTA 1RC0A 2H3QA 2I5PO 4M9LA 3BRCA 4POAA 3RRMA 3KTOA 1CE8A 3PUYA 1NWHA 3ZDDA 3NH6A 3EAFA 5KFNA 1ZL2A 2UVPB 1HK7A 4OHUA 1CEQA 4PCUA 3C2MA 2NZUG 3BHNA 4AS3A 5J4VA 3MTGA 5K7SA 1N2OA 2ZCUA 4XJVA 1T8PA 2YBDA 4M0CA 3OA2A 3GARA 3SP1A 2ISPA 4R40A 4CKWB 4J3FA 2KS6A 3GVCA 1LLCA 3MAJA 4NCKA 3N2IA 4A2CA 3QHAA 3V00A 1L3CA 3KXLA 1V85A 1HYGA 3MS2A 3H40A 1JPJA 1MQ8B 1NPDA 5JZSA 3HUEA 1LC3A 1FFGA 2OZKA 2G17A 4INJA 4J2HA 1NAIA 4A8PA 4MR8B 4CCHA 4BN0A 5KTNA 4FOPA 1HBJA 3VKUA 5JV5A 1VL6A 1BPDA 3UMRA 5B7QA 4L0MA 5DTEA 1JSRA 4EHFA 1MVOA 4UC0A 1ZJ4A 1ZMOA 1FW8A 4Q1DA 1O94A 2VPQA 2WKWA 3ORYA 2Y1XA 5HILA 2V7QA 2IYOA 3TDKA 3KQLA 2BIFA 1JT9A 1RLOA 3EH1A 7ICKA 1DI0A 3HDHA 5LD2B 3HA3A 4IDEA 4N3GA 3T5BA 1ZQQA 4NENA 4Y2YA 4M9SA 2YRFA 3UKJA 3W05A 4E31A 1MGPA 1VSTA 1FDVA 4ICAA 3LC1O 3Q8KA 3D2LA 3IKLA 4LMRA 4XGQA 4WESB 1D6JA 4HAUA 2PRZA 5H16A 8OHMA 2V0GA 1S6YA 1YRLA 3N2NA 2A4KA 1LPAB 1NQXA 4PYRA 5ES4B 4ELVA 2EFEB 3QUTA 1S7GA 4HQKA 2KVCA 1KQ3A 1LI5A 4QDXA 4B4VA 3DV0B 1YT3A 4KWTA 4ZIRA 3A2NA 2ZSDA 2RB4A 1YK0A 2R66A 3AP2A 1VE1A 2BFCB 3B9BA 4FFPA 3BXHA 2EJUA 5J2CA 2VXCA 3L8EA 4IM7A 4FKZA 4OFXA 1R4MA 4GP7A 3SDSA 4DIBA 1F0MA 4URVR 4INZA 2JFOA 3MCVA 3PDCA 2XBLA 4UZFA 2N46A 1BPXA 2OBFA 3TRKA 1ZQTA 4L27A 1AUXA 1BWRA 3QKRB 2W6JA 2J9YB 4TL9A 4XGNA 1YR9A 2JRLA 1R10A 4B2LA 1I94B 3EODA 2GEJA 1EX9A 2D2VA 2V3VA 5H3CA 4OMFG 1N7HA 3VA7A 3D3NA 4D42A 5ECDA 3DV9A 4QHYA 1LK0A 2IXGA 2AU0A 4JZKA 4BFVA 4O4HF 1KDVA 2AXEA 2JVKA 4II2A 4ISCA 4UZEA 5G3YA 2CT8A 7MHTA 5KYUA 1X2BA 4HLUA 1EA7A 1PQYA 1MOSA 1MJGM 3NNNA 1F4LA 1QR6A 3F8TA 1ADJA 3P8ZA 1NONA 4PHGA 4L5IA 2P41A 3BDAA 5DU2A 3G5LA 2C5BA 4RXMA 3U80A 2OQIA 5EJ7A 3DZGA 4L34C 1UBHS 1VMDA 1HKUA 3WJ2A 4ZHQF 4IAOA 4WEOA 1OBHA 5DHFA 2Z5VA 4C78A 4DF3A 3GBVA 4ZHQB 1K7CA 3KOUA 3UGTA 2IHKA 3QYJA 2WJJA 2F2TA 4FEYA 3RC7A 4DBVO 3Q1LA 4CT0A 1YQXA 2J33A 2QJWA 2ZI4A 3AR9A 4FS3A 4HDAA 4DPMA 3C3PA 2QTMA 1KS2A 2AN4A 3ESRA 5DB4A 3ALRA 3CF4G 4ZZ0A 3I5YA 4B6QA 3RB4A 4P7JA 3AIOA 1IG0A 1VTKA 2EC5A 1D2AA 2OCYC 4MMYB 3L7CA 3N6XA 2KHVA 3RFXA 3D55A 1WSDA 3LECA 4YQEA 3SM9A 3WGIA 4DIOA 5JZVA 3E0QA 4XB1A 5BPFA 3MCUA 3LQFA 3TNDA 3WMEA 1OXUA 3PEUA 4ZCQA 2KZMA 4F96A 1ZIXA 4TVOA 4PIMA 1IONA 1ZAKA 1AMOA 2WG0A 1ZMXA 2VJOA 4DFPA 3IEKA 4E08A 4IOMA 4YDHB 3EZFA 3IB3A 3WGLA 4IV5A 1SIJA 2YMQA 3NTLA 1XJWA 3ND8A 1YIAA 3PFIA 3MR6A 1WU7A 2XQGA 1P2BA 3HCNA 5D51S 4RT2A 3BSYA 4KQKA 4BVBA 3EASA 3N2GB 2IHMA 1ZI9A 2OUKA 3HKCA 1KFSA 1U3GA 2JLYA 4YWHA 3PSTA 1G21E 2HQSA 4QGAA 1GRVA 2B3TA 2O2ZA 4BN4A 2DEUA 3KT6A 3UJ7A 1P3DA 1XL0A 2C3OA 4LXIA 4QZCA 5KFMA 1IOVA 3LM8A 3LYHA 3R3JA 4KE9A 1YHNA 1QHHB 1SV0A 5FAXA 4D4KA 3DZHA 4G0ZA 1XDSA 2I22A 1HO3A 2JS7A 3RVJA 5DKWA 4OSEA 1PFYA 3LUCA 2XVMA 3I12A 3OCWA 2QUIA 4AY5A 3RK0A 1U2GA 1UWKA 1KDZA 5DHSA 3T4XA 4A0SA 1KI6A 2JIRA 2DKFA 2OBYA 5B3AA 1UXKA 3FCSB 4DCPA 2VJPA 4K81B 3QX7A 4OHVA 4M54A 2ZBEA 4BUJA 3DNPA 1JIQA 1WU8A 1U0SY 2EXXA 4ME6A 1O96A 4HDCA 2CNDA 3M8SA 2H4WA 3EJ6A 4U7GA 3C0KA 4GI7A 1RWPA 3M8RA 3RO7A 3BRSA 3C5VA 3RYTC 3OIVA 2CMKA 3MABA 3AUOA 1L3VA 4MS1B 5HCIA 3U6KA 2GPJA 5KWEA 4R71A 2RAVA 4TZTA 2Z57A 3DC7A 4JD5A 4EL5A 3JPYA 1T8YA 3A9TA 3KQUA 3U56A 3HYSA 3UUGA 3KUCA 4H4CA 3NDIA 4K2AA 2XQFA 4BPBA 1B93A 4JU8A 1DDGA 2FXIA 2WMNB 3GNSA 3C4QA 4IVPA 2JRZA 4FN4A 4CETA 3MRVA 2FMTA 3QU7A 4I3FA 2QY6A 3L7AA 1BO6A 2CEAA 4OJ6A 3BILA 1D4ZA 3ROQA 1Q17A 2E85A 4NX2A 4ZT7A 4OJMX 421PA 4BFLA 4Z3OA 2HDWA 5JFTA 3HA7A 4NOMA 2CZCA 4O4JB 4R9RA 5DHAA 1JVBA 1JXMA 4GWLA 1I3OA 2VLBA 4RVUA 1QZXA 3BWCA 1V1RB 2GZAA 2M6RA 1NQWA 3PHBE 4HAWA 2XCIA 4HQ6A 2Z0MA 1SG6A 3T5TA 5CCEA 5K03A 4EW6A 4D45A 4KN8A 2VTBA 1M1ZA 3WXMA 5DGAA 2R1VB 3U5TA 5CU7A 5K3AA 4J2TA 4UAVA 2AD5A 4ZAFA 3MJHA 1ZQUA 1OSNA 2B21A 5FPKA 4UB1A 1DQPA 4Z4IA 1Y81A 1IUKA 1C7JA 1AIPA 1ZJNA 3FKJA 5AVSA 5JXIA 1T3ZA 3H13A 2QVGA 1SOUA 4F4HA 4M7PA 4B7ZA 1FDOA 3W2HA 4KIGA 1UPAA 2VHQA 1F0NA 3F2DA 1U5BB 4JXJA 5DE3A 2JH7A 4I2EA 1MJ5A 3P2JA 5F5NA 3T4PA 1MENA 4EMTA 4RD3A 4MVJE 1ATZA 4CCAA 2ODNA 3KOWA 1NVWQ 1E0SA 1IATA 2L17A 4EI8A 1R2QA 4QUKA 3O38A 1R0LA 1W76A 1CSEE 1I80A 2QIOA 2CB9A 1B0ZA 3E3OA 3GU3A 1JFFA 1NHWA 3EG9A 3GRCA 3HO8A 2YFKA 4DFJA 3GHHA 3LYAA 4JFRA 4WNCA 1L7AA 2FQXA 3IAAA 3W2EA 1VJ0A 1HFWA 4U7FA 2V7EA 4UE6A 5EMJA 4PR0A 2IV2X 2ZT6A 3RW9A 3T1NA 2FPWA 4Z7QB 5CAEA 1MDBA 4NCBA 2JIZA 1QRAA 5JQGB 3RB8A 2OXCA 3NS7A 2BFEA 4L8LA 2HC9A 2JEYA 4V1CA 3N7RC 1C80A 3EGVA 3IUEA 3E9DA 1B26A 3GRKA 4YP9A 1U0RA 1O03A 1NG1A 2HOQA 1JAZA 3X1DA 4BEBA 1JAXA 4HH4A 3U17A 3TH5A 2PMKA 5DGBA 4KLUA 2B4YA 2ZTCA 4P4UA 1BOFA 3GJSA 1I6KA 3ZOZA 1CUVA 1AK9A 3MMXA 4DUGA 5JPDA 3U1VA 1J1ZA 1YONA 3SLRA 2A1JB 4QUEA 2Q29A 1UKCA 4QNMA 3FVTA 4HRAA 1N6IA 3RU3A 4O3QA 2E4UA 1PQ4A 3SBEA 3IIKA 2IHNA 3UHAA 4BX0A 1W94A 1MAUA 4YCAA 5DNWA 5GPBA 4PY2A 2NO5A 2EKBA 4MP8A 1YTUA 1JQBA 3WRWA 2GN8A 1DRGA 1KNXA 1SL1A 3B9PA 4LZWA 4Z54A 3HCAA 3IT0A 2JG3A 1ZUWA 4YA6A 2VP9A 4YXWA 1K8YB 3I52A 5K0GA 4MROA 5BP7A 2H3HA 1KZ9A 1Z0ZA 2P6NA 3DCYA 4PPQA 4BQRA 1N56A 4IJ6A 1GUAA 2A1UB 1R6TA 1U81A 4I5DA 4CI9A 2X5XA 2VBGA 2HTEA 5DB6A 2JGDA 1Q0RA 2EAPA 1J07A 1ZONA 1Z6PA 1O08A 2V9CA 1FMCA 1NNSA 3DCIA 3L0PA 3KJXA 3H8MA 2JFNA 1Q0LA 4MVCA 5CLHA 1GUZA 4XWTA 1JR3E 2CNKA 3JYQA 2QZPA 4KNWA 2C88A 2PU7A 3HG7A 5A03A 1EX7A 2RGUA 5K0SA 4I7EA 2IYQA 4XD2A 3CFYA 5GV8A 4UI3C 3IUMA 1SVLA 2WSIA 3ML1A 4EJSC 4GKVA 5E2BA 4FMBB 4F4KA 4PZPA 2R8OA 4E13A 4UTXA 7ICLA 4MW0A 3V7JA 1JFTA 2ATLA 3ZD8A 1SVWA 2OXIA 3LVRE 3ROKA 2VYCA 3PYMA 4KRXA 3ZWXA 3WYEA 3RWMB 3SX4A 3LPCA 2O9JA 1I4EB 1GY8A 1NN3A 3G2NA 2X3UA 4G9BA 4A10A 1E9AA 2QHXA 3MBOA 1DHTA 1C9NA 3RVQA 3V4SA 4DC9A 3KHUA 5KFVA 4H27A 2G5TA 2DT5A 1D1QA 7ICOA 2DG2A 2O2DA 3PI6A 1QCDA 1VKNA 1FFWA 4GBJA 4N5IX 4ZQCB 3U4GA 4AQDA 1ESMA 3EPRA 3GFFA 1FUKA 4UM8B 3OOWA 4LFAB 3PNLA 1X77A 4FVTA 3CPHA 4IXMA 1SIUA 3U37A 1HDYA 4FR0A 1NURA 3I28A 3FVQA 3NV9A 1EFUA 3LU1A 4K6GA 1B0UA 4GPIB 4F4YA 3HWRA 4WWHA 4KWIA 1YCHA 3PSIA 3KB8A 1X7ZB 3WJ1A 4ENVA 1JYEA 4RK0A 5PNTA 2BBOA 2X3FA 1KL7A 3WKCA 1W4LA 3K0KA 5FFMA 2C28A 1YB2A 3QUBA 1NZPA 1LV5A 1FYFA 1EUCA 3OPVA 3T15A 4D41A 1VI5A 3OA0A 4Q3AA 1N2EA 2QT9A 4K3VA 2HKIA 3RAGA 2KWIA 3PO4A 2OL4A 1JJAA 2JIOA 4YJ3A 2FZWA 4C0JA 1NXWA 3L6CA 4ZC8A 1WCV1 3BYZA 2UZ1B 2Y99A 2NQ8A 3OSNA 1SCJA 2X8BA 3CWZA 5B3KA 1B42A 1XU4A 2B1JA 4RTSA 1OH6A 1FRNA 1NVVR 4G4IA 1U1GA 4TVBA 5IXYA 3ROMA 1KU6A 1QHGA 1Z4MA 3VUEA 3T4EA 4H1UA 4ETMA 1EXDA 4PHAA 1JHXA 4DSIA 3BXOA 5DMHA 2VTVA 4RULA 1XALA 4CGZA 2GFHA 3OOSA 5HBGA 1KFJB 3ANSA 3CZRA 4OK6A 5A2QA 3I39X 4PZUA 2OAP1 3DOFA 1FX0B 4C76A 1ZQRA 1M7GA 4UPEA 4X54A 3SZMA 5CHGA 3WGYA 1V7CA 4Y2TA 1EQUA 1GU0A 1LKZA 2J0EA 4FYPA 2W4MA 2VL7A 3A26A 4IO1A 1LGYA 4QG7A 4B46A 3ZLVA 1WMSA 2I2FA 3H5LA 5A9RA 4FFRA 4J1TC 5EQJB 3AHGA 2PQ0A 3FWKA 4QSMA 3E81A 4UI4C 3RH6A 1DC5A 2XO7A 3GFKB 1PX2A 3T9DA 3WS7A 5CNKA 4IF4A 3GRVA 3UMMA 4XXHA 1V3QE 2DB3A 4UASA 4FFBA 5BPCA 1I51A 2CJPA 3EY4A 3OJ0A 4PC2A 1NVEA 4XLLA 2JZOA 3Q9SA 4Q47A 5CH3A 5D5PA 1XEXA 1L4FA 2DY0A 2GZDA 2VPPA 3RDPA 2JFWA 5KC9A 4B79A 4JMUA 3MFIA 1JKFA 3RFTA 5KQRA 4BNGA 4B3MB 2QMZA 2FLLA 2WIBA 2WJIA 4JCCA 3SC2A 3G6VA 4O4HA 3LIIA 1BDHA 3W5DA 2YJTD 3HA2A 4OQDA 2FWMX 4X9XA 3E7PA 2P5TB 1M6WA 2DF8A 3I2GA 4JYAB 1REQA 4RU9A 3PW4A 1GKUB 3STVA 1BVSA 5LXTA 5AW8A 5LLSA 4JA0A 3ROXA 5CJ7A 1KMMA 3ICWA 3C8ZA 2XUZA 1IHOA 4Q21A 3SC3A 4Z1OA 4JOSA 3QMMA 3D3KA 2B8EA 4MKHA 3VJLA 4DDVA 4CHTA 4PO1A 3NM4A 4C7OB 4EHJA 1M1YE 3QF7A 4ACBA 4MI3A 1X2EA 1U2DA 2HIGA 1VLZA 1XRQA 4B35A 3IHKA 4C7ZA 1A5BB 4DOAA 4ALIA 1ZP6A 3V7LA 4U6QA 1LQTA 3PL1A 1XK7A 3FZQA 3QEOA 4MLCA 3GGDA 4I2BA 5KQMA 4M3NA 3RYHA 3Q4GA 4J6EA 1U3CA 5CA1A 5HR5A 2WTFA 4TS1A 5HMMA 3KAPA 1ZH0A 1NR7A 1NVDA 4IH4A 4BMPB 3C1OA 4GOMD 3ISCA 4GW3A 4DLAA 5C81A 4PHTA 5KOJB 3ZD9A 5KFXA 2HI0A 3C87A 1PIWA 4FE4A 3D8RA 2X0RA 5G2OA 3I2YX 4DBLC 5KFAA 3J7TA 1X70A 2JJYA 4C6TB 1QSYA 1GN9A 2I5HA 3PUHA 1BVUA 1FU8A 1ZDMA 2GHTA 5AM0A 3QNUA 4HS4A 3SE7A 2GWHA 3LMKA 1U8XX 4R1OA 4TN5A 3ZV7A 1UJCA 2CVZA 2V97A 3HEAA 2MINB 4WNAA 2BFWA 3FYTA 2UYHA 1BRTA 4JQYA 2C5FA 3GRYA 2Y0BA 3NB0A 4NFHA 4NE9A 2OSBA 3IMKA 5ALEA 3SAFA 4RNOA 4WZAB 5H4HA 3UMVA 2IEDA 5GIOE 3L8MA 3E05A 3V4LA 3ZXIA 2CPRA 2J5XA 4PLPA 3DD1A 4Q03A 4KYIB 4NLKA 4HY3A 4MQ6A 9ICOA 1WQ3A 3BQ2A 1ISPA 1JJBA 1WETA 3B6JA 3BRQA 2JVJA 4KQGA 1YRQA 3E53A 2O8VA 4YJ2F 1N0IA 2X6RA 4KYTA 2Y4OA 4O02B 2P27A 4YJ2B 4FYWA 4DAOA 2DFLA 4HGNA 4Q7EA 2HEIA 2QLFA 3EVAA 2G8LA 4CM7A 1YZHA 5FA5A 2JLRA 3K0BA 5DX0A 2DFVA 2ZRAA 3LYLA 5F98A 2QLTA 1HT3A 1TGYA 2QD3A 3H18A 3TQHA 1GRNA 3THSA 3JPNA 1DUSA 4UQGA 1H5NA 1KSFX 1P8AA 1SR8A 2ZRHA 4NJEA 3ROGA 2OHVA 2FN9A 2C0PA 2QYTA 3KB2A 3A14A 5CPBA 4D44A 3OSUA 1DKOA 4FWTA 4WKOA 3DDSA 1TQDA 2FFAA 1OV6A 1IEXA 1QFSA 2FW6A 2HH9A 2OZPA 2V4ZA 4BAGA 4E46A 3TD2A 4YHHB 1ZRHA 4JXKA 1F3OA 4KFRA 1R0XA 2QQFA 3FLMA 4GSKA 2W58A 3FG9A 4GP9A 5FLYA 2JVIA 3G8BA 3DYIA 3QIVA 1WG8A 2HU2A 3QXCA 4XWGA 2VAVA 5DTMA 5U4QA 4DANA 4WDQA 5LMNB 3RTVA 2BMVA 5J63A 1E9EA 4KQXA 3WG9A 3IP7A 4PLTA 1OBVA 3HY6A 1JHZA 1C4OA 1Q0UA 3MVEA 3V72A 2FP3A 4FBMA 5HGJA 2ZJFA 3BRWD 5P8WA 2Y1FA 3PC3A 3VR3A 1Z0DA 1T7PA 2FWBA 4U8GA 5EXSA 4AZWA 2VO1A 3IE1A 7ICSA 5C1PA 2VP3A 1KIFA 1LBIA 1ZCBA 2IU0A 4CM9A 1VSUA 3ITEA 2BH2A 2ZB7A 1E3EA 2W6PA 2WPNA 1T5DX 1BFDA 1SUPA 1FFHA 3NHWA 4V0SA 1Q50A 2PCLA 3GRAA 3I73A 3N7TA 3B2QA 3I37X 2ILVA 1Y8CA 2PL5A 5JLAA 1YVPA 1XRRA 3BCUA 1WXWA 4IZ6A 4C4YA 4IRCA 2D06A 1T4MA 4HRYA 1L4MA 4LZZA 5JZMA 2QGZA 4CQJA 3C3EA 3IBTA 4QPDA 1I7QB 3KYIB 3FYDA 1QC5A 1TK3A 3UPDA 2D1QA 5B57C 3FPEA 3DE0X 4HT3B 1T3GA 2W9CA 3H65A 4MX8A 2JFFA 5DK4A 3SQNA 3WTCA 5HNKA 3E22B 1PKXA 3TO5A 4MV3A 3R5TA 1RHUA 1U1IA 2QZ9A 4OFZA 1WV0A 2HBLA 5K5EA 3JPTA 1S3FA 4NZOA 4EQZA 2CBGA 4D74A 1GTL1 2I87A 2VBFA 3Q0EA 4NL4H 1G8PA 4A3SA 1R74A 2XYRA 4ZT5A 3N28A 1CFJA 1SCDA 5KFSA 1SL0A 1JYFA 3VUFA 5JSZA 1Z13A 4JP1A 2VPWA 4NC9A 1VMKA 3ZHXA 5BYBA 2X8JB 2DQKA 4XQGA 3BK1A 2TRSB 1YZVA 2G06A 3LYSA 3H0EA 3U9TA 5B64A 2IOQA 1AZTA 6REQA 1G1AA 1X7WA 4FEEA 1K4KA 4ZVSA 4YDSA 5KX5B 3FI9A 1VBNA 1ZNXA 4DDKA 1D2RA 3EWSA 2HOFA 2DQ4A 3CLRD 4Q4DA 3MLEA 3OLVA 1YQUA 4ILKA 1DK3A 3PV8A 3DFUA 4Y6PA 4L0VC 4MF2A 2CYCA 1T2NA 2XGMA 4XWAA 5JVDF 4M99A 4YH1A 4BTVA 4NFYA 1GPUA 1M2NA 1OLSB 3DR3A 4RVHA 4CLHA 1R0SA 1WHSB 2Q8NA 3B36A 5A3QA 5F9FA 2FRXA 1S0OA 1X1RA 3I5UA 1V6SA 1U3WA 2WNSA 2ZIXB 1JZSA 1WMDA 2R00A 4NNOA 4BJ1A 2ZIVA 1JPNA 5IDWA 3KDPA 3BCRA 4TWBA 1WXHA 4ZAZA 1I5RA 4KPUB 3UW1A 5LNK1 4FONA 2VDWB 2MHCA 4Q93A 3ZCXA 4CKWA 1Z25A 4YGXB 1HETA 3RV3A 2C2ZA 3TG2A 9ICMA 6Q21A 4ZGBA 1HYEA 1SKYB 1GITA 1M0SA 3RJ5A 1C0EA 1GL3A 4HFNA 2D4AA 1SCBA 5M5BA 2NZWA 3PGVA 1MABA 4Y6OA 3C3BA 1EWRA 2PJDA 1TQ2A 1OXJA 4MHOA 2R6R1 3EHDA 5KL1B 4DLZA 1JQ5A 3WGZA 2C7QA 4MGIR 5A5VA 2BEUA 2VHTA 2PZGA 2B8JA 4WFJA 2AUTA 3SFVA 1GLNA 3NHYA 3EOBI 2C9BA 5D4BA 1T4CA 1LB1B 7ICQA 1X94A 4C8KA 2FSSA 1WPXA 2ZYAA 4EJMA 1NC1A 4F1WA 3SKYA 3STUA 3WL7A 3KQNA 4UPVA 2X41A 2HNAA 1A72A 2BEVA 2ANCA 3KTFA 5DG7A 1A8UA 1CS0A 2DHCA 4ITVA 4QODA 4XD7A 2IV3A 5BOSB 3OEIA 5E0OA 1W5AA 2QUAA 5DGCA 1HDEA 5K3FA 1KC1A 1O6FA 4GLFA 4DGQA 4MFCA 2VF2A 4RGYA 1SU8A 2IPXA 2Q2WA 4PRYA 2X14A 3VFDA 3AHIA 1XTQA 2GMWA 2V0CA 5HKBA 4TUSA 1RXSA 2Y6UA 1NFRA 4HRVA 3NT2A 1P9OA 1L0BA 2EZUA 5C5JA 4EB6B 2JBAB 3HV0A 2R6HA 2RAUA 5CVJA 4C7BA 5TPZA 1ZGCA 3E7FA 4LYGA 1MO4A 4LWPA 3WAKA 2VHCA 3PXEA 3S2UA 3ZU4A 1MJNA 4KLAA 1N2CA 3JYLA 1RT9A 2CMHA 3DEHA 4HX9A 4BDPA 4N8SA 8ICSA 2YTZA 3ROFA 2H2DA 1K6MA 3KYBA 2QN6A 2RAFA 1FNDA 4KLLA 3K9LA 5B55A 5LMUB 4F2SA 1N3LA 3BHMA 3RFUA 1G8FA 5DQHA 2W2MA 1S0VA 3WA6A 4ZDJA 4Q6BA 5C8XA 4Q4JA 3OM8A 1ESDA 2WAQC 1UT5A 2YR0A 2ADOA 1U1FA 2IOFA 3G0DA 3GNQA 5LB2A 5G0UA 4KOEC 5ED0A 4UOZA 4WCFC 1YKSA 2ZWPA 3NIBA 3T0FA 4F5EA 3CZ4A 3UMGA 3K1TA 3TI9A 1JTEA 4WT7A 1ADFA 4FSDA 3QVVA 2GUGA 4ZVTA 5BMVA 1H9AA 2H00A 5B4UA 2G5GX 3GFOA 3P4XA 1VSVA 1PWXA 4FZJA 3VZCA 2JEZA 3FVRA 3RQIA 2IELA 5DDMA 1IVNA 1U99A 4HLUC 4OI4A 4OMCA 4OP1A 4HPJB 3D0OA 3FR7A 4RF5A 4UNPA 2XC9A 4WESA 3KEQA 3T3DA 5BWOA 2V6JA 5JQWA 1HYQA 2BF7A 4A8JB 3EUFA 1PQWA 4E6EA 4K9OA 4LQCA 1QVZA 3N6RA 1U7DA 2RK4A 3D6VA 3NBFA 4R05A 5EQDA 3ZPXA 8GPBA 2UKDA 1U9CA 3B1WA 4OHPA 5BUSA 3Q8XB 4H7HA 1QX3A 4KPEC 1CY7A 3T1TA 1HTTA 2IEYA 4U2DA 3R40A 5H5JA 1Z4IA 3HJBA 2XQJA 3NBKA 4W5QA 1CEEA 3G8AA 5A6SA 1PHRA 2D2IA 3GDOA 1U7HA 4IIEA 3SSNA 3TVTA 4JLBA 2CKMA 1R0ZA 1Y8AA 3LG2A 2VZ8A 1M7BA 4JI2B 4JDPA 3TB6A 3TS1A 2WWIA 5A7FA 2P9FA 1PR5A 2V5VA 4WEQA 8ICFA 4M9UA 3DP7A 4O4JA 4ZA2A 1C3VA 3JVUA 2C83A 5K8UA 1FDTA 3GXBA 3ZE1B 1U0GA 1Q7RA 1XBTA 2Z8YM 4FR2A 4HYEA 4BLQA 5A3JA 5JPIA 3OPYI 2H5XA 2FUNB 3OQHA 2FR8A 3P5SA 1CQIB 2CL6X 2A59A 2NX2A 1SBYA 2P1DA 3KQPA 5E6UA 5MGNA 2XGPA 2DAPA 2UDPA 2H3IA 5B5EU 2ZT7A 3DFMA 3OU7A 4XE5A 5E1DA 3U4HA 2ZSBA 4Y2HA 1YACA 2PX4A 2Y68A 4JH0A 3PPVA 1M0TA 4KDFA 5DZSA 3TKAA 3SZRA 3W9YA 1LEHA 2C2WA 3EWAA 1GG5A 4QWDA 2PTHA 4GZMA 1UK9A 4S2EA 5GAJA 3EYZA 5K0LA 1D8YA 3NCTA 1R50A 2PX0A 1NKVA 4OXXA 4Z0NA 3PHLA 2PUDA 3OHSX 3QXJA 2I2AA 2W00A 1X6VA 4YB8A 1E9FA 2AR0A 3AL3A 1U2SA 2IHTA 1L4YA 3AUJB 3A3YA 5B7GA 1NNEA 4F3TA 4CQLB 4DCVA 3BMOA 4WN3A 4TKUB 3LCRA 4YCBA 3RYIB 4DRYA 3UJ6A 2JKVA 5LQKA 2L18A 3D81A 4Z1MA 3OESA 3CN7A 2GBLC 3AK4A 1X7XB 1DVRA 3PHCA 3PKZA 4F3KA 1H66A 1WB4A 2WJYA 3AI3A 3ADOA 5GZ3A 3ZE9A 5T57A 5BV1A 2ODGA 3KE8A 4EW2A 5JSYA 1IXRA 2E1FA 3DLAA 4QW8A 3L6BA 3Q6NA 4MWEA 4ZU1X 1WWKA 1M8GA 4N40A 3W5JA 1H2XA 2AWOA 1GVNB 5LSAA 1L5VA 4TT8A 3RBVA 1DJMA 2VP0A 1N0WA 2X2OA 3KXPA 4NLBA 1SRRA 1UK6A 4D0LB 2ZBRA 3CYFA 3JV7A 3TRFA 1NM5A 7ICTA 1RP7A 5CW1A 4MCAA 4LXQA 2EQ5A 4BL5A 4JKOA 1H23A 2HHWA 1O6GA 3KUXA 2IOFK 3EIHA 3N2KA 4XB6B 5CA0F 3U1BA 1UF9A 4QGBA 2PCJA 3DAOA 3AU8A 3OLCX 3QX9A 4UI7C 2ZM6B 2GYUA 3IB6A 5FXMA 5LA6A 2RDIA 5BW8A 1X7YB 4HADA 4K26A 2ZXHA 2PA0A 3KXDA 1RCTE 3JQCA 4K9MA 3DG9A 5CNJA 1V9LA 5DM4A 3VKFA 4QECA 1JMSA 3FYHA 2W2OA 3FSRA 4U8HA 3MJCA 4YO8A 4B09A 2ZQYA 3QF4B 2GZ2A 2Q4EA 2ZRJA 3ZJVA 1IZ8A 4LNUB 3K8QA 2HCTA 1ECBA 1T0BA 2BJHA 3I9LA 3DT8A 4G2NA 1SL2A 3COPA 1GTJ1 3UHOA 1R9GA 1Z7YA 3H1FA 2UVRA 1DAPA 3OCVA 1GL7A 1ODIA 3CRZA 4R1PA 1KI3A 4CIAA 1B6SA 2KK0A 1ZGHA 4PZ0A 3L82B 1G7RA 2NVBA 1KP2A 3UC5A 4TTTS 1WUDA 3M9NB 1NBWB 4XIFA 2NVUB 2ZBVA 1E20A 1KJZA 1SKQA 1U4NA 1EFRD 3SLKA 1BXRA 4Q12A 5KU1A 2GSWA 2DPLA 2ZI6A 2L0XA 3BC1A 2XI4A 1PR6A 3T38A 2LCFA 3O4VA 3RSHA 4OJYA 4JV2A 1U7WA 4PIVA 3ZGYA 2P9YA 4AJJA 3C29A 2X8WA 4UCWA 4W6ZA 1TE2A 3K9FC 2RHMA 3IBCA 1NMSA 1XLUA 3C98A 1RFLA 2PN1A 3RE1A 1L3UA 3H19A 2Q99A 1T0HB 1V48A 3A1NA 4CPDA 2X2FA 2QR5A 3H4TA 1NYQA 4UREA 4A91A 1ZQ1A 5KQPA 1D3AA 3CVOA 3FMGA 4QICA 4XSVA 2AUMA 4RQ5A 2EWVA 1MO3A 2H92A 3LWDA 3PS9A 1ZNYA 4GF5A 5CJJA 4YONB 3FYSA 4XOIA 1H1LA 1GVHA 3ETHA 4ECSA 4TLLB 2ZZMA 3C8UA 2J6UA 3HU1A 5AIBA 5EJ4A 1QHFA 1C2YA 3OPNA 4AZSA 1JF8A 5NULA 4DV1B 3U7HB 1QGUA 3VR0A 5KFGA 4NLCA 2I7TA 2ZTDA 2JZCA 3DVQX 3VZQA 4YRBA 1V1JA 2ID8A 4OQZA 3FM9A 4TRJA 5HQTA 4QPZA 4BQSA 5F1YA 2BJWA 5HJ2A 3LSTA 3Q72A 3CVXA 3OZTA 4GM0A 4HXYA 3H4DA 3TVDA 1PZEA 1ZRMA 3KYDB 1CXZA 4LUCA 4TMYA 1KZ4A 3VI3B 1V9SA 3R75A 3OCJA 3VDNB 1AZWA 1YZFA 4JENA 4P22A 1CZRA 2JI4A 5FOXA 2UAGA 1U1CA 5LQCA 5CM8B 3CONA 1T1SA 3JR3A 3F4BA 4HUJA 4PCVA 1RKVA 4YHBA 1E60A 2ATIA 3FZNA 3OH8A 1UOQA 4I19A 5JNVA 3R0VA 2WF5A 4F5QA 1O4VA 1ZPDA 4HFMA 3VJMA 4BQNA 4DC0A 4BWGA 4M0FA 2JCXA 4WOJA 2E5FA 2AH5A 4IDCA 4UEKA 1KSGA 4W4TA 4IUDS 1ZISA 3CO5A 3L43A 3KT8A 1C8LA 4QUAA 4M9HA 4OI1A 1MIHA 1G6HA 3A36A 2P0AA 4AY4A 4D9MA 3BZUA 2V7BA 5CT9A 5CCXA 3GYGA 3PR1A 1YQDA 1P7WA 1KJNA 2WP0A 3V2UA 1EDBA 2D1SA 3DT6A 2DWQA 2IP4A 3Q0TA 4OAPA 2BPGA 2WOOA 5ABPA 5I7SA 2V3CC 4G0WA 4QNRA 3JSXA 5IYZF 3TRJA 3TD6A 5JASA 1NUAA 1EAYA 3GJ3A 4BO8A 3HYLA 3L18A 2QG9A 4RCVA 1NDQA 3E1SA 1NUUA 1PT6A 3PIDA 2VJLA 5HBRA 1EK1A 1RJ9B 4JGGA 3JYPA 5JUWA 4KN5A 2QWXA 3AVPA 1KO8A 2RGAA 4O3FA 4PSKA 1KMHB 3IP9A 5TGZA 3TI7A 1Q0PA 4KTTE 4IDBA 4RH1A 2ZWIA 2DQYA 1FFAA 2MTBA 1DEOA 3NXSA 2QL9A 1VPVA 4K5QA 2OKGA 1BTOA 2VZ9A 4Y9RA 5HVNA 3OM1A 5LQAA 4KO2S 3CLSC 3DQZA 4KW7A 1W0JD 5I48A 2IHYA 1P3Y1 1BE6A 3RJIA 1VSQA 4BMZA 3CLHA 4DA9A 2MA1A 3O7MA 3R6WA 1VLLA 3A4YA 3FKSA 4UNQA 5KSPA 1K3TA 3UB3A 3UW3A 4CN8A 2RHFA 1UFKA 2Q9AA 2WWYA 1JSCA 1GT6A 3KL4A 4NHOA 1A1VA 1K7EB 3H9UA 5U1PA 4YEDA 2VUSA 4BMVA 4O29A 4Z7JA 1P17A 3HV2A 1DBSA 2UYQA 3NJRA 5IEBA 1G8HA 1N6KA 3VSEA 4GKBA 5I9LA 3GIWA 2Y9MB 1OI2A 2VQEB 1W4AA 5KZMB 2NAFA 4AW9A 3RJFA 4NSNA 3H3FA 3EZNA 3GLHE 4IIBA 1YDFA 3JASA 5DYIA 1ECGA 3FMOB 2XT6A 3BFPA 2FPKA 3Q6MA 3QTTA 3ZWBA 3NXKA 2NSDA 1O58A 3RAFC 3ZWDA 3AYXB 4MUFA 4F2GA 3LCUA 4BB6A 2XUKA 3W79A 1Z4LA 1HG0A 3ZKAA 1BVYF 4JLKA 2GNOA 3ZDCA 1VHWA 2OD2A 2V58A 3DA8A 2ZRNA 3WQBA 4ZU3A 3L0SA 4H7EA 1XNHA 3WHPA 3AQFA 3FTNA 3C2KA 1TVKA 4IS3A 2XA9A 4WJLA 3OX1A 4QVKA 4RF2A 1DO2A 3EQZA 1OV4A 3DLPX 4YRRA 2IF0A 3UCFA 2D5BA 2G9RA 5JLJA 1IUPA 1GD1O 3LT0A 3VR4H 3TAQA 1WXFA 2ZXFA 1M66A 1Y7LA 3FZYA 1U28A 5J0WA 2HO4A 5IANA 1VRWA 4HOYA 5J2TF 4GRIA 3GFGA 3EXEA 4EG5A 1WMBA 2EF1A 5ALSA 4B9SA 2P9CA 3HCFA 3H2GA 3ESCA 4NDZA 4FCWA 1K5HA 4EJ0A 2A9JA 2J67A 5KTMA 3EDMA 4MW7A 3U3ZA 1A9TA 5FI3A 1E2MA 2WJVA 3DTTA 4L8VA 4V3CA 3W2IA 1J5PA 4ED1A 1Z6GA 3I32A 2I6QA 2XOKD 3QLUA 1RBZA 3HILA 5DHPA 1J2MA 2OXEA 9ICUA 1I7NA 2X0JA 3KBOA 3PUWA 1U65A 4D0GA 2VDQB 3SHFA 1S10A 5IRCD 3ZHYA 1UUFA 3AG5A 4BTLA 2PSSA 3KPVA 3RRGA 3WGGA 1RI1A 1PG0A 3TUIC 2EKDA 2Q1UA 4BXOA 3A1DA 3OIWA 5CPFA 5AVUA 4G09A 1QQAA 1RG6A 3N4MB 1DPGA 1MXHA 4O25A 3ZYCA 2C54A 4M9ZA 3SMVA 2EF0A 2CEKA 2WP8J 3G3EA 2AFIE 3AQIA 4M60A 4F5DA 1FTQA 1NVMB 4GECA 4HI0E 4JJGA 3Q3HA 3RSZA 4DLLA 2E4WA 3KJZA 1CQJB 3G2IA 5AM4A 5EMLA 3ZHOA 3CINA 3H9EO 2CLSA 4RLFA 4LF6B 4B73A 4JWTA 1ZXIA 3JYNA 4DZTA 2NRTA 1BE1A 2BUCA 2JAQA 1NUSA 4ASUA 1ACLA 5B1IA 4EB0A 1V25A 2Y05A 4ZALA 5I9NA 4BO6A 3ECCA 1ST2A 5KIAA 3N7PD 3NNDA 2NUBA 1G0OA 2GK6A 1R27A 2XB4A 3ILHA 2V98A 4YN4A 4ISBA 4LJSA 5JZ9A 1UQTA 3GP3A 2H51A 2VUUA 4JK3A 1SC3A 1ZUIA 4WINA 5FIUA 2SKCA 4MV6A 4NF2A 5DNYB 2ZZNA 4XUDA 3SG0A 3NTXA 2LYHA 1WUIS 3KAQA 1V4VA 3OPMA 3DL0A 3H5TA 1K5OA 2NU8B 5GTDA 2CXHA 1BFKA 1Q95A 3PC4A 3L1KA 5JBIA 1TD9A 2AWNA 5DRTA 1E8NA 1Q0QA 2PVCA 2ZT8A 2Q2NA 5KFBA 1N0UA 2Q3EA 4DMFA 2ZJZA 1PTJA 5DT9A 1JBQA 2AEFA 3O03A 2JH8A 3OEWA 4LSMA 4RADA 3X1XA 1CY6A 1CIJA 4UNNA 1SUIA 5WRFA 1DKRA 2J7KA 2IQ5A 1VZ2A 2W2TA 3GGSA 3NAMA 1QO7A 2PG3A 3QFSA 3RJGA 2ODTX 3W5CA 1Q44A 2VJMB 3G89A 2B8NA 4MP3A 5AP9A 4ZV9A 2IS4A 4Z2YA 2AG1A 1CJKC 3H97A 2K2WA 1Z0IA 3UT0A 2E4YA 2Y1JA 4II3A 1S3SA 1MTOA 2GYYA 4J0JA 4N4AA 1EQ2A 4DMGA 4D9BA 1E1CB 1D6SA 1XMSA 5EC8A 4AX8A 3IN5A 4LJRA 4CTKA 4PTZA 2VPTA 5CURA 4O4LA 2ACVA 1N5LA 2Q5OA 1Z47A 1QG0A 5J8YA 2PFSA 3I9OA 4XUCA 5HJEA 3EEOA 1HX7A 1ZA1A 2CC2A 3FZGA 5A4IS 3QITA 4R8MA 5DYYA 3CX6A 2A6PA 3F6RA 3HJCA 4GZ6A 3BICA 4B3XA 2BM1A 3GV0A 3ILYA 5TIIA 1KDTA 3EVDA 3EZ2A 1TZBA 2P3QA 4BBAA 5J2UA 3F74A 4HTAA 4DF8A 3SYZA 4F5ZA 5EE9A 4NL9C 4D3XA 2ZYRA 4MKRA 4LV6A 1L4KA 3Q1KA 1P4SA 2JV3A 2YW2A 2Y93A 3I62A 3EIEA 1H2RS 2HA4A 3CUUA 2G9ZA 5D3MB 5E4JA 4DOBA 2PL3A 4NRDA 4QGFA 4RTKA 1URPA 1J4AA 4TYMA 4HXFB 2JIPA 3RAEC 4B3IA 5JJKA 3PWSA 5L3QB 1LLUA 1R6UA 4LZPA 5DBGA 1FDUA 1WPGA 4K9DA 5TX7A 3AI2A 3WISA 3L4EA 1D2MA 3R77A 5JT1A 4GI1A 4MCIA 3VR5D 2ZYWX 1OMOA 2PA3A 1DC6A 4CF7A 4YAFA 3QZUA 1ZR4A 5AM5A 2WF6A 4G07A 4HKTA 4OH1A 4G3IA 1E5QA 1MV8A 4IDNA 2QVXX 4C7XA 2HSEA 3QFCA 4E22A 2O8DA 1PS0A 4I36A 3PVCA 3SC6A 5ICEA 2WIAA 3IDQA 3FMFA 3T3OA 2JEJA 1D5WA 1PD1A 4GXTA 2IJGX 3ZE6A 1GFZA 1QBGA 2Q6OA 2VUIB 3PD7A 3T06B 2FMQA 2NTEA 3U61B 3OP4A 2W5UA 5AW0A 3LGSA 4H0FA 1SKWA 1BCSA 3JY6A 4U7PB 3V1LA 1CUIA 2MSCB 4PQYA 2H2AA 1GM5A 3RFCA 1ZM7A 3B1VA 2NV6A 1L5HB 1EVLA 4XYLA 1ADCA 2O0LA 4MSUA 1XV5A 1VB3A 4R68A 1QIKA 1DKMA 1X7GA 2XLCA 4FYHA 4ODIA 4RMHA 3RS0A 4BUCA 5JDIA 1Z4NA 2OXTA 3HBLA 5D7BA 5CITA 2M6SA 1ZX1A 1TC1A 2H5IA 4KLJA 1AUPA 1CZOA 2PLFA 4B87A 3C24A 3DBHA 4LGCA 4Y6GB 1EWVA 1LX7A 4Q9AA 3TMAA 3UFXA 3QLEA 2XSZA 2JAPA