2ZIXB

Crystal structure of the mus81-eme1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
322
structure length
259
Chain Sequence
ECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQESRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGETSRRIGPELSRRIYLQMTTLQPHLSLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Crossover junction endonuclease MUS81
total genus 21
structure length 259
sequence length 322
ec nomenclature ec 3.1.22.-:
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zixB03
3.40.50.11760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zixB02
3.40.1620.30 Alpha Beta 3-Layer(aba) Sandwich YefM-like fold YefM-like fold 2zixB01
2ZIVB 2ZIWB 4P0PB 2ZIUB 4P0QA 4P0QB 4P0PA 2ZIVA 2ZIUA 2ZIWA 2ZIXB 2ZIXA
chains in the Genus database with same CATH superfamily
2ECOA 1YI0A 1QIFA 2X42A 3E3LA 1M73E 5KFLA 1LBTA 1XO1A 1GNSA 2OCBA 3NVDA 4LDJA 3ZXIA 4JL5A 4OY3A 2VWPA 4HADA 3I8OA 2EP5A 1HLDA 2G9NA 2GGSA 3ZVRA 1TKCA 4PQYA 1HK7A 4B4VA 4EQ6B 1G98A 1XX6A 1JDPA 2ZI4A 4ZJUA 2PVCA 4QGGA 4EGJA 4LJ5A 3CR7A 2WJAA 5ECGC 5C1DA 3TM5A 4GGOA 4ERNA 3VKHA 2BN4A 5KFBA 2NU7B 3CKKA 5JD6A 4DYDA 1RMQA 3P71T 4YT8A 3VZCA 5FI1B 5EL0A 4ZO6A 2WB4A 1XQYA 2JVKA 3D4LA 4KLAA 1PT7A 3GO4A 3JQ7A 1F8GA 4JKIA 2IHTA 4CM4A 2BBTA 4GBMA 4ZO7A 1L8LA 3EVBA 5TEWA 4C6SA 2ATEA 4E12A 1ZOIA 4W5RA 2XBLA 2IUUA 3WKEA 2PZMA 4ZN6A 4MVYA 5CDFE 1JL3A 1N4DA 3GJTA 4PZYA 2OHFA 3LNCA 1JJIA 1YRLA 3Q98A 4RPGA 4MGZR 3TX2A 2XDYA 5HF5A 2XLCA 2FSPA 3CRZA 3IEXA 2AW5A 3FWNA 4G8CA 4B79A 2HHWA 1VJ5A 4ND6A 4YP5A 3REQA 1QXSA 2IZ6A 1NAIA 4FSXA 4AY2A 4NH0A 2QIPA 4HDAA 4MV0A 4X84A 1X1SA 4KIWA 2XCTB 5DX8A 5ALUA 2FPOA 2JFFA 3BWXA 5CA7A 5K3BA 2DUUA 3GGSA 1YVRA 5DGCA 1KZHA 1L6NA 1FC0A 3BRQA 4WRRA 4ZOCA 1IB6A 3DLPX 3FPAA 4J49A 1X7ZA 4MWZA 4IGAA 3THWB 4MW7A 1CEYA 3ABRB 5CA1A 1F2TB 2C4KA 4QGSA 4CDRA 1SOMA 4ZMSA 4DV3B 3OHSX 1QGOA 2O6KA 1A27A 4HNUA 3ESQA 1ZXIA 4NXZA 1N2CE 2JFZA 1YUNA 2JI7A 3L0OA 1CR0A 1Z9BA 3A1CA 1IWPB 1RZRD 4OXRA 3M6FA 2OV4A 4L2KC 3DAHA 3MOGA 1N48A 2GDJA 3VJMA 1PZMA 4TX1A 3FE2A 4N40A 2Q1YA 4YCDA 3CM0A 1O95D 5G3ZA 2WAOA 4O4JA 2V6FA 4KQXA 3FUTA 2QSJA 4O4HA 3QFSA 1A8QA 3FOZA 3B9JA 1FUEA 2EWVA 2QRUA 5DTMA 2UUCB 1C9NA 2DKFA 4WNAB 5JVDB 3WKDA 1TO2E 2QZJA 3VU9B 4F1WA 4BO3A 4KQ9A 4J2TA 3ZK8A 2H1LA 3W5SA 9ICSA 4A2PA 4AJHA 1OH7A 5C3MA 4WI1A 1ACJA 2H2GA 3U1VA 5BVGB 4DF4A 2ZBQA 4OHZA 3VO2A 4CGYA 4TQRA 5HDBB 1W25A 4U2BA 4FGSA 1E4VA 3D6FA 2GZHA 5AWFC 4KK3A 2CPRA 2WZDA 2BGJA 3HKCA 3NLLA 4AECA 3GELA 1QUEA 4IWNA 4W1QA 4OHYA 1KQOA 2Z2KA 4HWTA 2JLBA 2ATXA 4ERXA 1AZWA 4IR7A 1XCLA 3FZEA 3EIEA 1JHOA 4HH1A 4K03A 3NKVA 3N9IA 4IJUA 5BSFA 2QBYA 2R6AA 5F51A 4WW0A 3IE0A 3FYTA 2KG5A 3QPBA 1IULA 1R8SA 2I0FA 4HNHA 2AR9A 4JELA 5DBEX 2BI7A 4B2YA 5BUCA 2ZB7A 4BQPA 3O4HA 4KN5A 5I7OA 2FW9A 3KEMA 3HHPA 4CF5A 3NHAA 1XZDA 4IIXA 4TT8A 4XUGB 2BR3A 4FGZA 2HCRA 5KTYA 3FTCA 4O3FA 1EVJA 5CDSA 4TKLA 4YK7A 5GP1A 3RF9A 1OREA 3H5VA 2WJGA 3HGQA 2WYUA 1ITZA 1R0SA 2DRIA 1ZWKA 3V8NA 2JAHA 4UREA 1FCJA 4R2LA 3OF3A 2G70A 1V43A 5LQMA 1P4AA 3C7AA 2LUOA 3FZQA 2ANCA 4RGBA 5DBFA 4F4HA 1M1YE 8GPBA 2GRJA 3DOIA 4EARA 1XRMA 3A58B 4KQJA 2PZKA 3HFGA 2ZJ2A 2BR5A 1W96A 2H65A 1JPNA 2J4DA 2J5XA 2IIBA 5KU7A 1HDXA 1M6VB 1OKKD 5JS2A 2Q3HA 4DJJA 1D6NA 1D0SA 4NXMB 2C8VA 4I2IA 1C1DA 1ZU5A 2CGEA 2NOAA 1EAYA 4TM7A 1R10A 2YHSA 1AKWA 1T0BA 3K09A 1PCXA 4M60A 1W19A 3Q41A 2QRVA 3DW1X 1AROP 4OTZA 3UAWA 3VC1A 3W3AD 5A0LA 2WKQA 4HB4A 2XIQA 1E5DA 4DXHA 3HRKA 4Y9TA 3QUAA 2C0PA 2WF9A 2DY0A 1EP2B 3OBBA 4FS8A 2ZJYA 3X1JA 5IZ4A 3NDBB 3F2CA 2Z30A 5K8CA 1EP3B 1I94B 2DFVA 2XB2A 1JZQA 1DAGA 8ICQA 3E7WA 2OXTA 3E2IA 2B9EA 1M66A 4PG7A 2I3DA 2Q5JA 3H05A 4Q0MA 1ZQNA 3CB2A 5D2CA 3CVXA 1EWYA 2HEGA 4KUGA 4DTCA 3IBSA 2UZ3A 1X13A 2PH5A 2CLLB 3V6LA 1LDYA 1C9EA 4NZNA 3UATA 2EAUA 3V48A 2V5AA 3WGKA 1H3EA 4M88A 4N5IX 1VA4A 4GMFA 4LRTB 4P32A 4EMBA 3GLIA 1G19A 1W9MA 3B7GA 3GJ3A 3PNQA 2PYDA 5EMHA 4Z4QA 3WRXC 3LP8A 3BE8A 3ROQA 2F48A 2HK7A 3CF6R 2Y76A 3QFCA 4YIKA 4ELTA 1R64A 4GKJB 1KKLA 1P2TA 1U2GC 5B7PA 1S4QA 1KN5A 1G5RA 2W2LA 3K5HA 3LLCA 3EOAI 4S1WA 5ILQA 3WYDA 4I8DA 5K2MA 4B2LA 1OJ7A 2AW3A 421PA 2OHVA 3LIPA 1REQB 2IL1A 2J6SA 1SQSA 3L1HA 3PC8A 4QDZA 2F9LA 4QASA 1FZQA 5JNRA 2ZIXA 3FUVA 1BE6A 4URFA 3VR3A 1NW7A 5IEJA 4YR2A 4OHBA 1T9BA 2ZR9A 4UUMA 1C9JA 5FHRA 5I45A 4KXQA 4A8TA 4E31A 1EUDA 2GILA 1D8BA 2H1SA 3LE8A 3CH4B 5BW5A 2GPTA 2JFYA 1U3TA 3N8HA 4FS3A 5MN5A 1S02A 4EPXA 1B6GA 5SY9A 1Z00B 4F3NA 1CEZA 1OLXB 3GHYA 2YWFA 3TQ1A 2L42A 1YDFA 5JI2E 3SWWA 2R5WA 2XRZA 4HFRA 2FXVA 4W63A 4Q44A 1PI3A 1I2AA 2J3HA 1L5FA 4B31A 4AUNA 5HVNA 3RC8A 1RI2A 2AG5A 3VDRA 2WHPB 4IEEA 5KOJB 2CMDA 2IOYA 4K9DA 2A59A 2VAVA 1L5OA 4LC1A 4ZJZA 3R5XA 2QTBA 3LT0A 1H5NA 2C5LA 3AIOA 1NLUA 2X4GA 3MGAA 3RYIB 1BW9B 2ZDHA 3INTA 1ZFNA 2XKBA 1UA0A 3F71A 3GIWA 1J24A 4QYWA 4V39A 5A4IS 4F9GA 6NULA 4GXJA 4ER3A 2XE6A 1JIIA 1RIIA 4OYLA 2OQ2A 5GINE 4DSLA 2QRQA 1PLJA 2HXGA 3HCNA 4KDEA 1AHIA 4JB8A 5BWNA 3H4MA 2OHXA 3E9DA 4O29A 4FFVA 5CU7A 5CEFA 3M34A 4JR1A 2HLDD 3FYHA 1MC1A 4RNOA 1IVYA 1NNI1 2FN9A 3RFTA 1PQPA 2GAAA 4J9OA 1QO0A 3IX7A 2BTOA 4DSTA 1Z5OA 4RC9A 5HR7A 5KKAA 3M89A 3EA5A 4KLOA 1FA9A 3D81A 4P36A 2JIOA 5FUBA 4BKQA 2GPJA 1AXEA 1N1EA 5FWDA 3JYOA 3JVVA 1GTG1 5H2FU 3DMNA 4KZPA 4PLHA 3SG0A 3WHIA 2PA3A 1RRFA 1YHYA 4JJAA 1J9GA 3LXMA 4BAGA 1NJSA 3VA7A 3HU5A 4PS0A 3G1TA 1K97A 3WLNA 2BZGA 4O3MA 1KRWA 3PWZA 5CM9C 1AKMA 2XGGA 1FMFA 3N28A 2X15A 1YE5A 1NXSA 3GJ0A 2C7BA 3UHFA 1IQPA 4N0EA 1E5VA 1XRNA 4OQFA 5TF0A 4PHCA 2O7RA 3O31A 4RGVA 4EG4A 2B1GA 4OUKX 4L9WA 1OBCA 2CLEB 4XTRA 3R8FA 1O0CA 1IB0A 1PR5A 1W93A 3W2FA 1C0EA 2B98A 2QPAA 1AF4A 4FLFA 2IOQA 2I4TA 4TM8A 2P9TA 3SE7A 4R83A 3HL0A 1SVLA 4R31A 3F4BA 4KJXA 1YZNA 1H4TA 1YWGO 2WFAA 1P4RA 3C8ZA 3QWIA 4C43A 5K99A 1EIWA 4YXWA 1M2HA 3UG6A 2NVWA 4OFBA 3OJOA 5J59A 1Y7PA 3ZHVA 4LYFA 4LZDA 1YOVA 3QVVA 4MINA 4MHSA 1JU3A 4U6NA 4IXTA 2FPXA 3T1OA 1ZQDA 3G23A 3I2GA 3AZQA 4LGYA 5E95A 5L1LA 1NWHA 1ZH2A 2CNWA 1GT91 1ZK3A 1KZGB 2Q45A 2ZIFA 4FLEA 5CJJA 2ZJ0A 5IEBA 2GVZC 4TTTS 3AKDA 5FQOA 2NTJA 3YASA 1SL1A 4RA9B 3LI2A 3L7KA 4PFKA 1I7NA 3A0UA 3PYLA 2DR0A 4BJ6A 2X86A 4URZR 4NBUA 2ZRQA 2B21A 1KYXA 2KEYA 4YMVA 3AUKA 4Y6QA 5GJVC 4ALNA 3FOFC 3PDUA 2JJ1A 4KDFA 2R2GA 5EPEA 1RYSA 3LFUA 2DAPA 2YHUA 1G60A 3FRIA 4YV7A 1T9KA 3HILA 2R87A 2VHVA 4OBBA 3S6JA 3A3KA 4HGOA 3PXXA 4GOKA 4IIBA 3BQTA 2WZQA 4RE6A 4LBYA 4JI1B 1NUTA 1UBEA 5IKPA 5JQGB 4DV2B 1HNWB 3SM3A 2DKNA 4PR3A 4UOZA 4KI0A 4QFDA 2HA2A 4QT4A 2LDBA 3ZN2A 1OX4B 2NU9A 2BELA 2PN1A 1PUIA 4D8XA 1ZGJA 3LCMA 1CQIB 2GN4A 3B9PA 2QN2A 1OH8A 3V6HA 1BVHA 1YDHA 3JATB 1SC9A 4BNUA 4HB3A 4AG5A 4DR2B 1TAUA 1OI7A 1X8JA 1YGPA 3C8HA 3Q40A 5JXHA 4RE5A 4CIDA 2WAQF 1RXSA 3ZD6A 2BP7A 1BOFA 4JP3A 5KYKA 2YCLA 1KMNA 1TUIA 1DXSA 8ICUA 1FTWA 1LLDA 2IZ5A 3FA2A 2JD2A 3NATA 4QOHA 4UD2A 3JAKA 4UM7A 4E7OA 4RY8A 2OL4A 2AQKA 1PS0A 2OBBA 4ZCLA 3OHMA 2AQIA 3UM9A 2GNPA 2HPHA 1PT6A 4UU0A 3AVXA 1ZCAA 2E1RA 1TNDA 4MLCA 1KMIY 1YB1A 2EZUA 4ZZ3A 1LQUA 3E5NA 3B36A 3BOSA 1RE0A 3VYUB 1K08A 1ZVQA 2Z95A 4H1HA 4Y2GA 1EGQA 1FVOA 3G82C 3HHEA 4KH0A 1CY4A 4K8OA 3NRCA 5JR3A 1QC5B 4D43A 1VYHA 4CIVA 5AYVA 1EK2A 4CLDA 2GFIA 4MO9A 1EDOA 4OHMA 5DBHX 4JBNA 3AUUA 2YZKA 4MUGA 2Y6VA 4CV3A 1BQEA 4NMHA 4NDNE 1E2GA 1YZHA 3OTWA 4Z7JA 3BWMA 1QB8A 1XEFA 5AIBA 3FWYA 4WXEA 3PEYA 1U65A 2WTBA 3NXKA 2BI8A 2W22A 4N39A 1W4LA 2W9CB 4WZAB 1DO2A 1CR4A 1BEEA 4Y30A 1MC5A 2HA3A 1Z47A 3NNSA 3CUUA 2BF4A 3U7QA 4F2SA 1JAZA 3DLBA 5DGAA 2L2QA 3TBFA 3V7YA 1GKIA 1WCIA 3NGXA 1L8XA 5HFAA 4DLTA 3W6OA 4HWKA 2NTVA 3LECA 1VYVA 3SV4A 3EULA 6REQA 1W87A 1V9SA 1Y3HA 5I6DA 4LZZA 4B9VA 4PNZA 5CHGA 3WYGA 2CUNA 1JDUA 1U1EA 1XA0A 5C1IA 4CTMA 3GRFA 1M8FA 2FG7C 4CM9A 1R3UA 3T41A 2H7YA 4B40A 1IN6A 1U9IA 2EWWA 3DL0A 3GZNB 4GR5A 2NLOA 5J58A 3BMQB 4C14A 5INTA 1D2AA 1GU0A 3KP1A 3OJCA 3JR7A 2W58A 1W5SA 1E2JA 4IL6U 1VIDA 1KR5A 2H11A 5C4GB 2XY4A 4HTFA 1LKYB 3RJ9A 4BYGA 5CXUA 4DRXB 2H4JA 3OX1A 3RS3A 4H59A 2NU8A 4OK6A 4RGQA 4Z2AA 1XDDA 2P78A 3ETLA 1V9CA 1SCUB 2CXOA 4I1YA 4X66B 4LHEA 3FNHA 2CZQA 4QZEA 1CDEA 1FFWA 2D0OB 4FM9A 2PLNA 2IDZA 1N2OA 4D96A 3GUHA 2WT4A 1LTKA 1RI5A 3S5UA 4C0JA 2CC2A 1VSBA 4CG3A 4HUJA 5KKCA 1DC5A 2QD3A 5T67A 3I1YA 1Z45A 2IYNA 2BM0A 3HBNA 2XGPA 1DBSA 4J4BA 4HS4A 4B34A 4NQZA 1PT5A 1CUAA 2PXXA 1KAHA 4HMPA 3KWMA 2VDMB 5IPFA 5ELXA 5TIIA 1MQ3A 3KR9A 3O83A 3PNSA 3WLKX 4XKJA 4FJ0A 5T57A 1XPUA 3HLKA 1Q2XA 3TGPA 4KXXA 3FHTA 1P29A 4WLNA 4DCSA 3GEGA 2OO7A 1I7SB 2ZYRA 2EYUA 4PM4A 3I5AA 1PUZA 4E5VA 4LK3A 4OQYA 1G0NA 3NHYA 2EAMA 1DB3A 5CDFA 1NW9B 5U4XA 5MHTA 4C6TB 1MFZA 4V0ME 4ZEOA 4K0KB 1A97A 4MPDA 2BDEA 5HHHA 5AM3A 3COWA 1GTL1 3L7BA 2XT0A 4RLSA 1KRXA 3E2MA 3UW3A 2JAXA 4OHVA 1KJJA 2BSQA 4C22A 4GW3A 2O8DB 1NBEA 2P6OA 4CTNA 3TK1A 2W8BA 4ZJYA 5DG8A 1BVUA 1P5RA 3WWPA 4DKXA 3NBAA 1UK6A 4ITRC 3KPYA 4YEDA 3Q7PA 5EJAA 3GIIA 1SR8A 2JRLA 4JUDX 4P7KA 5DXAA 5CCBA 3HS3A 1TVCA 2DX7A 3QIVA 4UB8U 5J5VA 3UJ3X 3H5WA 3KJQA 1U0LA 5TXGA 3TINA 3NEAA 3NBYC 4R5HA 1R8XA 1JQKA 3CH6A 4ZZ2A 4B8YA 3D6AA 1D4ZA 3CG4A 3NU1A 3IVGA 4WBXC 5EPOA 4EABA 4UI5C 4US9A 4JBWA 1EH5A 1XLVA 1QTNA 1SM4A 4G24A 1L5QA 2YFYA 3A3PA 2P41A 3KVVA 4HH4A 2EQYA 4LJ8A 2C1EA 5A2GA 2GCOA 1Z1BA 4P83A 1KYYA 3CLUD 5BMOA 5ECDA 3IN5A 2IP2A 5I5GA 1US8A 1Q0LA 1G8FA 1TB4A 3MCTA 5HM6A 4UUAA 3ACBA 2J0SA 1CUEA 4PNPA 1IUNA 1IHOA 3FGZA 3R0XA 4X8OA 4BVHA 3WGNA 1QLJA 2JLYA 1D03A 3G89A 5LNK1 4WNYA 4XQEA 2ZTHA 5E38A 3R75A 2WFZA 3V8QA 4ALIA 3FKQA 3EEYA 5FPSA 4CFYA 2JL1A 3PJRA 1EQUA 1RP7A 2QVCA 3KALA 5EVJA 4OV6B 1ZH8A 1QCKA 4IX1A 3TXXA 2IWRA 1II9A 1R9JA 8ICPA 5I7FA 4BWVA 4XRHA 4CR7A 8ICGA 5CRIA 1BVRA 5B3LA 2VYND 3JVIA 3D3WB 3GLHB 1TF7A 3DO5A 4MRAA 5FLXA 1PT8A 1Y9ZA 1ODKA 2PUHA 3AESB 3CRMA 3FPGA 5IWCA 2EZZA 1VE7A 4NNPA 1GG8A 1XAJA 4OSOA 4YGXB 3TUZC 1NW3A 1AKQA 3VYSB 5DISB 3PNVA 4PYMA 2F8MA 2Y8EA 4IZHA 5CLHA 1C0LA 3PF9A 2RBEA 1VCNA 3MCZA 2PX2A 2PZFA 3T4XA 4AYBC 2YMPA 4HUQB 1WCYA 1KDTA 4B4OA 2W42A 4CEHA 1L4LA 1TO1E 1QK4A 4J9NA 2DMRA 2J9FA 1PIWA 2IXGA 2VYVA 1TK2A 3RSCA 1JEQA 1RRPA 4X1YA 3U3KA 3G1WA 4CIXA 1IZYA 1S9DA 3PKZA 4KQ6A 1S2LA 4YRJA 4UFNA 1MX1A 1KE1A 4Q8EA 3M8KA 5HIJA 3UQZA 5JJCA 2OQRA 2EG9A 4TLCA 5AW5A 5TVGA 4YUAA 5EQFA 2AE1A 4XSVA 1IEVA 2E1FA 2IUYA 1KLNA 1Y8QA 1KFDA 2FJ6A 1YA4A 2X5KO 3JQAA 4NXNB 2V65A 3KWJA 3JQPA 4HH3C 5ITSA 2NQ2C 1U31A 1PJBA 2XMRA 3WHKA 2OILA 2F44A 2W8KA 3IAFA 1BPZA 2I87A 4U3JA 2QGZA 2COEA 3DDOA 3NB0A 1P1KA 1XZJA 4HRXA 4DL3A 1J4AA 1V26A 4PYOA 4FNMA 1AQUA 1SURA 4C80A 4EGCB 5SY6A 2YN2A 1T2UA 3OGUA 1YQ9A 1Z4QA 4TXJA 1DKPA 5KJCA 1A98A 2QL5A 4YG2A 1B00A 3FVQA 1XTPA 4AUKA 1XMJA 5HSGA 3ROEA 4OHUA 1D07A 4N7RA 4LW8A 4RK6A 4QA9A 1BDJA 1XCPA 4I14A 4TWJA 5AOCA 3MUFA 1F4VA 4MS1B 1RWPA 1SVUA 4GMHA 2XTZA 4QJFB 1CK4A 5EKUA 2IODA 2GZSA 1HDOA 2DFKB 2QNRA 3FR7A 1YO6A 5ARDA 4EI8A 5TLSA 4PQGA 1FLAA 3VSEA 1M2JA 1M5RA 1XNRB 3A6HA 5FOWA 1FUYB 4FO6A 4JSRA 2ZETA 4N0QA 3OQJA 3RBAA 3K9NA 2ENUA 2E8OA 4XDGA 3VTFA 5I8WA 3BMXA 5KFUA 4D9BA 1N78A 1KTQA 3EXIA 3ZBQA 3IC5A 3UV6A 1TQ4A 3ILSA 2CVHA 1XKQA 3NANA 1J0XO 2J9RA 4JP2A 3WXBA 5AFSA 5JIBA 1MGPA 3PEFA 5FCDA 1GTSA 3VNVA 5EIBD 2KJ8A 1SMKA 3VPHA 2ZKLA 1CNMA 2ZTEA 4XASA 3VTKA 3DBRA 5DH9A 3BGVA 2BFAA 3UMFA 1TAQA 1Z39A 3T3EA 1RRCA 1DIAA 1CEQA 1GNPA 2GK4A 2RH9B 4FOSA 5JANA 1GL3A 5LQCA 4QBTA 4MP8A 4PAOA 4EZBA 3IILA 3FAZA 1A71A 1GA4A 1B2RA 2NXJA 1NMXA 4YT5A 2I22A 2D62A 3O3CA 4KR9A 4DV0B 3N2ZB 4LDAA 1B26A 4ZVUA 3RAPR 4GM0A 4UHDA 3RJTA 2PCLA 4ZOQI 2IXEA 1U9ZA 4HDQB 3K4HA 4B84A 4XVCA 3Q9LA 2KSOB 1SUCA 4JX8A 4V0SA 2K2QB 5MN6A 3ABOB 4DABA 2RI0A 3ONWA 3RVNA 5IM4F 4L2IA 3UB4A 2V1XA 3MWKA 2I65A 4IW3B 4RQAA 4Q1FA 1KSJA 1J06A 2VJYA 5HKLA 4G41A 1QG0A 4ZIRB 2AG6A 2J59A 3LYAA 1UC4B 1EK1A 3KZNA 1VJ0A 4KK4A 4KLRA 4CQLB 4IQ0A 5JISA 5L40A 1SZJG 2P7HA 3QXGA 5KWSA 2R4UA 3N05A 3VPGA 5CT5A 2AHOA 5CCDA 4U6PA 5D3QA 4EM6A 6CHYA 5LMUB 1S7CA 2PUEA 1N8TA 1BZYA 1UXOA 3SAGA 5GTIU 2IY8A 3NWPA 2OQIA 1W85B 1A04A 4X7BA 2VTKA 2QB0B 5TQJA 2X4DA 2WOJA 3VSAA 2OV6A 4M8IA 2HUPA 3A4YA 3GYGA 3K15A 2PKYX 1V1MB 2YB1A 1P6UA 1TCBA 2ZJ7A 5JYBA 3VPCA 1ZCZA 1TDJA 5FORA 1W73A 1SBIA 1KI7A 3BSFA 1IK4A 3NDPA 2C97A 3OCWA 1BGVA 3LF1A 4IRXA 2XOKD 4BJ5A 3ZUGA 4DFDA 1J2RA 4CR8A 2D8AA 2O7VA 3KL2A 5J2CA 1HZZA 2ACEA 3CYMA 1XCMA 5JSZA 1O9HA 2C2OA 5KSOA 1OH5A 3VKGA 2P9YA 5HR6A 4C06A 1B8VA 4MA0A 1X9SA 2R62A 4LE0A 2PUJA 4RL4A 3T5PA 4JV1A 1NK0A 1H0SA 2OGSA 4NZYA 3UHOA 1YD7A 1DBIA 1TI7A 2WPNA 3TAPA 4WKPA 5KTRA 3EDOA 2V45A 3WLAA 1QQ6A 3N2IA 1E92A 4YJ3A 1A8UA 1KI9A 1PNVA 1F5NA 1N9KA 2G7MC 3FDJA 3HM2A 3PX2A 4OMDA 4V0NA 4ZPJA 3TFQA 5JO9A 3ZWVA 3V4SA 3IURA 3ZBPA 4LZAA 5JY6A 3EMVA 5PNTA 9ICQA 2NSDA 2VZ0A 3EMKA 3SHFA 1FSSA 3WDKA 1E1DA 4MUJA 1Y89A 1R4MB 2ONKA 5CA0A 3THXA 4M76B 2VCEA 4YVZA 3PVXA 2WIDA 3RFXA 3W5DA 4K05A 2CXYA 1NR7A 3ICCA 5JYEA 4GZLA 4YBZA 2PX5A 3D02A 1JVBA 1Y98A 3UQ0A 1KSHA 4R8LA 4UVHA 1Y3DE 1RCTE 1VHLA 5A05A 3C28A 4FFPA 4FOTA 4URVR 2R0QC 1A5BB 3RRMA 1I1NA 2YY7A 4KNWA 4WJ3B 4BMNA 4JJEA 5IT5A 1H2EA 2H5EA 4JN6B 5AKGA 3HBFA 2XT9A 2NQTA 4EY8A 2AD1A 2HHJA 4RQ2A 5JFOA 3GRCA 3HPOA 2NTYC 4KLJA 1MN6A 1CVIA 3H0EA 4HN2A 1FY2A 3I2JA 1QF9A 4OKSA 2Y1JA 3MLEA 4NLNA 4RENA 2FLWA 2O57A 5F3WB 3T5LA 3LHFA 3JARA 1GQ2A 5GV8A 3LQ1A 1RLJA 1PFYA 3HKCB 4U5XA 3DXZA 2C84A 1LBIA 4NZZA 4TMZA 4CCHA 3OX3A 2J8ZA 1MB2A 5CHEA 4D4JA 1RXWA 4MAMA 1DO0A 1TT7A 1KBOA 1QNLA 2FF5A 4Q3KA 5EN4A 1KORA 1ZO8A 3RRJA 5THKA 4BNWA 3SSAA 5CX1A 3HJ6A 1MIHA 1DKNA 4BVBA 2WUWE 1M2KA 3EZ7A 4QOJA 2H5JA 4PZEA 2AQ4A 2GDZA 3GRUA 1L5ZA 3O8NA 4R05A 1RRKA 1PGQA 6AT1A 1ZA1A 5EUMA 4DA0A 1E1NA 2TECE 3W4KA 4ZQFA 1YRAA 1PP4A 2EATA 3IOMA 2I3GA 5BN3B 5I9LA 4E5PA 2W2LD 4UUPA 1UFKA 3IXMA 4BQEA 2G5PA 1ZHOA 4GX0A 2RMKA 1K89A 1KZ7B 3EJWA 4FFRA 4Q3DA 1WXIA 3QTBA 4X0EA 1ZONA 5F12A 3ZIUA 4QZHA 1KVQA 4DQIA 1DG3A 4V1CI 4RS4A 1CJBA 3GVCA 1RZTA 2G88A 5E9WA 1Q8KA 3KHGA 1VLVA 5CW1A 5KU1A 1RYRA 4I50B 1XXLA 3LBIA 4F93B 1TO6A 3AY6A 3NONA 4JNKA 4RD3A 5ANRB 5CLFA 3O5AA 1ZUIA 2ESRA 3AR9A 4TL7A 3I9MA 1KEJA 2IE0A 4N8DA 5D7NA 5A9RA 1DT3A 1ZD5A 1J23A 2FEAA 4ZEMA 3IO3A 2OO5A 1TM2A 1P2VA 1JQ3A 4IIDA 5DASA 1AXRA 4AZ0B 2O9JA 1E3WA 1V2GA 1Z73A 3BJIC 3OPYI 5DTQA 3CE9A 1ZGAA 5FTNA 6ABPA 2HOIA 3JZIA 2LNDA 1JA1A 2EZXA 1PD1A 1BROA 1Y9AA 2YIMA 2QRHA 1A9PA 3GVIA 3WB2A 3MR6A 3AEZA 3QSYA 1I36A 3GG2A 2GZRA 2GZ3A 2ZVJA 1YS7A 2ODTX 5G2OA 4J1NA 3VR0A 5KNDH 4EENA 3ZHBA 1CUDA 1CX9B 5K7SA 3ACDA 2WNHA 4M0CA 3PE6A 2D00A 3PZBA 1RAAA 2I33A 2QZZA 2WSLA 3GJQA 5GONA 5J2TF 2HJGA 5FAXA 5J43A 3S40A 2NNWB 3DC2A 1PNOA 1QHNA 5JNWA 3ZDRA 2V7EA 4QHYA 5DCUA 4YMLA 4UI7C 4TMFA 4HYTA 4ZI5A 4J0GA 3RDPA 4H9GA 4GR9A 3TEFA 1I7DA 5EJ6A 3IR5A 2C00A 3RV4A 4N9QA 4R66A 1W0JD 1C1DB 2I4NA 2OEHA 3NXSA 2ALZA 8ICLA 3OQMA 1TJ5A 1VM6A 3ZX4A 3ZQJA 5KX5B 2X7HA 4S1OA 1YCHA 4QPJC 1BPBA 1S76D 1WPRA 3WNVA 1XXHB 2O7NA 3Q2IA 3BZBA 5LB4A 1LQ2A 3N07A 1TF2A 3GEHA 3FSEA 2R6GA 3PVSA 3BJMA 1DK2A 3HY3A 4FOLA 5CLGA 2ZI6A 3LCUA 5EG5A 4L0IC 5CX1B 3LGXA 5CLQA 3SSMA 3TLXA 1GR1A 4Q24A 5JZVA 2D59A 4G5XA 2RCYA 2TS1A 3E48A 3JALA 4R8KA 4BO1A 2J87A 3MJ4A 4E09A 2HOQA 2HV8A 4ZM2A 4A82A 1BHQ1 4HV4A 5CWRA 4BTVA 4DDUA 2JCVA 2RLTA 1JAYA 1XNGA 5EJIA 1XNQB 3VM6A 3FZNA 1P1IA 3HZHA 3MIIA 4G5OA 3P0RA 2WKRA 3EEBA 1ORVA 3ZV5A 1ICIA 4OGFA 1FYFA 1ZJYA 2CNBA 2YR0A 3N0XA 3GNSA 4GSKA 4NF2A 3GLIE 5LMNB 2IU6A 4J7AA 1WBDA 2ZP1A 4Q9IA 2YJGA 4Y2QA 1LPSA 1YZQA 4NV3A 4YAKA 1KL9A 1XTBA 2QRPA 1UC8A 1ONPA 4I55F 1I9GA 4MW0A 4DRXA 4MAFA 1O4WA 4YAJA 2QYSA 1THGA 3TQQA 4NM1A 1EIZA 1RQRA 1XJCA 2IYRA 3FNIA 3CBQA 3Q5EA 4LJ9A 4B6PA 6PFKA 1LSSA 1N1GA 2RAVA 2XUQA 3ENKA 4UCXA 9ICBA 3MIZA 1GZ6A 3EHDA 4GPIB 3BXOA 4B6OA 1EHIA 5J2UB 2JF0A 4D4MA 2XYGA 1LPBB 1ZGHA 1PGOA 3BJEA 3LVBA 4DB2A 5HJ2A 4S1PA 1OUMA 2YXLA 4BATA 4ZYZA 4DR6B 4C30A 3QHQA 4W1PA 1NQOA 1PQYA 1E1KA 2GARA 1JSCA 2CFTA 3KPUA 1EXNA 1GGJA 4TQUS 1WKVA 2HF2A 4LJSA 2D4AA 4B0PA 5L51A 4AULA 2GEKA 2NV2B 4R0VA 1ID8A 4JBHA 3OFVA 2FEWB 3U9TA 3QUBA 3L1JA 3AHCA 4Y2RA 2OUIA 3BKXA 1B43A 4HATA 1ISHA 3GMDA 4KW7A 3PGLA 2YOHA 4OK5A 1E6EA 1U8AA 3GRKA 4JENA 1XMIA 4N54A 3EC2A 2R6DA 2RRDA 3GJ8A 2D1QA 1EFHA 1PRYA 2GEUA 4KPGA 1TEVA 4FGKA 1S3SA 2HTFA 2ZCUA 2JHGA 4N3GA 4CE6A 1ONNA 3B52X 4UNIA 4YC7A 4IQUA 2PMBA 1LV5A 3K0SA 2OXEA 4FD2A 1NW5A 4GRDA 2DXIA 1C8VB 5AXAA 3CZ9A 2JASA 2VS1A 4ZXFA 3Q3HA 3RNOA 1L1FA 1RS0A 1OJLA 1D2HA 4TSFA 2QP4A 2BHTA 4K46A 1PG2A 1P45A 1F1BA 4ARZA 1P7VA 4WACA 1I8TA 4JBIA 1ZR4A 3NVZA 4IX9A 1W88A 3KOXA 4KJZA 3PXGA 4MW6A 2LVBA 2GZMA 2RDMA 2VRCA 3E27A 3OECA 4IILA 3LL4A 3C7TA 3BF7A 5IK2D 4ISBA 1C7RA 1VJ1A 3DYBA 5I9SA 4CIYA 1JR2A 2JIMA 4BX9C 2XB6A 5LZ7A 4XE5A 3GCWA 5BXYA 1Z4NA 1HDZA 3BQ7A 4W1SA 4OBWA 5EIWA 1JILA 3EXFB 4X60A 3H16A 3WB9A 1UMDB 2W90A 4JQYA 1HE1C 3EH2A 4M0AA 4FSDA 1WABA 3PC7A 3VOBA 5LWQA 2BGTA 4I50F 4EUSA 4F2RA 4H6PA 3F5AA 4P4LA 5J9FA 2AN5A 4B7ZA 1PV4A 1UPHA 4Y2HA 2CLOB 4G36A 5CH8A 1L4FA 1ZN8A 4FCVA 4ZU3A 2J3KA 3WGGA 3EXAA 1JR3E 1UBHS 1OT3A 3MTAA 5FO0A 5FTJA 4H3KB 4BJHB 5JUWA 1T5OA 1QH8B 2Q1TA 3VBCA 4XYLA 5A5VA 4LFBB 2QUHA 2F62A 4RA6B 4BAZA 3ZD7A 3COPA 3TCKA 2NXCA 2CVFA 3SKXA 4OH7A 1KY4A 2WZCA 3GV7B 2PT6A 4PCAA 5CPBA 3TZKA 4DMLA 7ICLA 1OLOA 4TS1A 5LYYA 2NO0A 2COKA 3F7NA 3MWDA 4YRMA 2R44A 4PYLA 4AK9A 1TCUA 1DQZA 3D43A 5BNZA 1DIBA 2GJ4A 2RKOA 2HQOA 2WYHA 4MKGA 2FPSA 2I3ZA 4PSDA 9ICWA 2KN7A 1L9KA 2F3TA 3DBRB 4QODA 4XX1A 3S29A 5LR6A 4POOA 3AY3A 3DXXA 2I3BA 4NE2A 1U8XX 3VPXA 4FMBB 2EOAA 3F96A 3PTAA 4GC5A 4DJDC 3QKIA 1EUYA 3EVGA 2FFJA 3IAM1 4F5WA 2E4ZA 1R27A 4OLJA 1JJFA 2CD7A 1Z8NA 4L0QA 2OQVA 3KT6A 4RTMA 2A5DA 2ZBRA 1YUMA 3L01A 3MWJA 3LT1A 1FPQA 1STOA 3PUZA 1SL2A 1DIGA 4KWIA 3T5MA 5JAZA 4X62B 2CLMB 1T6YA 4WXYB 5FUWA 1H42A 2Q9AA 2ZTLA 4U7PB 1QV9A 2F1RA 4DSJA 3LKZA 4CCAA 3G5OA 2G5TA 3VHXB 4YXWD 1SQ5A 3OPXA 3C2MA 2IDJA 3VSDA 4F9EA 1ZQJA 1CY6A 2B20A 4KIUA 4WNIA 2GBIA 5K6RA 3LUGA 3SF8A 1X94A 4QO7A 3AQFA 3CRXA 3ZU2A 3L6BA 1E9AA 3ZY2A 1H2WA 2YHIB 1P1JA 4NDAA 3JTEA 1GPJA 4RHCA 1LBSA 1SVIA 2C7VA 1NVKA 4JGBA 4C4ZA 1H4QA 4QZAA 4YRQA 3HN2A 1BC5A 2D2VA 3FMPB 3VBEA 4B9UA 3CT6A 9ICGA 3P2EA 3KSZO 1SKQA 3NS7A 1KQFA 1GGNA 1P2DA 3WLSA 3R9KA 1MH1A 4RTSA 5IIMA 1I4TD 2PMWB 5AXDA 1M0SA 4H15A 1D9XA 1DBRA 3KD3A 1LLUA 1JECA 4HDKB 4DR1B 2ZYIA 4J9VA 4N5LA 1YULA 2RGNC 1A4IA 2DPIA 2PTHA 1MUUA 3NGMA 4H7EA 5JWOA 1V3QE 1UAAA 2BKUA 2FZ4A 5BOVA 1SIBE 1D04A 1QORA 2XQJA 2Q7DA 2X5NA 3WWDA 3ZJTA 1GLVA 2PTGA 1P4JA 5K09A 4GWKA 2ZJ1A 3L46A 3D2LA 1AGRA 4N6OA 1CUFA 4R2JA 4RPHA 3BH7A 1U81A 5IM4A 1AV6A 3RF7A 3ILXA 3M83A 4PG5A 4QXPA 5EEHA 3MJSA 3D2AA 2ON6A 3BCSA 3P1JA 5JPIA 3B1VA 1UOQA 2AFVA 4NZOA 4G8BA 4BNJA 1H6DA 1D09A 1V97A 1UXHA 4DFKA 3LDAA 1KSGA 2VP6A 3AEXA 4E51A 5EWJA 3U2QA 3H11A 1WTAA 1K6IA 2QSUA 3NNNA 2AJBA 5SZKB 2FQXA 2DHDA 2P0EA 1OC4A 4LQLA 5K01A 5BQPA 4XYGA 1C0KA 1DOHA 3MJVA 3LBYA 3T7TA 3AI7A 3TLJA 1J1UA 5HP4A 3Q7SA 2WG0A 3QX7A 4OKIA 5ADRB 3HJCA 1BPEA 2UYHA 4HBGA 2NTEA 4NH4A 4O25A 2QUZA 4QKQA 1QTQA 2P3SA 3LWZA 2OZLA 5K9ZA 5C7OO 1KVRA 1T15A 1DCFA 3SX2A 1CHDA 1WR8A 4KODA 4RA6A 4X91A 4F06A 1DIRA 1HM5A 2D0IA 1XS9D 4IDOA 3G2HA 2PWAA 3BMCA 1TT5A 2ZPTX 2C8LA 4PRYA 4B32A 4F1JA 1R6VA 2EF1A 2EFJA 3OICA 4MXDA 4PQEA 3TD2A 1BWQA 5EJ7A 1V47A 3GBVA 4IHJA 2NUTB 1DMRA 4HLMC 5ILGA 4GI7A 1XYVA 1I6LA 4O8CA 4UTXA 2PDAA 1E6MA 4XGQA 1KKMA 3V6KA 2H5XA 4IIUA 4HGYA 2J46A 3C6YA 1RQ7A 4A2CA 3G2KA 1IDOA 4D5GA 1JHQA 1SUEA 3QLVC 3U62A 4K28A 4ZWNA 1Z0JA 2IUTA 5C5IA 5L8VA 3I39X 1ISIA 2PRKA 3IVCA 4U6QA 4AU1A 2PLFA 4D3FA 2JIZA 1J6UA 1WNTA 4MCIA 1UBMS 1CUYA 1QHGA 1J8VA 2EV9A 1JXAA 3D59A 1PJZA 4UQPA 4WLVA 1MLDA 2OGWA 2PT7A 3ZHYA 2OHGA 5C81A 3CISA 2JBWA 1KOFA 3NHUA 4D97A 3TFOA 3LVVA 1VCOA 2HC9A 4OHWA 4ID9A 2H1RA 2AS0A 1XNJA 1RMTA 1J8FA 4TWIA 5FXMA 4Q15A 2XRMA 1E3JA 1WCLA 1Z62A 2P9ZA 1J8YF 1R0BA 1U28C 3UKDA 4D44A 1YRYE 1W4CA 1T3TA 3D4IA 4KR6A 1E6LA 2H07A 4HVLA 3AUJB 2YL2A 2J6TA 5ECYA 3EQ2A 1ZMBA 4MKIA 1NN0A 3EQZA 3TR0A 1II0A 2IA5A 1LLFA 3B20A 3WNCA 3ZLBA 3FDZA 4WOJA 3NVVA 2IPAB 4C0HA 3AKZA 3D6MA 5AIAA 3RS7A 4PZLA 2Y1CA 4C4AA 2QRVB 5C80A 4WXHA 1G3UA 1SEPA 2FI1A 2H2DA 5CFRA 2O0JA 3PEUA 3Q3JB 4X9XA 4DIFA 1V9LA 1N2HA 2CXRA 2EFGA 2EQ5A 3ZW7A 4EUKA 3I1IA 4HMQA 4L8FA 4I0WB 5IM5A 3VR5H 5JU6A 1WXEA 2Q3FA 1O96B 3BZCA 4D99A 1NSFA 5JNTA 5KG3A 1OZHA 1A88A 3WMRA 3RAGA 1DC4A 5K8UA 2UDPA 4GIBA 1F17A 1G4HA 3GFPA 1C1XA 4MOWA 1AK1A 1GJRA 2I6QA 4QDXA 4ZPXA 4K6HA 5E0OA 5AI9A 1H2XA 2I1QA 3PEVA 2GPYA 2PX8A 3PUHA 2QZ9A 3SDZA 1GNRA 4UBOA 4C2BA 2I6XA 4G6ZA 4HQLA 4KZUC 4IG9A 1BXRA 1ZM9A 1OIWA 2GD6A 1GUBA 3FPEA 4G0MA 3E0QA 3MWYW 4G0WA 1I0IA 1QOQB 2OXFA 4RKYA 5KBYA 1R5JA 2HN9A 3W4JA 3RJZA 3BMQA 4J16C 2CLFB 1MABB 2X5OA 4A7PA 2PL9A 3PXCX 3HJRA 3NGLA 4JA0A 5CNJA 3VH3A 4EGQA 4KZLC 3O4JA 1S1MA 4NOLA 4P1ZA 4RUKA 5DEOA 1HFJA 5FOXA 1VSQA 1CZKA 1SKYB 4LHWA 4UU8A 4IQ8A 3TIFA 3NCHA 1NKVA 1YIOA 4QHTA 4PCUA 4TTIA 3V3TA 5FI3A 4KIJA 2PX3A 2AGPA 2OESA 1NQXA 2EW8A 2K5UA 3SXPA 1J97A 4N5DA 1VOTA 5IDXA 1P2FA 1PEDA 3TVYA 1PVDA 3ADOA 4M0KA 2IWHA 3V4FA 2BLLA 1N3BA 4UI6C 4RQNA 2XWQA 2GYWA 2OCXA 2B6GA 1XMXA 3TSOA 3WGIA 3ISBA 2XVAA 4RM2A 5AKXA 3PR2B 3PUYA 2XMCA 4Z4GA 3B1XA 3R7LA 1RD4A 2WBLC 3CR3C 4IMRA 4IOKA 5J2UF 4WNAA 2BKLA 1T8UA 3KE9A 3PNLA 4KR0A 1VTKA 1YGYA 4YCXA 5BNWA 4QUEA 1U2EA 2QRGA 5ALTA 1YRHA 3T5KA 4QEDA 3VR6H 3P96A 4DLBA 4ESHA 3OFJA 2HFKA 4B3XA 3WK4A 1J07A 1J70A 3ETNA 1XPRA 2AZTA 4E2WA 5E3HA 1OXKB 3GGJA 4XLZA 3WL7A 3R4CA 3FRHA 4J43A 2W9AA 2H3ZA 2O23A 2Z43A 4QDKA 3V2IA 5KQLA 4UCQA 1QHFA 2NO6A 2CB9A 1F1JA 1M6WA 5GJCA 5TQ0A 5DHUA 3EA4A 3TR6A 1K4KA 1MV8A 2OBXA 4PJ0U 1NVXQ 1UPBA 5IBRA 3A9WA 3KYDB 4QRIA 1TIBA 4IY1A 4RXMA 5D00A 2GXUA 2J5QA 2RGYA 4R8RA 4BNFA 4FX2A 2C83A 3LDUA 2GKGA 3EY4A 2Y3IA 4JV5B 1WG8A 3H9GA 4LV5B 3OY2A 3KXPA 4FYMA 1Y6FA 5KG0A 2G5IB 4J1SA 1T6BY 2O1XA 3CVUA 1GYRA 3ORQA 4MLDA 4DIDA 3G5LA 4GBGA 1T0HB 4GX5A 1R2QA 2P9QA 4G1FA 3HRDD 1C7ZA 7ICRA 1DT5A 1F6WA 3LQ2A 4Q1AA 4BGEA 3TRDA 2ZIWA 1AF7A 1U4OA 1P0IA 1VZ3A 1W76A 1EP9A 3I0NA 5F23A 1NOKA 2R84A 3T5CA 1OA1A 1DEKA 1XP8A 3VH1A 4AX4A 2UVPB 5DDMA 1XVUA 5LXTF 4YAUA 3D7KA 3HC7A 4C7KA 4BL5A 2I1LA 4AQ7A 4LXQA 1QH0A 3R41A 1C30A 1NMZA 4FYWA 2P5SA 4UQLA 5JC8A 5E4TA 1UBLS 2AE2A 2REOA 3OJEA 3P2IA 4DDWA 4YRNA 3AVVA 4RWZA 4QSHA 3PD0A 3L05A 4J1TA 1ZQIA 3SZ2A 2Q9CA 1D2NA 1M74A 4W82A 3H7AA 3GIMA 1MTOA 3UMGA 1FP4B 2PGNA 2WSIA 3PKJA 4JLKA 5NULA 4YHHB 2GZ2A 2CNNA 2HU7A 2Q50A 1KE2A 4IOLA 4BUGA 2KD1A 3GEBA 1JHXA 3C87A 1FFHA 3GROA 5TT1A 2PZEA 4P98A 4DNXA 2VZ9A 3ZH9B 9ICPA 4PIPA 5IK2A 1KEPA 2G1JA 3UO8B 4PAWA 1XBTA 4ECQA 1GQYA 2BR4A 3E9QA 3TGLA 2AJTA 4LAFA 1IAVA 2XTMA 4ODIA 1TU3A 4OI4A 4D45A 2Q7OE 1S97A 2K7FA 1HX7A 4IJ5A 3W3AH 4FWTA 4AN1A 4RQ5A 4KLQA 3D7LA 4RAQA 1OT5A 2B82A 3BAFA 5LU8A 4ZAFA 4GNKA 1DLIA 3QZ7A 3FC4A 3ZDAA 1YZVA 2VZEA 1XI2A 3PC8C 3KSAC 2B78A 3TARA 3KFXA 3V2GA 4F45A 2B4TO 5I5EA 2EBUA 3VYWA 4ZVNA 5KFXA 1TA0A 4XDYA 2OA0A 1MA0A 2Q27A 4HPXB 4YECA 3ZDYB 4A91A 1KQGA 1M34E 2J67A 3VV3A 3B8HA 5AUQA 2FPUA 3ZZNA 1U28A 3W5JA 1YBAA 2J7PA 1MOQA 4MS3B 1JF8A 3LBHA 4ZAVA 3ZTTA 1ZKMA 4DARA 3OEIA 1YTLA 2RIPA 1RM5A 2MSCB 1Y34E 2WB1F 4DLGA 2Q0QA 3K6KA 3L8FA 4J91A 4BRSA 5AI0A 2IPMA 4C08A 5A02A 2I2DA 1E3QA 4RESA 2VA8A 4HF7A 1A7AA 2W6CX 1K7XB 2P5YA 2QR3A 3EGOA 3JYPA 4UHJA 1YDEA 5AQEA 2E5WA 5EGNA 2VJMA 4RHXA 4EJ0A 3AEQB 1XPJA 3Q2OA 3VKFA 3GDOA 5F7XA 4MARA 3KZXA 2O50A 2VOJA 4G1VA 3FWPA 5C1PA 3ZXUB 1ZOOA 2G07A 3G13A 3RVKA 5CA0F 4ZDKA 2Y0BA 1Z7BA 1GL6A 3MS4A 4G1UC 1BTOA 4JLPA 4ZT7A 3EPHA 5M2QA 4CCYA 1GKYA 2VP0A 2WEKA 4E94A 5HKKA 5J0YA 3O4FA 4OMCA 4C29A 1FFUA 1QJCA 1E61A 1F4PA 3KVYA 4KAAA 5FBZA 3WL3A 1W2HA 2Z2JA 4AYWA 3C43A 3E58A 4BNDA 4QBIA 1IN7A 2RHWA 2VDLB 4UTZA 5B53A 4IV5A 3ZEIA 1N2JA 5DFAA 1Z25A 5CFMA 5T5QA 2IEDA 3BQMB 4JI3B 3T1QA 2I7VA 3CR8A 1JIXA 1O97D 1CS0A 2EKBA 2DUYA 4ELUA 1K75A 2RK6A 5C0OE 2G09A 1QTRA 3DEAA 1UJ6A 2IEGA 5AM2A 4PVCA 4B3HA 1SC4A 4JMPA 1VPEA 1Z06A 3UT5B 2ZB2A 3HP6A 4BN4A 1Q95A 4RTPA 3S68A 4FYIA 2LR0A 1GARA 2IQ5A 3GR6A 4J8PA 2PMCA 3RSHA 4XR4A 3V34A 1SQ0A 2E89A 1RAGA 2B30A 1KZ6A 3A9TA 3V8BA 4DJFC 3OCXA 5JAHA 2Q5EA 4KNYA 2IYZA 2XJ4A 3ZCSA 4NFSA 1QR6A 1W4ZA 4QJ3A 4CM7A 4KR3A 1BD3A 3BJRA 3SGLA 3M5DA 4F3TA 2VK4A 4HL6A 5I7HA 2H7XA 3B9BA 4YAEA 3AVUA 2JFVA 1GDTA 4TKMA 1AT1A 3O8QA 4ARSA 2DHCA 4DDTA 2YWDA 1T4CA 1YS9A 3KKMA 3O8LA 5KI6A 4D25A 1FDVA 4HVCA 2OK8A 3RIEA 2GF2A 2PK3A 5DHRA 2HLPA 1IJFA 2IU0A 5CXSA 2K8CB 2ZIUA 1XL0A 3ZNQA 1ZNYA 1BN6A 3RTAA 4AJKA 2J6HA 1DXQA 4C21A 5DNAA 1LDBA 1XWFA 3LJKA 2R66A 3ANNA 1RWNA 2PR7A 3A25A 1BYUA 5SZIA 4Z9AA 3RHSA 1BS9A 1D1TA 3ENZA 3VR4A 3LLSA 4QEZA 4GOJA 3EBLA 3PGA1 3UKJA 3ZWQA 4AURA 2B1QA 3KU1A 1PKEA 2XUFA 1TMGE 4QGFA 2BYTA 1WHSB 5KG6A 2GTIA 5ELLA 3HP7A 1XMPA 3EVAA 3O3NB 1OASA 1AN0A 3IQDB 3TGWA 2P9BA 2PL3A 2PSSA 3LDFA 4ETIA 3BS5B 1ZSYA 5EWJB 2VLBA 2IBSA 4TT3D 1GFZA 3FWZA 4E22A 3WB0A 1GRCA 5KTKA 1QMGA 4MYUA 3IG5A 2QM3A 5JS8A 4OK3A 3ZU3A 2HTEA 2XIDA 3EBPA 3HKEB 3I2IA 3EZLA 1ZRSA 2XV1A 1PJTA 3KKZA 3O03A 3O2JA 1YQXA 2CJWA 2V6IA 1WXHA 8AT1A 1ECJA 1KF0A 3JASA 1CC1S 1G21A 1H85A 1UKYA 3AFMA 3S2GA 1PR2A 1CUXA 5JHHB 5LQRA 3NPMA 3C1UA 1RG6A 3PDWA 3ILHA 2A1IA 1N1DA 4TKVB 5DHTA 2BAGA 4QXRA 4BNDB 2E0IA 5BUZA 2CNOA 4R4JA 1RLMA 4YB8A 3N7UA 3A7DA 3R0ZA 2H3IA 2PX4A 2QTLA 4CMEC 2HCBA 2Z2YA 2AMJA 3I3SR 1R0RE 4HH0A 4AP9A 2A86A 3WDLA 5SYNA 4ND1A 4EY4A 3K94A 5LQAA 1WMDA 3DOFA 5LC1A 1WA5A 2FX3A 2GEFA 3UQYS 1RPJA 4E1AA 4OEHA 3H5LA 4KMOA 3CWZA 3BULA 1UOPA 3PI6A 4IOJA 1XSEA 4WLUA 3EEOA 3AJ8A 4IIHA 1ZXXA 3DAOA 1CQXA 2NO4A 3NIBA 2FPGA 3OEHD 1JPJA 3TZCA 2VHZA 1L7PA 3C4JA 1PR6A 5JG7A 5JLAA 1DKUA 4O1HA 2N75A 2PU7A 4TUPA 3UUFA 4CL0A 9ICFA 4J76A 2M6KA 4CVNA 4M9ZA 4DWWA 4AO8A 2MJLA 2VJ4A 3PL5A 4FXOA 1YFKA 4JLVA 1Q7EA 1X2EA 2IU3A 4FKZA 2OBMA 1MZVA 3B9QA 1NNEA 2RHFA 4M8LA 1H38A 1WP4A 2WJYA 2DHQA 3IJ5A 4XVRA 3P4XA 2HVHA 5JNUA 2DLCX 3I5UA 3DZDA 1T8TA 4C0SA 3CX7A 3SX4A 2DBRA 4MFCA 2OHOA 2VYVD 2H2HA 2BJHA 9ICLA 2PGLA 1JSLA 4A1FA 3K9CA 5E6UB 1H3FA 4BBAA 4X7PA 2GNOA 3DZBA 1ISFA 4X6XA 4NCJA 2EWMA 4Z5XA 4C2TA 4Q7LA 2AVDA 2B61A 2AD5A 2EIXA 1T8EA 2D13A 1W1IA 4M87A 5H3HA 1KEZA 5IC6A 2X0FA 1N5JA 4YQEA 1MO2A 2F9MA 1FRZA 3ZY5A 3B2NA 4YV0A 4YNBA 5J0TA 2ZK7A 4ECTA 2ID9A 1C20A 4M86A 4L6IA 1Q0RA 3A1NA 2W83A 1AGPA 2A1JB 3NHKA 3HJFA 1BMFD 1E2QA 1ZLXA 3BWVA 1GN9A 2PUAA 4CF4A 2EARA 1GCIA 4TTVA 3RS5A 1X3LA 5TGTA 4MJLA 1UPUA 2O20A 2W2XA 2XVMA 3FPBA 4FIZA 1HJPA 3LNTA 1ATIA 5L1IA 2FZGA 1B0PA 4NS4A 3WY9A 3L8CA 5AVSA 4GQBA 2P4SA 1OI2A 2BUAA 2C5FA 2ZIXB 5J2HA 3CWCA 1RZRA 2AUTA 4AF8A 5AESA 2R6R1 1BGWA 2V6MA 5HOQA 3QVMA 1JB1A 4LIPD 1ISJA 2QS9A 3ZWKA 4AMGA 1EJ6A 1KRPA 1TJ4A 2V7TA 3GJRA 3P2OA 3TI0A 1JIQA 4G8DA 4EO9A 1UK9A 3ERCA 1NC1A 2HHQA 3JQCA 3MPOA 3BWCA 1U7WA 3EFBA 3D0RA 4Y6RA 3TRJA 3UCXA 1FLNA 2XRFA 7ADHA 3D9QX 4Q7KA 4GPTA 4FP9A 2IEZA 4JIGA 4NPAA 4XYEA 3SHOA 3BQ0A 3TJZA 5C8XA 1TK0A 4EMUA 1SO8A 3JQDA 1DFGA 3MABA 4FHEA 3U4CA 2HPZA 1QRUA 4KACA 2I5HA 3AI1A 3B2EA 3HZRA 4QJ4A 2O2YA 4YCSA 5HG0A 3FUWA 4F4KA 4CLRB 4M1KA 2PX6A 2ICAA 3Q11A 3W1VA 1QAOA 4Y67A 3KWLA 2CK3D 3U48A 3SQWA 3B5IA 4RY0A 4X63A 1DX6A 1ST3A 4XB1A 4KOEC 2WUEA 4XGNA 5ALSA 4XJTA 1DJNA 1D2EA 3AUSA 1HUQA 3HCCA 3OZRA 4F0JA 3LPCA 2V74B 5JPDA 5FI0B 1SUPA 1EBUA 3FIJA 4CM1A 3BXPA 3WL5A 3SR4A 3C6BA 5DB8A 5T4HA 1UT5A 2J5RA 3J81j 5FBKA 3SC2B 2YW2A 3I9V6 5K05A 3RH6A 5IIIA 3M1YA 3GJSA 3H2SA 1MD9A 3I92A 1OAOA 4MW5A 5IN5A 2XJ9A 1ZESA 3PR5B 1Z7WA 2ID4A 2ZJ8A 1DX4A 2OMEA 1LNQA 1MG0A 1EFRD 3CLVA 3JRWA 3ZDFA 4D4HA 4YXMA 1V7ZA 1VHTA 3J80A 4DBZA 5LXTB 2P9HA 4ZV9A 4DVJA 3WLPA 1F2DA 4JGGA 2FLNA 4I6GA 4WL0A 3SZMA 1DEXA 1KFKB 4GS5A 5FPKA 5JYDA 2QNBA 5AW0A 5E9AA 1JJBA 4U2CA 3WNBA 2ZS9A 4YFKA 3ULKA 1XQWA 3I09A 3IMKA 5FJJA 4E11A 1G59A 1UXJA 1E4EB 1S9HA 3SFTA 3E5RA 1PW7A 4KGZA 1KEEB 3FPCA 5AO9A 1H6BA 3U7RA 4AJOA 2G76A 1OKKA 4LSWA 5F1OA 1Y3AA 3VO1A 4BE7B 2VJLA 1X80B 2DUJA 4IQ4A 4DQUA 3STXA 4LJ7A 1XMQB 4G9EA 1MW8X 3LG2A 3P5SA 4MR9A 1VE1A 5BQ5A 5J2UA 2OCLA 4CQMD 1W0KA 3QBVA 1MPTA 1AHNA 3W5CA 1EX9A 4N41A 2NVUA 3M4ZA 3UUGA 1NJGA 4KQKA 4QPCA 4CEJB 3A4TA 4E0DA 5A6SA 4C6HA 2R6FA 3K6JA 4IYJA 1BDIA 5A6SB 1G3QA 4P2GA 4NU8X 9ATCA 4BGVA 4Q4LA 4GP9A 2Z4RA 1GZ7A 1TYDE 2WA2A 1YB7A 2YDXA 4ECUA 4HAVA 3ZV7A 2HBQA 1FYEA 2P9EA 3M9WA 4PSCA 1J00A 4ZRDA 5E9JA 4D8VA 3U6BA 4LE2A 4OBXA 4R41A 3L7IA 2JHCA 4KE7A 1Y9JA 1FXWA 1CUGA 1NP7A 1FVFA 2HA4A 5D5HA 1V5GA 1YQEA 2OCIA 3SBDA 5EXSA 4HSEA 1HLPA 4EFKA 4QD3A 3VZBA 2Y77A 2HBMA 5CYPA 1Q2UA 1GZHB 2VPTA 4CRWB 1QIJA 3THYB 2CV2A 1VKZA 1V6AA 1RWOA 4YMMA 2ZSKA 5G4KB 3AB7A 2J6CA 1USWA 4JOQA 3B13B 4J0CA 3RLFA 2LKYA 3JQRA 4WZAA 2PIDA 5LA6A 3EFEA 1UBFA 4BQSA 3G8YA 2OFWA 4F12A 1DWQA 1YB6A 4QZIA 2WU8A 1ZD2P 2YOFA 2FRDC 3E9EA 4CV1A 5EUCA 4IUDS 2DJ5A 5I47A 3KAPA 1R4ZA 2IF0A 3L92A 1QTMA 1KDYA 3WS7A 4WFKA 3OLVA 1IHDA 1JYFA 1NX9A 3MGBA 2ZZMA 1SNYA 3R3XA 4FYYA 3W05A 1Z82A 3HJHA 1QC5A 2AZ4A 1WCNA 1UPTA 3VPAA 1XJQA 1WTCA 1X1BA 2G9ZA 2QA5A 1Z2CA 2OAP1 4NOMA 4DEYA 3GH1A 3LK9A 2RHHA 4X1IB 4YT4A 1UPFA 5GGXA 5K8IA 4WSOA 4HGNA 4QYIB 3KQVA 3FSGD 2WK1A 3TXAA 3UA3A 4XQGA 2PE5A 5GONB 1NE7A 2LYBA 5D49A 1M6NA 2DUMA 4QGHA 1A4RA 1IY0A 2P2NA 2R11A 3ZDDA 1Z37A 4BJ3A 3O6VA 4XIJA 4XM0A 4MB6A 1QZZA 2AEFA 4MWGA 1JZSA 5D3ZA 4ZCIA 4D56A 4NOKA 4KQGA 2GBCA 3BL6A 2H7CA 2I6FA 1VKNA 1WZEA 3QE0A 1QIKA 5IKOA 1ZMOA 4E4TA 5E7IA 2RD2A 3OZGA 3JZFA 4H4EA 1YJXA 5G0TA 1M83A 1ZCFA 3JQFA 4R3WA 3ZBUA 4RVUA 4MI9A 3ZGLA 4DS4A 5KB3A 4WFJA 3TX6A 4E4RA 3AL0B 2PVPA 3BCHA 3M3DA 1L8QA 1EBBA 1K5HA 4RZHA 5EMKA 3WIOA 4NYIR 2GUGA 2OORA 4KNVA 5MFPA 4US8A 4M1MA 3R44A 4FD3A 1TRHA 4I50A 5TQ0B 2PZLA 3QENA 1PJAA 5AUPB 4JJGA 2B5VA 2VNSA 3AU9A 2QPTA 3TANA 3MG9A 5F1PA 1J2NA 3HY4A 3ZU6A 5HOEA 4TSFD 2YY5A 2H92A 2BPFA 4UNNA 4ECXA 2FWAA 3MWLA 1EBFA 4AIRA 1RXYA 2EANA 2WD9A 2YFHA 2F8TA 2O2GA 2XAUA 2Y1XA 3L6RA 2JEZA 4MGYR 5I48A 1WS6A 2QJWA 2GXSA 5CVVA 5FLKA 4MYDA 1JLLB 4TPKA 2KK0A 3WXMA 4RF5A 3RAFC 2D6FC 4ZMBA 4ZOBA 2K4MA 1DJMA 8ICKA 1DEHA 1A8SA 4HQFA 3I45A 5L9AA 2YIVX 1MHTA 1L3SA 4MIEA 3QJYA 1ZKDA 4DEXA 1QJ4A 2GM9A 2WAAA 4DOCA 1J7KA 3L6CA 4IHKA 2WNIA 1V6SA 3FAKA 4UVDA 3LYLA 2W6IA 3G0IA 5AVKA 5JCZA 3B6ZA 1AQIA 3RS9A 1DAPA 1U7TA 3IJEB 1VSVA 1QX4A 1Y5LA 3RV3A 1VHQA 2ZB4A 4UTVA 2YXNA 1OXSC 1OX6A 3QEMB 1GTZA 4X3OA 1MJNA 2IYAA 4J0FA 4D9CA 1DIHA 2YNMD 2PGIA 4IDFA 2OENG 4WOCA 5F1YA 2HK6A 4E70A 3FM9A 3L0DA 1E66A 3DJFA 4M9XA 4ZOLB 5ICEA 3P0IA 2YRXA 3LBNA 1Y7IA 3RYCA 1CULC 5IIOA 1MPXA 1M7BA 1AY0A 3RSSA 1YBFA 4ILEA 1BNPA 1W29A 2C4MA 4OM7A 3DBLA 5REQA 1M33A 3STYA 4FZMA 1HT0A 4I55B 2FUCA 4P5DA 5CDYA 4LY9A 3QE4A 1RI4A 4PTYA 2NW6A 4TMWA 5DCWA 2C8KA 2EJTA 1AKYA 1ONBA 4RQBA 2ZCJA 1TK5A 1GA6A 4AYBF 4NG5A 4F85A 5KOHB 3B1ZA 1Y1PA 2CDRA 1I4EB 1UDBA 1ZBQA 5FLEX 2DQKA 1QHXA 2WY2D 4FMDF 3V97A 1FX1A 1Q0SA 3OM1A 4YCNA 3U4QA 3VI4B 5B30A 2CFSA 3RW9A 3OM8A 5GZ6A 4L5JA 3CUTA 4UEQA 5EHQA 2I2XB 4RJKA 4C03A 3ZHQA 2OFXA 2MIIA 3AFIA 4MS4A 2Y1LA 1ZJ5A 4H0CA 5CVTA 8ICFA 4YN3A 1E62A 2UUAB 1AS3A 4M4SA 4RSGA 1CE8A 1FFVA 1XAHA 4WXMA 1HZZC 1N77A 3QLUA 3BDAA 2CHFA 3VNSA 1Z38A 1KVUA 5BSRA 1SXJC 2R6ZA 3PW5A 3ORHA 1GAJA 3HVRA 3PIRA 2QPOA 4MYRA 1FMCA 3EXEA 2YX1A 3P94A 3SN6A 3DFFA 3G0BA 4E1VA 4QZ8A 1M3SA 2CJXA 5BN4B 1RWVA 5ALFA 3QEBZ 1RTTA 5KG1A 1K6JA 2N1MA 4K4GA 1KS2A 2A5GA 2GSDA 2YVUA 1QLHA 3GI1A 3K9HA 1KYVA 3NDJA 4IO1A 4TXLA 4G1CA 3K1AA 5AXBA 3L0SA 1ZOSA 3UZUA 3LRXA 2GBFA 4EBEA 3O9VA 4KQ1A 3UB2A 3DP9A 2M32A 5FPTA 4P7FA 4BLSA 1SBTA 5EZ6B 2QI9C 3BE6A 1UDCA 5F5XA 3KEQA 1VGRA 2WUDA 4F3KA 5JSZB 2QD5A 2UUOA 3T38A 4ZEXA 5KFAA 4NK4A 1MG5A 3L7AA 2OOSA 4ZVOA 1INLA 3HG7A 4RIEA 3FMIA 1I2CA 3ZK9A 4C3UA 3IR7A 1A77A 5A3JA 4LPKA 2X1HA 2MYTA 3M5WA 1ZH6A 4KDRA 1UPCA 5FBHA 4BUCA 1WDKA 1ZQXA 1KA9H 1MZPA 3SAHA 1S2NA 4G0OA 4KQCA 3KV1A 4RBNA 4CQNA 3KS9A 1ZK0A 3W1WA 2JCGA 3JX9A 2J30A 3G2PA 4LGCA 2C82A 1G5FA 1L4MA 1IPHA 2G40A 3LQQA 4A10A 7YASA 2BCSA 3JRXA 3HJGA 4R1QA 1AB5A 3BD7A 5LZ8A 1PD0A 5DNYB 4H1UA 3VX4A 5B58T 5EYPB 3PSTA 3ML1A 3ESBA 5EESA 3ZOZA 5JOQA 5FTKA 4N82A 4PRZA 4ZJPA 5CXXA 3SD7A 4LBWA 4LA4A 2ZCVA 1LRJA 3LQYA 3QX3A 4KO1S 1S7GA 5H1YA 5H83A 3HS2A 1XD8A 1WXXA 5F2KA 2VTVA 4Z4HA 4XEUA 3IHQB 2PG3A 2B8WA 3C23A 1IQUA 1VE3A 2F90A 3AHFA 1J5EB 3SX0A 1NYRA 1PK3A 1TVAA 1T6XA 1WV0A 2VC2B 5CDHA 1E8NA 1NLMA 4BNTA 3TIIA 2X3YA 2WTFA 1YV9A 1JFTA 3ADKA 4P3PA 4W5NA 1URJA 1YQGA 3GN2A 1D2GA 4PX5A 2XCAA 2ATVA 3RR8A 3AQIA 4E0BA 1Y0BA 5ERXA 5KAMA 4UAYA 4P4PA 3DQZA 4MULA 3VRHA 2CNDA 5I01A 2HSWA 3A4MA 3G85A 3N74A 3QYAA 5TS2A 3ZCXA 2FP4B 2BE7A 5B3AA 3WC4A 1ZI6A 1E0SA 3G9ZA 2DPJA 1VJGA 1HY3A 1ZI8A 2BUBA 5K0JA 2J4CA 2W4QA 2Q5CA 4IF6A 2IV7A 4EG6A 1IQRA 1AGNA 4JFAA 3LVWA 2AJ8A 1ZQGA 2PWBA 4G0QA 3FVRA 3L93A 5IILA 3OFNA 5EE3A 1Z28A 4MVJP 3T1TA 1HNZB 3B3QA 3D5TA 4UZFA 3BM5A 1ZSVA 3KQNA 4IVQA 4YRBA 2HRBA 1OGJA 1GCGA 3CQ9A 4V03A 1JFVA 1IDN1 1Y8RB 4M99A 1WX1A 1G2IA 1XROA 1JR6A 1SG9A 5AVXA 1PDWA 1NJ1A 3DW3X 3ZE7A 1NOMA 1JG7A 5ALDA 2WHYA 3DFKA 3RQSA 1QYIA 3ZCVA 4TGLA 1R50A 2I9KA 1PK9A 2PFOA 3PYMA 1YOBA 3RGWS 2GLUA 3OQPA 3OT4A 3T61A 1CFZA 4IQFA 3NRJA 5AOAA 2PD4A 3IMFA 3V5NA 2JFUA 2Q4TA 4W9MC 3LYSA 4DG9A 4J0QA 3DA8A 2Z83A 4I4TB 2BMFA 2W9XA 2VTBA 4IAOA 1KJIA 3W06A 1ID1A 2HVIA 5HMMA 3HN6A 2F43B 3ZNOA 3J81A 2PI4A 1JDZA 1KHHA 1EA7A 3I1FA 4L4YA 4GXTA 4PLZA 5JZMA 3SVLA 2VBIA 3QMWA 4UHCA 2YMLA 1U2QA 2ZBDA 2FW7A 4OVKA 1AZSC 3MWFA 1P8AA 5DQHA 4HNGA 4L16A 4FMDB 4ON9A 3LIIA 5FUXA 3R8CA 2G06A 2JFHA 2VDWB 2X5XA 5D85A 3WLFA 2YNMA 5KOIA 3HBJA 3FMOB 3PPIA 4TVBA 3PRYA 4REMA 4ZAGA 3Q8XB 2VRNA 4U7HA 2P6UA 2PZAA 3RYTC 4DLNA 4EEKA 1Q7TA 1YB4A 4HYQA 4BY9E 1H94A 5LSAA 5ETJA 1TM3E 2B0JA 2VATA 4J9MA 1UZLA 3VCBA 3W8FA 1QK5A 1RBZA 3PNBA 3VH4A 1Z13A 3B89A 5AI5A 5KVCA 2HY7A 1ND5A 4PIVA 2AL7A 2DWOA 2ZAYA 2FPLA 1CNEA 4MWDA 4C0KA 5GADl 4XWGA 1NVUQ 3NUQA 4U9UA 1YMQA 2FMIA 2Z7JA 2RGWA 4LRYA 3FSJX 2E2WA 2IA6A 1XK7A 3B6KA 1V3TA 4G5HA 5AM5A 2B2XA 2J3DA 3Q3VA 4KLCA 1VI6A 1HUZA 3RFUA 3PFHA 2HHLA 2BBWA 5EHGA 1OB5A 4NMWA 2ZDQA 4YREA 2Y68A 3DZKA 5CTAA 1C30B 1OMOA 3QWHA 1B7GO 3PSIA 1C9YA 1P7PA 2P2CA 2P2ZA 4OX9Y 1GUZA 3WLIA 4FBTA 4KFRA 5FL3A 1X87A 3DOEA 4RD4A 5DDYA 3OQVA 2RHMA 3PX3A 4ZVRA 4D9NA 3TD9A 4DMRA 5L7TA 4Q3LA 2CV0A 5KAFU 5CG1A 3I37X 5K8TA 4CKBA 4Y0NA 1EX6A 2WPDA 3KDSE 4NI5A 4JSTA 3F3KA 3ZWDA 3GNLA 2MMCA 5AXCA 2VHYA 3CZ5A 1JJAA 1RWMA 5JDIA 3ZJVA 2GCOB 4P6VF 1TK8A 5IG2A 2VNAA 1UCFA 1NJWA 2KHVA 3HY6A 1UIRA 3R3WA 4D9EA 2AWNA 3UH1A 4C8OA 3AP3A 3DV0A 2AEMA 1WIWA 2HHUA 1M1YB 2WSYB 1MBZA 1Q92A 4F5EA 1QFMA 1JR4A 4UZSA 4IRMA 1V2HE 4Z4FA 3NHMA 3MGCA 3KYDA 1FUUA 1T3QA 3OFSA 3HN7A 2HDHA 4HDSB 2C54A 2FMHA 2WICA 4A8JA 4HKKB 1QHIA 5DBGA 1E2LA 1M2OB 3OX4A 4W7SA 3V4RA 2JLZA 1DUIA 3ZS9A 4C5CA 5BSVA 1YIDA 3KQMA 1CF2O 3VO9A 3L4PA 2DFPA 2UYOA 3W8NA 2YFQA 5HKOA 2D5CA 4YPFA 5BSWA 4HZUA 1A9ZA 5MFZA 1KFSA 2FXIA 1U49A 3HPRA 2E85A 3F4LA 5DLQC 3T6KA 1R6BX 2PH7A 3EZ9A 4GAEA 2FZWA 1M8JA 1M1XB 2DY1A 2XEXA 4R1NA 5U4QA 4ND8B 2KHQA 3ETHA 3TOZA 4INPA 1ZPDA 3WISA 1DCMA 1ZN7A 3IP6A 5K4GA 4GKKB 1IIBA 3VDXA 1U90A 1SUBA 4B5LA 5DOZA 2QAGC 4EI2A 2OCKA 1VKRA 2ZRHA 2MUTA 2D8CA 2ZSBA 4KQHA 2NACA 3HLYA 3T54A 5LZ4A 5KL8B 1ZK1A 3SI7A 4CMCA 3C3WA 3OEHA 1QIEA 2FAXA 1JEEA 3TLYA 1L5YA 2LKCA 4UBMA 3NRWA 1WY7A 2VP3A 2YINC 3BILA 3D1JA 5LA6B 3SIXA 2IS1A 3H2YA 4ECWA 1EEHA 4JAVC 4NCNA 5LZ5A 2WI8A 2BL4A 1ULTA 1RXCA 4PC6A 3W04A 4QAQA 5G3YA 4U7CA 3JAMA 1U0SY 4RMJA 4QDOA 1QPGA 4OGGA 5A06A 1EFVA 3OOYA 4Q3OA 1A5SB 2I1WA 2M6SA 3U7GA 2FMKA 1XB2A 3A9CA 3ALRA 1T0UA 2JVJA 3AV0B 3OA2A 3AR4A 2HSEA 4IDBA 4V38A 3RREA 1GSIA 2GHIA 1GPAA 1M7GA 3QKSB 4MSUA 1OHHA 3Q0EA 3V7FA 2YYYA 3HXKA 1VI5A 1C3LA 3FYDA 1U2GA 2WVGA 3AYXB 3IGFA 2LV8A 2LYHA 4JGIA 2NU6A 3E0XA 4F8RA 3I6MA 5I51A 2AK2A 4YCLA 1LPPA 2VKQA 3O1IC 4AC9A 4DOMA 3DMTA 1QHSA 3N0TA 3GNTA 4B8ZA 4EITA 3RUDA 1IOWA 3DHNA 4LMRA 4ZZIA 5BP7A 2ZYSA 1SEVA 4FDVA 5K0FA 5JAOA 2BTQA 3W9BA 3ED5A 1ZINA 3BKWA 1JDTA 3IUQA 3BMNB 5KVVA 3UBTA 3NEYA 2N9UA 4WKGA 4R6WA 1WMEA 1LZLA 3AEUB 1XZEA 3N8DA 2EZTA 2YVQA 2I7TA 2IHJA 1X9WA 3LSTA 1YFLA 4FZRA 2Y9PB 3DTVD 2BE9A 2ODBA 5ALPA 1UBKS 4D2IA 5AI6A 1JFFA 2OGUA 1GZDA 4F5PA 1U8EA 3I0ZA 5DN6A 3UMMA 1YZFA 4B17A 2BV3A 1RHKA 2J9XB 2HLNA 3RAQA 1CIVA 3BGOS 4AYTA 2CV1A 2ZE8A 2V7WA 2XWSA 5G1OA 1KK2A 4CL8A 1K63A 1L7RA 2J32A 2Q3MA 4RQ1A 3PIDA 2JXJA 7ICTA 1NF9A 3O73A 4QJIA 3IP4B 1BWPA 1LSJA 2EJUA 3BRWD 1Z8DA 3H1GA 1N57A 4CF3A 1JTEA 1YS4A 5DSXA 4CTKA 5B64A 5CYFA 3T5DA 3C21A 4A92A 4BXOA 1ETUA 3UWSA 4EHAA 2E5LB 1SQFA 1YFZA 1XLTA 1DKRA 1Z56C 2OZPA 4ZC8A 4DL9A 1Q0HA 3H9UA 4CIAA 2AC4A 3K0AA 4G0ZA 4NJMA 4RZSA 2H1IA 3RC7A 3OAAD 1WBJB 3H9CA 3IV7A 1OYYA 3IT3A 2NX2A 4FGUA 2OXIA 3SHTA 4YAOA 2ASLA 1J0CA 1R66A 5AK3A 2XNSA 1Z6AA 4RYDA 4BMPB 1HA3A 5KEIA 1DHRA 2ZWAA 3JAKB 3AUXA 1NTRA 4FLMA 3AEKA 4MROA 1S2IA 1WZIA 4ID3A 3MK31 1QWSA 4N7BA 2HDWA 2H0QA 3OIDA 4NABA 5J4YA 4RULA 1MXHA 5K8VA 4QLAA 5KG5A 1WMBA 3OY7A 4C01A 5CIWA 3M6UA 4AMBA 5KNDA 2XBMA 2RONA 4JT9A 4GZ3A 1Z1VA 4K1XA 3S2IA 3JQEA 4U9IS 4EDFA 4L2IB 3RUHA 1TT5B 4US2R 3LZCA 1KEVA 3UICA 2KSOA 4PC3A 3OJWA 1O95A 3Q8SB 3H75A 5LBUA 1A9YA 1WZNA 3MTEA 3PE3A 3Q15C 4R1PA 1ULBA 3A2LA 3CLHA 4LF6B 5DQGA 1Z2OX 4XM2A 2OZLB 2XYQA 4BB0A 3E9MA 2W9MA 1T4CB 3M70A 5LLDA 4IJWA 2BM1A 2JS7A 3E03A 1CY7A 3IIKA 5CM2Z 3B3JA 1EX1A 3DP7A 3JD4A 1VHJA 3FUUA 3T15A 1FBTA 1KPGA 1LTQA 1V16A 2CVOA 1N8KA 1PG5A 4L28A 3H8JA 2WAXA 5BWMA 2X40A 2VHEA 2BDUA 2OH2A 3FSRA 4X41A 3VU1A 4DM7A 1O1YA 1KZYC 2QJFA 2X41A 4LVOA 3SAFA 4MYCA 3WO0A 2GR9A 4JJ4A 4C2AA 1N25A 4E2YA 5CD1A 3QPVA 4B45A 4KUHA 4UFPA 4BQIA 4YJGB 4N8EA 2EHDA 3G8DA 4PGMA 5K0BA 1G2QA 2DF4B 1NUAA 3AUTA 1WOYA 4F04A 3KKNA 2FFQA 1R88A 5AH0A 1ESMA 3HKDB 4DWOA 1YT5A 4M9HA 5FNVB 4PYIA 4R9SA 5JD3A 1O0BA 2H7VA 3GB9A 5TPZA 1X7YB 4FCCA 2BCJQ 1OQAA 2F3RA 5KSWB 4ZI2A 5LMZA 3FCOA 1PJLA 3WO1A 5T8KC 5KYWA 4YAWA 1ZJZA 2E18A 1F20A 5E0KB 3ER9A 1QDLB 5JTTA 2H1OA 1UIMA 2XI9A 5E7JA 2AMFA 1QVAA 3K0KA 4N3NA 4DG5A 1ZQBA 4ZYTA 1V25A 2NSHA 4WCDA 2G9QA 4EJSB 2ZXFA 2AEEA 4Y6SA 4L4SA 4NE7A 4KEAA 1W46A 2PSEA 5DZSA 1CB0A 3FGPA 3O2NA 1ADYA 1MH9A 3QVLA 2EJCA 1EESA 4IYRA 3T3DA 2ZUBA 1NDUA 1XZHA 2ISPA 2WSBA 4LBVA 3REGA 4K86A 2EDCA 3PHBE 3KQKA 5KFTA 4HAZA 1HLGA 1EFTA 1KFEB 2I8LA 4ZP1A 3HWWA 5L7WA 1VP9A 3KJEA 2DWUA 2VDVE 2XY7A 1HQCA 2ADOA 2G1AA 3H9EO 1YR2A 4PC7A 1P2SA 1NVTA 2DYKA 2ID7A 1MVOA 3BIFA 4Q3AA 4QDUA 3GLGB 1KBQA 4C7YA 3E15A 2VANA 2QAGA 4HAWA 4HLGC 8ICCA 1SPBS 3N2LA 1WUHS 5CA0B 4J0HA 4JX9A 3IUNA 1AMOA 1P0PA 2BGLA 3COYA 1IY1A 3HCWA 2I4LA 2YC4C 2FDRA 3AI3A 4CMGA 2H1CA 4DL2A 1CT9A 1Z33A 3ZWNA 4RPCA 2VDOB 4CLOB 1Z6QA 3UAGA 1YHZA 2JHAA 5IVHA 2WTEA 1FDSA 2WV7A 4L8WB 5EQTA 5DDIP 1AQYA 2WWWA 3JYNA 2J48A 1WSWA 3RJGA 3WK6A 3QK7A 5A3VA 4P38A 1SUIA 3EZFA 1VIMA 1U7XA 1GAXA 4M0EA 4EUFA 4E5KA 5C18A 1SQ6A 3WKAA 1T8PA 3JD3A 3TLCA 3VC3A 3MERA 4UUQA 3RK1A 3WRYA 1NW6A 4TYWA 3LO5A 4EBDA 4DGQA 9ICTA 1GL7A 1HKUA 2AXTU 4QE3A 3WGLA 4Q9NA 2KZZA 1BYIA 4XDHA 1FLVA 3JASB 3SEFA 5JSKA 3WAJA 1VMIA 3NPAA 2HIAA 4F92B 3FKSA 4LRWA 3DFIA 1T1IA 1JG4A 1GNQA 4TKZA 1OYOA 1I3MA 2RIRA 3DKRA 3PP8A 4WDQA 4ZK6A 5L3VA 1BFDA 4N49A 4X71A 3WZMA 1ZRNA 4ZA2A 4Q9JA 3OEIE 4TVKA 3HM9A 4WERA 3G6KA 3NJRA 4IRDA 2O3JA 4OKNA 4XA8A 5IJ0A 1BFUA 2AFIE 1KP3A 3ONVA 4M1TA 3NYWA 1ML4A 3CX8A 4LFAB 2XXAA 1V1RA 3AZOA 4IS3A 5FTMA 3DOOA 1JR3A 4D98A 5A5FA 3WGMA 1X6VA 2VJBA 1V96A 4W5HA 1B0UA 1US8B 1Y8ZA 4F5DA 3KYCA 1DCTA 2EKPA 4EHKA 2HLHA 2Q6OA 3VR4H 2PT9A 2AXQA 1XNSA 2Q4BA 3C24A 2QQFA 1E2UA 4I08A 4IIVA 4IS7A 2JPDA 3M3PA 4IXWA 4MKFA 4KL8S 4O4LB 5KJEA 4UU7A 2E8PA 4TV8A 1NTOA 3IIMA 2VIXA 1LWOA 3WLOA 2C3UA 3L8EA 1QPZA 1SRRA 2OCGA 3L1UA 2X58A 3QEJA 4V24A 4ZO8A 1XYGA 1C3JA 2FW0A 1SH7A 3C48A 2NYVA 4LV8B 5TQVA 4IDCA 5L9XA 2HZ7A 3F98A 4RIGA 4RMHA 4PZAA 4CXMA 2DCUA 1FX0B 3C3AA 2VWHA 4HEQA 4ML3A 2Y0CA 2D1FA 1IATA 2DLNA 4J2HA 4A03A 1A9OA 5CR0A 1ILEA 4BNMA 4DV6B 2JJ1D 5GTHU 4Q43A 1LJUA 1H69A 1KY2A 3RSQA 10MHA 5J1SB 2XNHA 4EVRA 2JJYA 1T10A 3AEVA 1XDWA 3GFRA 1KU6A 3OZUA 3VZSA 2UAGA 1JQAA 3QU7A 1K4MA 3JXEA 4L0DA 4MVJH 4P9NA 2GKOA 2C22A 3WL6A 2ZBVA 1HDGO 4J90A 1RDFA 5BRNA 2YIDA 4FE7A 1E5XA 4B6JA 221PA 3HKBA 3T7CA 3NKLA 2WU3A 1SXJA 3H3JA 1I4DD 1E64A 2EKQA 5IVPA 3SICE 3LX5A 5JCOA 2CMFA 4DZRA 2QMEA 2R1ZA 2WVAA 2XNDA 3H19A 3PD7A 3R40A 3KFUF 2WW8A 3UXHA 1M6YA 5PGMA 3RVRA 1UKZA 1V8DA 2LGJA 1CJVC 1UDRA 2R8JA 3NDRA 3OT1B 2F8KA 4GKVA 1NV9A 4UVEA 1A4XA 2NSJA 3NIDB 1XKXA 1PSZA 4B87A 1T4BA 4DM3A 5JW6A 1CUSA 5KYGA 5DN9A 4AMVA 1YH3A 4Y6GB 4ADSG 3SYRA 4BMDA 1GG9A 1X70A 1YJAA 2I4IA 2DGZA 5EHIA 3W1EA 3SDBA 1NU8A 5KFRA 3CFYA 1TX4B 4X6LA 4TLLB 1A5TA 1N2GA 2IDMA 2WDPA 3ENQA 4II3A 4IWYA 2VJCA 1ZIOA 1I3OA 2AV6A 1DJQA 3WA6A 4XPZA 2XC9A 3F53A 2HJHA 4QYMA 3R1IA 2XIJA 4PGYA 3KT8A 3QVXA 1HETA 4N3BA 4Q4DA 4TWAA 5LDHA 9ICUA 1TKAA 4F5NA 2NU8B 5FBRB 4AMYA 4YJ2A 4PAMA 4UU1A 1UH5A 4GZ6A 4DNFA 1OD6A 1Q7RA 3JPOA 2YRWA 3GBPA 1RPZA 2B4YA 4I2VA 3MQ2A 1EXVA 3GLQA 1TLFA 3SSNA 1ZR2A 2HHVA 1USUA 2H3VA 4R8SA 4O0IA 5J0PA 3C1YA 1LBHA 5EKTA 1UODA 3PY8A 3NOOA 3RE1A 4RMGA 1BXRB 3GA7A 2IEIA 1U1IA 5J2DA 3QKSA 1L3VA 3MJFA 4I1IA 1SKMA 1SGGA 1E3MA 4UD6A 4DIMA 2H5IA 2VJ5A 4V1CA 4XVQA 1XQ6A 3K7EA 5DPMA 1FFCA 2FPPB 1SD1A 2K89A 2X77A 2YJNA 4RS3A 4XJVA 4EKNB 4DF3A 1OXUA 4AP6A 2EAPA 1Q5PA 2EX4A 3D6JA 2EJWA 3EXHA 5FHQA 3UMJA 4UM9D 1HNXB 1UBGA 1IC6A 2H0AA 1LXCA 1ZD4A 2W8LA 1II8B 1XALA 2X23A 3FXAA 4BCBA 3L7OA 2C4UA 2P62A 1O96A 4L3VA 2GEDA 3DF9A 4NHEA 2QL6A 5CHYA 5LXTA 4QTZA 1IZZA 4WA7A 1VFPA 1OU4A 4A26A 4ZVVA 3K4GA 8ICXA 4GGMX 5BQFA 3P52A 1QVWA 3DS8A