4A3GF

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
84
structure length
84
Chain Sequence
KAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 27
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.940.10 Alpha Beta Alpha-Beta Complex Eukaryotic RPB6 RNA polymerase subunit Eukaryotic RPB6 RNA polymerase subunit 4a3gF00
4OIQE 4C3IF 4XLNE 1R9TF 5M5XF 3I4MF 3HOVF 4ZH4E 3M4OF 1TWHF 3H0GF 4A3BF 4A3KF 5IYDF 2NVXF 1TWGF 4A3FF 4JK1E 1I50F 3S1RF 4A3JF 5E17E 3PO2F 4GZYE 4KN4E 2E2IF 3GTLF 5D4CE 5D4EE 3S16F 2R93F 3HOYF 4KMUE 1K83F 3FKIF 2R92F 2BE5E 4Q4ZE 4LK0E 4OINE 5FJ8F 3GTMF 2PMZK 4A3MF 3EQLE 2E2HF 2O5JE 4C3JF 4MEYE 4XSXE 5M3FF 3H3VG 3HOWF 5C4XF 5FLMF 3I4NF 1I6VE 2JA7F 4KN7E 2PPBE 4LJZE 5E18E 3HKZK 5M5YF 2JA6F 1I6HF 5TMFE 1WCMF 4Q5SE 4A93F 4A3DF 1SFOF 1Y1VF 3GTGF 5IP7F 4BBSF 2A6HE 4YG2E 3S14F 3S1QF 4AYBK 4Y7NF 3GTQF 1TWCF 5M5WF 1SMYE 4C2MF 2A6EE 1ZYRE 2A69E 5IP9F 3S2DF 4A3CF 2NVYF 5C44F 1I3QF 2NVTF 3S2HF 2CW0E 4YFKE 3HOXF 4LK1E 3DXJE 4BY1F 4Y52F 4A3GF 5C4JF 1QKLA 1IW7E 1TWFF 3CQZF 3RZDF 4OIRE 2B63F 2JA8F 2NVQF 2E2JF 4A3LF 3PO3F 4MQ9E 4BY7F 2Y0SI 4YFXE 4XLPE 2A68E 3K7AF 5M3MF 3HOUF 4G7OE 2WAQK 1Y1WF 3GTPF 2R7ZF 4A3EF 2YU9F 2O5IE 4YFNE 3RZOF 4G7ZE 4BXXF 5IYCF 5D4DE 3S15F 4A3IF 4OIPE 5BYHE 4OIOE 4XSZE 1TWAF 1YNJK 5TMCE 3WODE 4C3HF 3GTJF 4G7HE 2JA5F 2VUMF 5IYBF 5IPLE 4BBRF 3S17F 3GTKF 4MEXE 1HQME 3GTOF 2WB1I 5C3EF 1YNNK 3HOZF 3S1NF 4LLGE 3M3YF 3S1MF 4X6AF
chains in the Genus database with same CATH superfamily
4OIQE 4C3IF 4XLNE 1R9TF 5M5XF 3I4MF 3HOVF 4QIWK 3S17E 4ZH4E 4A3EE 3M4OF 1TWHF 3H0GF 2WB1H 3HOWE 4A3BF 4A3KF 2E2IE 5IYDF 2NVXF 1TWGF 4A3FF 4JK1E 1I50F 2JA7E 3FKIE 2Y0SH 3S14E 2WAQH 3S1RF 4C3IE 4A3DE 3I4ME 1WCME 5FJ8E 4A3JF 5E17E 4X6AF 1Y1VE 5M5WE 3PO2F 4C3HE 5IYCE 3GTJE 4GZYE 1EIKA 4KN4E 3S1QE 2E2IF 3GTLF 5D4CE 5D4EE 3S16F 2R93F 3HOYF 4BBRE 1TWAE 4KMUE 1K83F 3FKIF 2R92F 2BE5E 3S1RE 4Q4ZE 4C2ME 5IYBE 4LK0E 4OINE 5FJ8F 5C3EE 3GTMF 2PMZK 3S2DE 4A3MF 2NVYE 1TWFE 5C44E 3RZDE 3HOZE 3EQLE 2E2HF 3GTKE 4X6AE 2O5JE 4C3JF 4MEYE 4XSXE 5M3FF 5IP7E 3H3VG 3HOWF 4BBSE 3S1NE 5C4XF 3S1ME 2E2JE 2B63E 5FLMF 3I4NF 5M5XE 1I6VE 4Y7NE 2JA7F 4KN7E 2PPBE 4LJZE 1DZFA 3HKZK 5M5YF 5E18E 2JA6F 1I6HF 5TMFE 1WCMF 4Q5SE 4A3JE 4A93F 4A3KE 1SFOF 4A3DF 1Y1VF 2PMZH 5IYDE 2NVXE 3GTGF 5IP7F 4BBSF 3PO2E 2A6HE 3RZOE 4YG2E 1I3QE 5C4XE 3GTLE 3S14F 3S1QF 5FLME 4AYBK 4Y7NF 3GTQF 3GTPE 3S15E 1TWCF 4Y52E 5M5YE 5M5WF 1I6HE 1SMYE 2JA8E 4C2MF 2A6EE 1ZYRE 2A69E 5IP9F 3PO3E 3S2DF 4A3CF 3GTME 3S16E 2NVYF 5C44F 2R93E 3H3VF 1I3QF 2NVTF 3S2HF 2CW0E 4YFKE 3HOXF 4LK1E 3GTQE 3DXJE 5M3FE 3HOUE 4BY1F 4Y52F 4A3GF 5C4JF 1QKLA 1IW7E 1TWFF 3CQZF 3RZDF 2JA5E 4OIRE 2B63F 2JA8F 2E2JF 2NVQF 3PO3F 4A3LF 4MQ9E 4BY7F 2Y0SI 2JA6E 4YFXE 4XLPE 2A68E 2NVTE 3HOXE 1SFOE 4A93E 3K7AF 3GTOE 5M3MF 3HOUF 3I4NE 3GTGE 1I50E 4A3GE 4G7OE 2WAQK 4A3IE 1R9TE 1TWGE 4A3FE 1Y1WF 3GTPF 3HOVE 1TWCE 2R7ZF 4A3EF 2YU9F 3M3YF 2O5IE 1TWHE 3H0GE 4YFNE 4G7ZE 3RZOF 4A3CE 5IP9E 4BXXF 5IYCF 5D4DE 3S15F 4A3IF 4OIPE 3S2HE 5BYHE 4OIOE 1Y1WE 4AYBH 3HOYE 4XSZE 1TWAF 1YNJK 2KRXA 2R7ZE 5TMCE 3WODE 4QIWH 4C3HF 3CQZE 3GTJF 4G7HE 2JA5F 2YU9E 5IYBF 2VUMF 3M3YE 5IPLE 4BXXE 4BBRF 3S17F 3GTKF 4BY1E 1K83E 3M4OE 4A3BE 2R92E 4C3JE 5C4JE 4MEXE 1HQME 2NVQE 5M3ME 3K7AE 3GTOF 4A3LE 2WB1I 5C3EF 1YNNK 4A3ME 3HOZF 3S1NF 4BY7E 4LLGE 2VUME 3S1MF 3HKZH 2E2HE
chains in the Genus database with same CATH topology
4OIQE 4C3IF 4XLNE 1R9TF 5M5XF 3I4MF 3HOVF 4QIWK 4ZH4E 3M4OF 1TWHF 3H0GF 4A3BF 4A3KF 5IYDF 2NVXF 1TWGF 4A3FF 4JK1E 1I50F 3S1RF 4A3JF 5E17E 3PO2F 4GZYE 4KN4E 2E2IF 3GTLF 5D4CE 5D4EE 3S16F 2R93F 3HOYF 4KMUE 1K83F 3FKIF 2R92F 2BE5E 4Q4ZE 4LK0E 4OINE 5FJ8F 3GTMF 2PMZK 4A3MF 3EQLE 2E2HF 2O5JE 4C3JF 4MEYE 4XSXE 5M3FF 3H3VG 3HOWF 5C4XF 5FLMF 3I4NF 1I6VE 2JA7F 4KN7E 2PPBE 4LJZE 5E18E 3HKZK 5M5YF 2JA6F 1I6HF 5TMFE 1WCMF 4Q5SE 4A93F 4A3DF 1SFOF 1Y1VF 3GTGF 5IP7F 4BBSF 2A6HE 4YG2E 3S14F 3S1QF 4AYBK 4Y7NF 3GTQF 1TWCF 5M5WF 1SMYE 4C2MF 2A6EE 1ZYRE 2A69E 5IP9F 3S2DF 4A3CF 2NVYF 5C44F 1I3QF 2NVTF 3S2HF 2CW0E 4YFKE 3HOXF 4LK1E 3DXJE 4BY1F 4Y52F 4A3GF 5C4JF 1QKLA 1IW7E 1TWFF 3CQZF 3RZDF 4OIRE 2B63F 2JA8F 2NVQF 2E2JF 4A3LF 3PO3F 4MQ9E 4BY7F 2Y0SI 4YFXE 4XLPE 2A68E 3K7AF 5M3MF 3HOUF 4G7OE 2WAQK 1Y1WF 3GTPF 2R7ZF 4A3EF 2YU9F 2O5IE 4YFNE 3RZOF 4G7ZE 4BXXF 5IYCF 5D4DE 3S15F 4A3IF 4OIPE 5BYHE 4OIOE 4XSZE 1TWAF 1YNJK 2KRXA 5TMCE 3WODE 4C3HF 3GTJF 4G7HE 2JA5F 2VUMF 5IYBF 5IPLE 4BBRF 3S17F 3GTKF 4MEXE 1HQME 3GTOF 2WB1I 5C3EF 1YNNK 3HOZF 3S1NF 4LLGE 3M3YF 3S1MF 4X6AF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIQ E;  4C3I F;  4XLN E;  1R9T F;  5M5X F;  3I4M F;  3HOV F;  4ZH4 E;  3M4O F;  1TWH F;  3H0G F;  4A3B F;  4A3K F;  5IYD F;  2NVX F;  1TWG F;  4A3F F;  4JK1 E;  1I50 F;  3S1R F;  4A3J F;  5E17 E;  3PO2 F;  4GZY E;  4KN4 E;  2E2I F;  3GTL F;  5D4C E;  5D4E E;  3S16 F;  2R93 F;  3HOY F;  4KMU E;  1K83 F;  3FKI F;  2R92 F;  2BE5 E;  4Q4Z E;  4LK0 E;  4OIN E;  5FJ8 F;  3GTM F;  2PMZ K;  4A3M F;  3EQL E;  2E2H F;  2O5J E;  4C3J F;  4MEY E;  4XSX E;  5M3F F;  3H3V G;  3HOW F;  5C4X F;  5FLM F;  3I4N F;  1I6V E;  2JA7 F;  4KN7 E;  2PPB E;  4LJZ E;  5E18 E;  3HKZ K;  5M5Y F;  2JA6 F;  1I6H F;  5TMF E;  1WCM F;  4Q5S E;  4A93 F;  4A3D F;  1SFO F;  1Y1V F;  3GTG F;  5IP7 F;  4BBS F;  2A6H E;  4YG2 E;  3S14 F;  3S1Q F;  4AYB K;  4Y7N F;  3GTQ F;  1TWC F;  5M5W F;  1SMY E;  4C2M F;  2A6E E;  1ZYR E;  2A69 E;  5IP9 F;  3S2D F;  4A3C F;  2NVY F;  5C44 F;  1I3Q F;  2NVT F;  3S2H F;  2CW0 E;  4YFK E;  3HOX F;  4LK1 E;  3DXJ E;  4BY1 F;  4Y52 F;  4A3G F;  5C4J F;  1QKL A;  1IW7 E;  1TWF F;  3CQZ F;  3RZD F;  4OIR E;  2B63 F;  2JA8 F;  2NVQ F;  2E2J F;  4A3L F;  3PO3 F;  4MQ9 E;  4BY7 F;  2Y0S I;  4YFX E;  4XLP E;  2A68 E;  3K7A F;  5M3M F;  3HOU F;  4G7O E;  2WAQ K;  1Y1W F;  3GTP F;  2R7Z F;  4A3E F;  2YU9 F;  2O5I E;  4YFN E;  3RZO F;  4G7Z E;  4BXX F;  5IYC F;  5D4D E;  3S15 F;  4A3I F;  4OIP E;  5BYH E;  4OIO E;  4XSZ E;  1TWA F;  1YNJ K;  5TMC E;  3WOD E;  4C3H F;  3GTJ F;  4G7H E;  2JA5 F;  2VUM F;  5IYB F;  5IPL E;  4BBR F;  3S17 F;  3GTK F;  4MEX E;  1HQM E;  3GTO F;  2WB1 I;  5C3E F;  1YNN K;  3HOZ F;  3S1N F;  4LLG E;  3M3Y F;  3S1M F;  4X6A F; 
#chains in the Genus database with same CATH topology
 4OIQ E;  4C3I F;  4XLN E;  1R9T F;  5M5X F;  3I4M F;  3HOV F;  4QIW K;  3S17 E;  4ZH4 E;  4A3E E;  3M4O F;  1TWH F;  3H0G F;  2WB1 H;  3HOW E;  4A3B F;  4A3K F;  2E2I E;  5IYD F;  2NVX F;  1TWG F;  4A3F F;  4JK1 E;  1I50 F;  2JA7 E;  3FKI E;  2Y0S H;  3S14 E;  2WAQ H;  3S1R F;  4C3I E;  4A3D E;  3I4M E;  1WCM E;  5FJ8 E;  4A3J F;  5E17 E;  4X6A F;  1Y1V E;  5M5W E;  3PO2 F;  4C3H E;  5IYC E;  3GTJ E;  4GZY E;  1EIK A;  4KN4 E;  3S1Q E;  2E2I F;  3GTL F;  5D4C E;  5D4E E;  3S16 F;  2R93 F;  3HOY F;  4BBR E;  1TWA E;  4KMU E;  1K83 F;  3FKI F;  2R92 F;  2BE5 E;  3S1R E;  4Q4Z E;  4C2M E;  5IYB E;  4LK0 E;  4OIN E;  5FJ8 F;  5C3E E;  3GTM F;  2PMZ K;  3S2D E;  4A3M F;  2NVY E;  1TWF E;  5C44 E;  3RZD E;  3HOZ E;  3EQL E;  2E2H F;  3GTK E;  4X6A E;  2O5J E;  4C3J F;  4MEY E;  4XSX E;  5M3F F;  5IP7 E;  3H3V G;  3HOW F;  4BBS E;  3S1N E;  5C4X F;  3S1M E;  2E2J E;  2B63 E;  5FLM F;  3I4N F;  5M5X E;  1I6V E;  4Y7N E;  2JA7 F;  4KN7 E;  2PPB E;  4LJZ E;  1DZF A;  3HKZ K;  5M5Y F;  5E18 E;  2JA6 F;  1I6H F;  5TMF E;  1WCM F;  4Q5S E;  4A3J E;  4A93 F;  4A3K E;  1SFO F;  4A3D F;  1Y1V F;  2PMZ H;  5IYD E;  2NVX E;  3GTG F;  5IP7 F;  4BBS F;  3PO2 E;  2A6H E;  3RZO E;  4YG2 E;  1I3Q E;  5C4X E;  3GTL E;  3S14 F;  3S1Q F;  5FLM E;  4AYB K;  4Y7N F;  3GTQ F;  3GTP E;  3S15 E;  1TWC F;  4Y52 E;  5M5Y E;  5M5W F;  1I6H E;  1SMY E;  2JA8 E;  4C2M F;  2A6E E;  1ZYR E;  2A69 E;  5IP9 F;  3PO3 E;  3S2D F;  4A3C F;  3GTM E;  3S16 E;  2NVY F;  5C44 F;  2R93 E;  3H3V F;  1I3Q F;  2NVT F;  3S2H F;  2CW0 E;  4YFK E;  3HOX F;  4LK1 E;  3GTQ E;  3DXJ E;  5M3F E;  3HOU E;  4BY1 F;  4Y52 F;  4A3G F;  5C4J F;  1QKL A;  1IW7 E;  1TWF F;  3CQZ F;  3RZD F;  2JA5 E;  4OIR E;  2B63 F;  2JA8 F;  2E2J F;  2NVQ F;  3PO3 F;  4A3L F;  4MQ9 E;  4BY7 F;  2Y0S I;  2JA6 E;  4YFX E;  4XLP E;  2A68 E;  2NVT E;  3HOX E;  1SFO E;  4A93 E;  3K7A F;  3GTO E;  5M3M F;  3HOU F;  3I4N E;  3GTG E;  1I50 E;  4A3G E;  4G7O E;  2WAQ K;  4A3I E;  1R9T E;  1TWG E;  4A3F E;  1Y1W F;  3GTP F;  3HOV E;  1TWC E;  2R7Z F;  4A3E F;  2YU9 F;  3M3Y F;  2O5I E;  1TWH E;  3H0G E;  4YFN E;  4G7Z E;  3RZO F;  4A3C E;  5IP9 E;  4BXX F;  5IYC F;  5D4D E;  3S15 F;  4A3I F;  4OIP E;  3S2H E;  5BYH E;  4OIO E;  1Y1W E;  4AYB H;  3HOY E;  4XSZ E;  1TWA F;  1YNJ K;  2KRX A;  2R7Z E;  5TMC E;  3WOD E;  4QIW H;  4C3H F;  3CQZ E;  3GTJ F;  4G7H E;  2JA5 F;  2YU9 E;  5IYB F;  2VUM F;  3M3Y E;  5IPL E;  4BXX E;  4BBR F;  3S17 F;  3GTK F;  4BY1 E;  1K83 E;  3M4O E;  4A3B E;  2R92 E;  4C3J E;  5C4J E;  4MEX E;  1HQM E;  2NVQ E;  5M3M E;  3K7A E;  3GTO F;  4A3L E;  2WB1 I;  5C3E F;  1YNN K;  4A3M E;  3HOZ F;  3S1N F;  4BY7 E;  4LLG E;  2VUM E;  3S1M F;  3HKZ H;  2E2H E; 
#chains in the Genus database with same CATH homology
 4OIQ E;  4C3I F;  4XLN E;  1R9T F;  5M5X F;  3I4M F;  3HOV F;  4QIW K;  4ZH4 E;  3M4O F;  1TWH F;  3H0G F;  4A3B F;  4A3K F;  5IYD F;  2NVX F;  1TWG F;  4A3F F;  4JK1 E;  1I50 F;  3S1R F;  4A3J F;  5E17 E;  3PO2 F;  4GZY E;  4KN4 E;  2E2I F;  3GTL F;  5D4C E;  5D4E E;  3S16 F;  2R93 F;  3HOY F;  4KMU E;  1K83 F;  3FKI F;  2R92 F;  2BE5 E;  4Q4Z E;  4LK0 E;  4OIN E;  5FJ8 F;  3GTM F;  2PMZ K;  4A3M F;  3EQL E;  2E2H F;  2O5J E;  4C3J F;  4MEY E;  4XSX E;  5M3F F;  3H3V G;  3HOW F;  5C4X F;  5FLM F;  3I4N F;  1I6V E;  2JA7 F;  4KN7 E;  2PPB E;  4LJZ E;  5E18 E;  3HKZ K;  5M5Y F;  2JA6 F;  1I6H F;  5TMF E;  1WCM F;  4Q5S E;  4A93 F;  4A3D F;  1SFO F;  1Y1V F;  3GTG F;  5IP7 F;  4BBS F;  2A6H E;  4YG2 E;  3S14 F;  3S1Q F;  4AYB K;  4Y7N F;  3GTQ F;  1TWC F;  5M5W F;  1SMY E;  4C2M F;  2A6E E;  1ZYR E;  2A69 E;  5IP9 F;  3S2D F;  4A3C F;  2NVY F;  5C44 F;  1I3Q F;  2NVT F;  3S2H F;  2CW0 E;  4YFK E;  3HOX F;  4LK1 E;  3DXJ E;  4BY1 F;  4Y52 F;  4A3G F;  5C4J F;  1QKL A;  1IW7 E;  1TWF F;  3CQZ F;  3RZD F;  4OIR E;  2B63 F;  2JA8 F;  2NVQ F;  2E2J F;  4A3L F;  3PO3 F;  4MQ9 E;  4BY7 F;  2Y0S I;  4YFX E;  4XLP E;  2A68 E;  3K7A F;  5M3M F;  3HOU F;  4G7O E;  2WAQ K;  1Y1W F;  3GTP F;  2R7Z F;  4A3E F;  2YU9 F;  2O5I E;  4YFN E;  3RZO F;  4G7Z E;  4BXX F;  5IYC F;  5D4D E;  3S15 F;  4A3I F;  4OIP E;  5BYH E;  4OIO E;  4XSZ E;  1TWA F;  1YNJ K;  2KRX A;  5TMC E;  3WOD E;  4C3H F;  3GTJ F;  4G7H E;  2JA5 F;  2VUM F;  5IYB F;  5IPL E;  4BBR F;  3S17 F;  3GTK F;  4MEX E;  1HQM E;  3GTO F;  2WB1 I;  5C3E F;  1YNN K;  3HOZ F;  3S1N F;  4LLG E;  3M3Y F;  3S1M F;  4X6A F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...