4BXXF

Arrested rna polymerase ii-bye1 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
84
structure length
84
Chain Sequence
KAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 28
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.940.10 Alpha Beta Alpha-Beta Complex Eukaryotic RPB6 RNA polymerase subunit Eukaryotic RPB6 RNA polymerase subunit 4bxxF00
5E18E 2PPBE 1YNNK 1SMYE 2BE5E 3H0GF 4A3KF 2NVQF 1TWGF 3HOZF 4OIQE 2E2IF 1Y1VF 4AYBK 2NVYF 2O5JE 4ZH4E 3I4MF 4A3DF 2JA6F 3H3VG 2R93F 2JA5F 3S2HF 4BBRF 4OINE 4Q4ZE 4MQ9E 3HOVF 4YFNE 4G7ZE 4XLNE 4A93F 5E17E 3WODE 3GTQF 4LJZE 4A3MF 3HOUF 3M3YF 4A3JF 4BY1F 5TMCE 1HQME 5M5WF 2YU9F 5D4DE 4MEXE 3FKIF 3HOWF 1I6VE 2JA7F 5BYHE 3K7AF 2A68E 2Y0SI 4LK1E 3HOYF 3GTKF 3DXJE 4KN7E 4C3JF 1I6HF 5IYCF 2PMZK 2WAQK 2VUMF 3S1NF 1TWCF 5FJ8F 2WB1I 4OIPE 4XSZE 5IYDF 4JK1E 2JA8F 4G7OE 5C3EF 2R92F 4KMUE 3S1MF 2A69E 4KN4E 3HKZK 5C44F 4Y52F 4BXXF 3GTPF 2O5IE 1WCMF 4A3EF 5D4CE 5IYBF 2E2JF 2A6HE 3RZOF 1TWFF 5M5XF 4C3IF 1TWHF 4LLGE 1I3QF 5TMFE 1Y1WF 2B63F 3S1RF 1ZYRE 4C2MF 4G7HE 4MEYE 3PO2F 3GTMF 5IPLE 2NVTF 4C3HF 5FLMF 1R9TF 1TWAF 4YFXE 3S16F 5IP9F 3S17F 5M5YF 4A3FF 3PO3F 5D4EE 4Q5SE 2A6EE 3I4NF 4XLPE 3GTJF 3CQZF 3M4OF 2CW0E 2E2HF 3RZDF 1QKLA 3S2DF 4YFKE 4A3BF 4XSXE 3HOXF 3EQLE 5M3FF 5M3MF 4A3LF 1K83F 4A3GF 3GTLF 4A3CF 4YG2E 4BBSF 1I50F 4LK0E 2R7ZF 3GTGF 4OIOE 4A3IF 5IP7F 2NVXF 5C4JF 3S15F 1YNJK 4BY7F 4X6AF 3S14F 1IW7E 3GTOF 4OIRE 4GZYE 1SFOF 5C4XF 4Y7NF 3S1QF
chains in the Genus database with same CATH superfamily
2R93E 5E18E 4Y7NE 1EIKA 2PPBE 1YNNK 1SMYE 2BE5E 3H0GF 4A3KF 4A3JE 2NVQF 1TWGF 2NVYE 3HOZF 4OIQE 3GTLE 2E2IF 1K83E 1Y1VF 4AYBK 2NVYF 3HOZE 4A3CE 2O5JE 4A3DE 4ZH4E 4QIWK 4A93E 3I4MF 4A3DF 2JA6F 3H3VG 1DZFA 2R93F 3H0GE 3GTJE 4BY7E 2JA5F 3S2HF 3GTOE 4A3LE 5C4JE 5IP9E 4BBRF 4OINE 2PMZH 4MQ9E 4Q4ZE 4YFNE 4G7ZE 3HOVF 2JA6E 4BBRE 5C4XE 4BBSE 4XLNE 4A93F 3M4OE 5E17E 3GTGE 3WODE 3PO2E 3GTQF 4LJZE 4A3MF 3HOUF 3M3YF 4A3JF 4BY1F 5TMCE 2NVQE 1HQME 5M5WF 3HOXE 3S14E 3HKZH 2YU9F 5M3ME 3RZDE 3S15E 5D4DE 4MEXE 2NVTE 3FKIF 3S1QE 3HOWF 1I6VE 2E2IE 1I50E 2R7ZE 2JA7F 4AYBH 5BYHE 3K7AF 2A68E 2B63E 2Y0SI 2WB1H 1Y1WE 4LK1E 3I4NE 3HOYF 4A3IE 3GTKF 2KRXA 3DXJE 4KN7E 4C3JF 5M5XE 1TWAE 1I6HF 5IYCF 2PMZK 2WAQK 2VUMF 3RZOE 3S2DE 1SFOE 5C4XF 3S1NF 1TWCF 4C3HE 5FJ8F 4A3FE 3PO3E 2WB1I 4OIPE 4XSZE 4JK1E 5IYDF 2JA8F 3S16E 4A3GE 4C2ME 2R92E 5M5YE 4G7OE 5IP7E 5C3EF 2NVXE 2R92F 4KMUE 3S1MF 4A3BE 2A69E 4KN4E 3HKZK 5C44F 4Y52F 5IYBE 2E2JE 5FLME 1R9TE 2O5IE 3GTPF 1WCMF 4C3IE 5D4CE 5IYBF 4A3EF 4BXXF 5C44E 2E2JF 3HOWE 2A6HE 3RZOF 1TWFF 1I6HE 5M5XF 4C3IF 1TWHF 5M3FE 4LLGE 1I3QF 5TMFE 1Y1WF 2B63F 1I3QE 3S1RF 2E2HE 1ZYRE 4C2MF 4G7HE 3GTQE 3CQZE 4MEYE 5IYCE 3GTMF 3PO2F 3S1ME 5IPLE 2NVTF 2WAQH 4C3HF 5FLMF 1R9TF 3H3VF 3HOYE 3PO3F 4BXXE 3S1NE 3S17E 1TWAF 4Y52E 4YFXE 4C3JE 3S16F 5IP9F 3S17F 3K7AE 5M5YF 1TWHE 1TWCE 5FJ8E 4A3FF 4Q5SE 5D4EE 2A6EE 3HOUE 5IYDE 4XLPE 3GTJF 2JA8E 3GTME 3I4NF 3CQZF 3M4OF 3GTKE 1WCME 4A3EE 2CW0E 3GTPE 3S1RE 2E2HF 3RZDF 2VUME 2YU9E 1QKLA 3S2DF 4YFKE 4A3BF 4XSXE 5M5WE 3EQLE 3HOXF 3I4ME 5M3FF 5M3MF 2JA5E 3S2HE 4A3LF 1K83F 4A3GF 1TWFE 3GTLF 4A3CF 4YG2E 4A3ME 2JA7E 4BBSF 1I50F 4LK0E 2R7ZF 3GTGF 4OIOE 4A3IF 5IP7F 5C3EE 5C4JF 2NVXF 3S15F 1YNJK 4BY1E 3S1QF 2Y0SH 1Y1VE 4BY7F 4X6AF 3S14F 1IW7E 1TWGE 4A3KE 3GTOF 4OIRE 4GZYE 4QIWH 1SFOF 4X6AE 3M3YE 3HOVE 4Y7NF 3FKIE
chains in the Genus database with same CATH topology
5E18E 2PPBE 1YNNK 1SMYE 2BE5E 3H0GF 4A3KF 2NVQF 1TWGF 3HOZF 4OIQE 2E2IF 1Y1VF 4AYBK 2NVYF 2O5JE 4ZH4E 4QIWK 3I4MF 4A3DF 2JA6F 3H3VG 2R93F 2JA5F 3S2HF 4BBRF 4OINE 4Q4ZE 4MQ9E 3HOVF 4YFNE 4G7ZE 4XLNE 4A93F 5E17E 3WODE 3GTQF 4LJZE 4A3MF 3HOUF 3M3YF 4A3JF 4BY1F 5TMCE 1HQME 5M5WF 2YU9F 5D4DE 4MEXE 3FKIF 3HOWF 1I6VE 2JA7F 5BYHE 3K7AF 2A68E 2Y0SI 4LK1E 3HOYF 3GTKF 2KRXA 3DXJE 4KN7E 4C3JF 1I6HF 5IYCF 2PMZK 2WAQK 2VUMF 3S1NF 1TWCF 5FJ8F 2WB1I 4OIPE 4XSZE 5IYDF 4JK1E 2JA8F 4G7OE 5C3EF 2R92F 4KMUE 3S1MF 2A69E 4KN4E 3HKZK 5C44F 4Y52F 4BXXF 3GTPF 2O5IE 1WCMF 4A3EF 5D4CE 5IYBF 2E2JF 2A6HE 3RZOF 1TWFF 5M5XF 4C3IF 1TWHF 4LLGE 1I3QF 5TMFE 1Y1WF 2B63F 3S1RF 1ZYRE 4C2MF 4G7HE 4MEYE 3PO2F 3GTMF 5IPLE 2NVTF 4C3HF 5FLMF 1R9TF 1TWAF 4YFXE 3S16F 5IP9F 3S17F 5M5YF 4A3FF 3PO3F 5D4EE 4Q5SE 2A6EE 3I4NF 4XLPE 3GTJF 3CQZF 3M4OF 2CW0E 2E2HF 3RZDF 1QKLA 3S2DF 4YFKE 4A3BF 4XSXE 3HOXF 3EQLE 5M3FF 5M3MF 4A3LF 1K83F 4A3GF 3GTLF 4A3CF 4YG2E 4BBSF 1I50F 4LK0E 2R7ZF 3GTGF 4OIOE 4A3IF 5IP7F 2NVXF 5C4JF 3S15F 1YNJK 4BY7F 4X6AF 3S14F 1IW7E 3GTOF 4OIRE 4GZYE 1SFOF 5C4XF 4Y7NF 3S1QF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E18 E;  2PPB E;  1YNN K;  1SMY E;  2BE5 E;  3H0G F;  4A3K F;  2NVQ F;  1TWG F;  3HOZ F;  4OIQ E;  2E2I F;  1Y1V F;  4AYB K;  2NVY F;  2O5J E;  4ZH4 E;  3I4M F;  4A3D F;  2JA6 F;  3H3V G;  2R93 F;  2JA5 F;  3S2H F;  4BBR F;  4OIN E;  4Q4Z E;  4MQ9 E;  3HOV F;  4YFN E;  4G7Z E;  4XLN E;  4A93 F;  5E17 E;  3WOD E;  3GTQ F;  4LJZ E;  4A3M F;  3HOU F;  3M3Y F;  4A3J F;  4BY1 F;  5TMC E;  1HQM E;  5M5W F;  2YU9 F;  5D4D E;  4MEX E;  3FKI F;  3HOW F;  1I6V E;  2JA7 F;  5BYH E;  3K7A F;  2A68 E;  2Y0S I;  4LK1 E;  3HOY F;  3GTK F;  3DXJ E;  4KN7 E;  4C3J F;  1I6H F;  5IYC F;  2PMZ K;  2WAQ K;  2VUM F;  3S1N F;  1TWC F;  5FJ8 F;  2WB1 I;  4OIP E;  4XSZ E;  5IYD F;  4JK1 E;  2JA8 F;  4G7O E;  5C3E F;  2R92 F;  4KMU E;  3S1M F;  2A69 E;  4KN4 E;  3HKZ K;  5C44 F;  4Y52 F;  4BXX F;  3GTP F;  2O5I E;  1WCM F;  4A3E F;  5D4C E;  5IYB F;  2E2J F;  2A6H E;  3RZO F;  1TWF F;  5M5X F;  4C3I F;  1TWH F;  4LLG E;  1I3Q F;  5TMF E;  1Y1W F;  2B63 F;  3S1R F;  1ZYR E;  4C2M F;  4G7H E;  4MEY E;  3PO2 F;  3GTM F;  5IPL E;  2NVT F;  4C3H F;  5FLM F;  1R9T F;  1TWA F;  4YFX E;  3S16 F;  5IP9 F;  3S17 F;  5M5Y F;  4A3F F;  3PO3 F;  5D4E E;  4Q5S E;  2A6E E;  3I4N F;  4XLP E;  3GTJ F;  3CQZ F;  3M4O F;  2CW0 E;  2E2H F;  3RZD F;  1QKL A;  3S2D F;  4YFK E;  4A3B F;  4XSX E;  3HOX F;  3EQL E;  5M3F F;  5M3M F;  4A3L F;  1K83 F;  4A3G F;  3GTL F;  4A3C F;  4YG2 E;  4BBS F;  1I50 F;  4LK0 E;  2R7Z F;  3GTG F;  4OIO E;  4A3I F;  5IP7 F;  2NVX F;  5C4J F;  3S15 F;  1YNJ K;  4BY7 F;  4X6A F;  3S14 F;  1IW7 E;  3GTO F;  4OIR E;  4GZY E;  1SFO F;  5C4X F;  4Y7N F;  3S1Q F; 
#chains in the Genus database with same CATH topology
 2R93 E;  5E18 E;  4Y7N E;  1EIK A;  2PPB E;  1YNN K;  1SMY E;  2BE5 E;  3H0G F;  4A3K F;  4A3J E;  2NVQ F;  1TWG F;  2NVY E;  3HOZ F;  4OIQ E;  3GTL E;  2E2I F;  1K83 E;  1Y1V F;  4AYB K;  2NVY F;  3HOZ E;  4A3C E;  2O5J E;  4A3D E;  4ZH4 E;  4QIW K;  4A93 E;  3I4M F;  4A3D F;  2JA6 F;  3H3V G;  1DZF A;  2R93 F;  3H0G E;  3GTJ E;  4BY7 E;  2JA5 F;  3S2H F;  3GTO E;  4A3L E;  5C4J E;  5IP9 E;  4BBR F;  4OIN E;  2PMZ H;  4MQ9 E;  4Q4Z E;  4YFN E;  4G7Z E;  3HOV F;  2JA6 E;  4BBR E;  5C4X E;  4BBS E;  4XLN E;  4A93 F;  3M4O E;  5E17 E;  3GTG E;  3WOD E;  3PO2 E;  3GTQ F;  4LJZ E;  4A3M F;  3HOU F;  3M3Y F;  4A3J F;  4BY1 F;  5TMC E;  2NVQ E;  1HQM E;  5M5W F;  3HOX E;  3S14 E;  3HKZ H;  2YU9 F;  5M3M E;  3RZD E;  3S15 E;  5D4D E;  4MEX E;  2NVT E;  3FKI F;  3S1Q E;  3HOW F;  1I6V E;  2E2I E;  1I50 E;  2R7Z E;  2JA7 F;  4AYB H;  5BYH E;  3K7A F;  2A68 E;  2B63 E;  2Y0S I;  2WB1 H;  1Y1W E;  4LK1 E;  3I4N E;  3HOY F;  4A3I E;  3GTK F;  2KRX A;  3DXJ E;  4KN7 E;  4C3J F;  5M5X E;  1TWA E;  1I6H F;  5IYC F;  2PMZ K;  2WAQ K;  2VUM F;  3RZO E;  3S2D E;  1SFO E;  5C4X F;  3S1N F;  1TWC F;  4C3H E;  5FJ8 F;  4A3F E;  3PO3 E;  2WB1 I;  4OIP E;  4XSZ E;  4JK1 E;  5IYD F;  2JA8 F;  3S16 E;  4A3G E;  4C2M E;  2R92 E;  5M5Y E;  4G7O E;  5IP7 E;  5C3E F;  2NVX E;  2R92 F;  4KMU E;  3S1M F;  4A3B E;  2A69 E;  4KN4 E;  3HKZ K;  5C44 F;  4Y52 F;  5IYB E;  2E2J E;  5FLM E;  1R9T E;  2O5I E;  3GTP F;  1WCM F;  4C3I E;  5D4C E;  5IYB F;  4A3E F;  4BXX F;  5C44 E;  2E2J F;  3HOW E;  2A6H E;  3RZO F;  1TWF F;  1I6H E;  5M5X F;  4C3I F;  1TWH F;  5M3F E;  4LLG E;  1I3Q F;  5TMF E;  1Y1W F;  2B63 F;  1I3Q E;  3S1R F;  2E2H E;  1ZYR E;  4C2M F;  4G7H E;  3GTQ E;  3CQZ E;  4MEY E;  5IYC E;  3GTM F;  3PO2 F;  3S1M E;  5IPL E;  2NVT F;  2WAQ H;  4C3H F;  5FLM F;  1R9T F;  3H3V F;  3HOY E;  3PO3 F;  4BXX E;  3S1N E;  3S17 E;  1TWA F;  4Y52 E;  4YFX E;  4C3J E;  3S16 F;  5IP9 F;  3S17 F;  3K7A E;  5M5Y F;  1TWH E;  1TWC E;  5FJ8 E;  4A3F F;  4Q5S E;  5D4E E;  2A6E E;  3HOU E;  5IYD E;  4XLP E;  3GTJ F;  2JA8 E;  3GTM E;  3I4N F;  3CQZ F;  3M4O F;  3GTK E;  1WCM E;  4A3E E;  2CW0 E;  3GTP E;  3S1R E;  2E2H F;  3RZD F;  2VUM E;  2YU9 E;  1QKL A;  3S2D F;  4YFK E;  4A3B F;  4XSX E;  5M5W E;  3EQL E;  3HOX F;  3I4M E;  5M3F F;  5M3M F;  2JA5 E;  3S2H E;  4A3L F;  1K83 F;  4A3G F;  1TWF E;  3GTL F;  4A3C F;  4YG2 E;  4A3M E;  2JA7 E;  4BBS F;  1I50 F;  4LK0 E;  2R7Z F;  3GTG F;  4OIO E;  4A3I F;  5IP7 F;  5C3E E;  5C4J F;  2NVX F;  3S15 F;  1YNJ K;  4BY1 E;  3S1Q F;  2Y0S H;  1Y1V E;  4BY7 F;  4X6A F;  3S14 F;  1IW7 E;  1TWG E;  4A3K E;  3GTO F;  4OIR E;  4GZY E;  4QIW H;  1SFO F;  4X6A E;  3M3Y E;  3HOV E;  4Y7N F;  3FKI E; 
#chains in the Genus database with same CATH homology
 5E18 E;  2PPB E;  1YNN K;  1SMY E;  2BE5 E;  3H0G F;  4A3K F;  2NVQ F;  1TWG F;  3HOZ F;  4OIQ E;  2E2I F;  1Y1V F;  4AYB K;  2NVY F;  2O5J E;  4ZH4 E;  4QIW K;  3I4M F;  4A3D F;  2JA6 F;  3H3V G;  2R93 F;  2JA5 F;  3S2H F;  4BBR F;  4OIN E;  4Q4Z E;  4MQ9 E;  3HOV F;  4YFN E;  4G7Z E;  4XLN E;  4A93 F;  5E17 E;  3WOD E;  3GTQ F;  4LJZ E;  4A3M F;  3HOU F;  3M3Y F;  4A3J F;  4BY1 F;  5TMC E;  1HQM E;  5M5W F;  2YU9 F;  5D4D E;  4MEX E;  3FKI F;  3HOW F;  1I6V E;  2JA7 F;  5BYH E;  3K7A F;  2A68 E;  2Y0S I;  4LK1 E;  3HOY F;  3GTK F;  2KRX A;  3DXJ E;  4KN7 E;  4C3J F;  1I6H F;  5IYC F;  2PMZ K;  2WAQ K;  2VUM F;  3S1N F;  1TWC F;  5FJ8 F;  2WB1 I;  4OIP E;  4XSZ E;  5IYD F;  4JK1 E;  2JA8 F;  4G7O E;  5C3E F;  2R92 F;  4KMU E;  3S1M F;  2A69 E;  4KN4 E;  3HKZ K;  5C44 F;  4Y52 F;  4BXX F;  3GTP F;  2O5I E;  1WCM F;  4A3E F;  5D4C E;  5IYB F;  2E2J F;  2A6H E;  3RZO F;  1TWF F;  5M5X F;  4C3I F;  1TWH F;  4LLG E;  1I3Q F;  5TMF E;  1Y1W F;  2B63 F;  3S1R F;  1ZYR E;  4C2M F;  4G7H E;  4MEY E;  3PO2 F;  3GTM F;  5IPL E;  2NVT F;  4C3H F;  5FLM F;  1R9T F;  1TWA F;  4YFX E;  3S16 F;  5IP9 F;  3S17 F;  5M5Y F;  4A3F F;  3PO3 F;  5D4E E;  4Q5S E;  2A6E E;  3I4N F;  4XLP E;  3GTJ F;  3CQZ F;  3M4O F;  2CW0 E;  2E2H F;  3RZD F;  1QKL A;  3S2D F;  4YFK E;  4A3B F;  4XSX E;  3HOX F;  3EQL E;  5M3F F;  5M3M F;  4A3L F;  1K83 F;  4A3G F;  3GTL F;  4A3C F;  4YG2 E;  4BBS F;  1I50 F;  4LK0 E;  2R7Z F;  3GTG F;  4OIO E;  4A3I F;  5IP7 F;  2NVX F;  5C4J F;  3S15 F;  1YNJ K;  4BY7 F;  4X6A F;  3S14 F;  1IW7 E;  3GTO F;  4OIR E;  4GZY E;  1SFO F;  5C4X F;  4Y7N F;  3S1Q F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...