4GZYE

Crystal structures of bacterial rna polymerase paused elongation complexes
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLVPEDRLQKEMERLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcriptional pausing in bacteria.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 17
structure length 93
sequence length 93
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.940.10 Alpha Beta Alpha-Beta Complex Eukaryotic RPB6 RNA polymerase subunit Eukaryotic RPB6 RNA polymerase subunit 4gzyE00
4G7ZE 4A3LF 4BXXF 4A3EF 3I4MF 4A3GF 2YU9F 2JA7F 2PMZK 4A3KF 2R7ZF 3HOYF 1ZYRE 3S2HF 2O5IE 4C3JF 5IYCF 3GTLF 1TWAF 3FKIF 3GTJF 2BE5E 4BBSF 4A3IF 4YFXE 2R92F 1Y1VF 5E18E 5M3MF 1HQME 3CQZF 3S1RF 3S2DF 3DXJE 1SMYE 4MEYE 2E2IF 5IYBF 5FJ8F 5C4JF 3M4OF 4XLNE 2A68E 5IP7F 2WAQK 2PPBE 4A3DF 4AYBK 5IYDF 4XLPE 3HOZF 2E2JF 4Y52F 5TMCE 3I4NF 4KN4E 2NVTF 3EQLE 3RZDF 4MQ9E 4BY7F 4XSXE 5M5WF 3RZOF 2JA6F 4KMUE 4Q4ZE 5E17E 3WODE 4Q5SE 3S16F 4G7OE 3PO2F 4A3FF 1Y1WF 4JK1E 5D4DE 3GTQF 4MEXE 4A3CF 2VUMF 3H3VG 4YG2E 1I6HF 1K83F 5D4CE 3GTMF 3GTOF 4A93F 4G7HE 4LK0E 2O5JE 2NVQF 4C2MF 4Y7NF 5D4EE 3PO3F 2E2HF 1TWFF 1YNNK 4KN7E 4BBRF 3HOWF 1IW7E 1TWGF 4XSZE 4OIPE 5C4XF 5TMFE 5M3FF 3S14F 2A69E 4LK1E 2NVYF 3S1QF 4OIRE 3H0GF 4LJZE 3HOXF 4A3JF 4YFNE 2Y0SI 5C3EF 4BY1F 3S15F 3HOVF 2A6EE 2JA5F 5FLMF 2NVXF 1TWCF 3HOUF 5BYHE 1QKLA 4C3IF 5M5YF 1TWHF 1WCMF 2R93F 4OIOE 4OINE 3K7AF 4ZH4E 3GTPF 3GTGF 2B63F 1R9TF 5IPLE 5IP9F 1I6VE 3S17F 4GZYE 2CW0E 3HKZK 5M5XF 4OIQE 3S1MF 3M3YF 3S1NF 4X6AF 4A3BF 2A6HE 5C44F 4LLGE 1SFOF 1YNJK 3GTKF 1I50F 1I3QF 4YFKE 2JA8F 4A3MF 4C3HF 2WB1I
chains in the Genus database with same CATH superfamily
4G7ZE 3I4ME 4A3LF 5FLME 4BXXF 4A3EF 3I4MF 4A3LE 4A3GF 3S16E 2YU9F 2JA7F 2E2JE 2NVQE 2PMZK 4A3KF 3S1RE 2R7ZF 3S17E 4C3JE 3HOYF 1ZYRE 3S2HF 2O5IE 2R7ZE 4C3JF 4BY7E 5IYCF 3GTLF 2Y0SH 1TWAF 1TWGE 3M4OE 3FKIF 3GTJF 2BE5E 4A3DE 4A3ME 4BBSF 4A3IF 4YFXE 2R92F 1Y1VF 5E18E 5M3MF 1TWHE 1HQME 3CQZF 2WB1H 2JA7E 4A3KE 3S1RF 3S2DF 5C44E 3GTPE 3DXJE 1SMYE 4MEYE 5IYBE 5FJ8E 2E2IF 4A3BE 4BBRE 3HOWE 1I6HE 5IYBF 5FJ8F 3HOVE 5C4JF 3M4OF 4XLNE 3GTOE 2A68E 5IP7F 1Y1WE 2WAQK 2PPBE 4A3FE 4A3DF 4AYBK 5IYDF 4XLPE 3HOZF 2E2JF 4Y52F 5M5XE 2YU9E 3S1QE 5TMCE 3I4NF 3S1ME 3H0GE 4KN4E 3S1NE 2NVTF 3CQZE 3EQLE 3RZDF 2JA8F 3S2HE 3RZOE 2R93E 4Y52E 4BY7F 4MQ9E 4XSXE 5M5WF 2JA8E 1I3QE 1I50E 2JA6F 3RZOF 5M3FE 4KMUE 2KRXA 4Q4ZE 3WODE 3GTJE 5E17E 4BXXE 4Q5SE 2JA5E 2NVYE 3S16F 4G7OE 3PO2F 4C2ME 4A3FF 1Y1WF 5IYDE 4JK1E 3HOZE 3HOYE 4C3HF 4C3IE 5D4DE 2VUME 3GTQF 4MEXE 4A3CF 2VUMF 3H3VG 4YG2E 3M3YE 4X6AE 2PMZH 3RZDE 1I6HF 3FKIE 3S1NF 3GTME 1K83F 5D4CE 3GTMF 3GTOF 4A93F 4G7HE 4LK0E 1DZFA 3HKZH 2R92E 2O5JE 5M3ME 1Y1VE 2NVQF 5IP9E 5M5YE 4A3JE 4C2MF 4Y7NF 5D4EE 3HOUE 3PO3F 2E2HF 1TWFF 1YNNK 4KN7E 4BBRF 2E2HE 3HOWF 1IW7E 1TWAE 1TWGF 4A3CE 4XSZE 4OIPE 4BY1E 3S15E 5C4XF 1SFOE 5M3FF 1EIKA 1R9TE 3S14F 2A69E 4A93E 5C4XE 4LK1E 3PO2E 2NVYF 2NVXE 3S1QF 4OIRE 4A3GE 3H0GF 4LJZE 3HOXF 3PO3E 1WCME 4A3JF 4YFNE 2Y0SI 5C4JE 5C3EF 2B63E 4BY1F 3S15F 3HOVF 2A6EE 2JA5F 4A3EE 3S14E 5FLMF 2NVXF 1TWCF 3H3VF 4Y7NE 3HOUF 5BYHE 1QKLA 4C3IF 5M5YF 1TWCE 1TWHF 3GTQE 1WCMF 4QIWH 2R93F 3HOXE 4OIOE 4OINE 3K7AF 2NVTE 4ZH4E 4QIWK 3GTGE 3GTPF 1K83E 3GTLE 3GTGF 2WAQH 5C3EE 2B63F 1R9TF 4AYBH 2JA6E 5IPLE 5IP7E 4A3IE 5IP9F 1I6VE 3S17F 4GZYE 1TWFE 2CW0E 3HKZK 5M5XF 4OIQE 3I4NE 3M3YF 3S1MF 3S2DE 2E2IE 5IYCE 4A3BF 2A6HE 5C44F 4X6AF 3K7AE 4LLGE 3GTKE 1SFOF 1YNJK 4C3HE 1I50F 1I3QF 4YFKE 5M5WE 3GTKF 4A3MF 5TMFE 2WB1I 4BBSE
chains in the Genus database with same CATH topology
4G7ZE 4A3LF 4BXXF 4A3EF 3I4MF 4A3GF 2YU9F 2JA7F 2PMZK 4A3KF 2R7ZF 3HOYF 1ZYRE 3S2HF 2O5IE 4C3JF 5IYCF 3GTLF 1TWAF 3FKIF 3GTJF 2BE5E 4BBSF 4A3IF 4YFXE 2R92F 1Y1VF 5E18E 5M3MF 1HQME 3CQZF 3S1RF 3S2DF 3DXJE 1SMYE 4MEYE 2E2IF 5IYBF 5FJ8F 5C4JF 3M4OF 4XLNE 2A68E 5IP7F 2WAQK 2PPBE 4A3DF 4AYBK 5IYDF 4XLPE 3HOZF 2E2JF 4Y52F 5TMCE 3I4NF 4KN4E 2NVTF 3EQLE 3RZDF 4MQ9E 4BY7F 4XSXE 5M5WF 3RZOF 2JA6F 4KMUE 2KRXA 4Q4ZE 3WODE 5E17E 4Q5SE 3S16F 4G7OE 3PO2F 4A3FF 1Y1WF 4JK1E 5D4DE 3GTQF 4MEXE 4A3CF 2VUMF 3H3VG 4YG2E 1I6HF 1K83F 5D4CE 3GTMF 3GTOF 4A93F 4G7HE 4LK0E 2O5JE 2NVQF 4C2MF 4Y7NF 5D4EE 3PO3F 2E2HF 1TWFF 1YNNK 4KN7E 4BBRF 3HOWF 1IW7E 1TWGF 4XSZE 4OIPE 5C4XF 5TMFE 5M3FF 3S14F 2A69E 4LK1E 2NVYF 3S1QF 4OIRE 3H0GF 4LJZE 3HOXF 4A3JF 4YFNE 2Y0SI 5C3EF 4BY1F 3S15F 3HOVF 2A6EE 2JA5F 5FLMF 2NVXF 1TWCF 3HOUF 5BYHE 1QKLA 4C3IF 5M5YF 1TWHF 1WCMF 2R93F 4OIOE 4OINE 3K7AF 4ZH4E 4QIWK 3GTPF 3GTGF 2B63F 1R9TF 5IPLE 5IP9F 1I6VE 3S17F 4GZYE 2CW0E 3HKZK 5M5XF 4OIQE 3S1MF 3M3YF 3S1NF 4X6AF 4A3BF 2A6HE 5C44F 4LLGE 1SFOF 1YNJK 3GTKF 1I50F 1I3QF 4YFKE 2JA8F 4A3MF 4C3HF 2WB1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7Z E;  4A3L F;  4BXX F;  4A3E F;  3I4M F;  4A3G F;  2YU9 F;  2JA7 F;  2PMZ K;  4A3K F;  2R7Z F;  3HOY F;  1ZYR E;  3S2H F;  2O5I E;  4C3J F;  5IYC F;  3GTL F;  1TWA F;  3FKI F;  3GTJ F;  2BE5 E;  4BBS F;  4A3I F;  4YFX E;  2R92 F;  1Y1V F;  5E18 E;  5M3M F;  1HQM E;  3CQZ F;  3S1R F;  3S2D F;  3DXJ E;  1SMY E;  4MEY E;  2E2I F;  5IYB F;  5FJ8 F;  5C4J F;  3M4O F;  4XLN E;  2A68 E;  5IP7 F;  2WAQ K;  2PPB E;  4A3D F;  4AYB K;  5IYD F;  4XLP E;  3HOZ F;  2E2J F;  4Y52 F;  5TMC E;  3I4N F;  4KN4 E;  2NVT F;  3EQL E;  3RZD F;  4MQ9 E;  4BY7 F;  4XSX E;  5M5W F;  3RZO F;  2JA6 F;  4KMU E;  4Q4Z E;  5E17 E;  3WOD E;  4Q5S E;  3S16 F;  4G7O E;  3PO2 F;  4A3F F;  1Y1W F;  4JK1 E;  5D4D E;  3GTQ F;  4MEX E;  4A3C F;  2VUM F;  3H3V G;  4YG2 E;  1I6H F;  1K83 F;  5D4C E;  3GTM F;  3GTO F;  4A93 F;  4G7H E;  4LK0 E;  2O5J E;  2NVQ F;  4C2M F;  4Y7N F;  5D4E E;  3PO3 F;  2E2H F;  1TWF F;  1YNN K;  4KN7 E;  4BBR F;  3HOW F;  1IW7 E;  1TWG F;  4XSZ E;  4OIP E;  5C4X F;  5TMF E;  5M3F F;  3S14 F;  2A69 E;  4LK1 E;  2NVY F;  3S1Q F;  4OIR E;  3H0G F;  4LJZ E;  3HOX F;  4A3J F;  4YFN E;  2Y0S I;  5C3E F;  4BY1 F;  3S15 F;  3HOV F;  2A6E E;  2JA5 F;  5FLM F;  2NVX F;  1TWC F;  3HOU F;  5BYH E;  1QKL A;  4C3I F;  5M5Y F;  1TWH F;  1WCM F;  2R93 F;  4OIO E;  4OIN E;  3K7A F;  4ZH4 E;  3GTP F;  3GTG F;  2B63 F;  1R9T F;  5IPL E;  5IP9 F;  1I6V E;  3S17 F;  4GZY E;  2CW0 E;  3HKZ K;  5M5X F;  4OIQ E;  3S1M F;  3M3Y F;  3S1N F;  4X6A F;  4A3B F;  2A6H E;  5C44 F;  4LLG E;  1SFO F;  1YNJ K;  3GTK F;  1I50 F;  1I3Q F;  4YFK E;  2JA8 F;  4A3M F;  4C3H F;  2WB1 I; 
#chains in the Genus database with same CATH topology
 4G7Z E;  3I4M E;  4A3L F;  5FLM E;  4BXX F;  4A3E F;  3I4M F;  4A3L E;  4A3G F;  3S16 E;  2YU9 F;  2JA7 F;  2E2J E;  2NVQ E;  2PMZ K;  4A3K F;  3S1R E;  2R7Z F;  3S17 E;  4C3J E;  3HOY F;  1ZYR E;  3S2H F;  2O5I E;  2R7Z E;  4C3J F;  4BY7 E;  5IYC F;  3GTL F;  2Y0S H;  1TWA F;  1TWG E;  3M4O E;  3FKI F;  3GTJ F;  2BE5 E;  4A3D E;  4A3M E;  4BBS F;  4A3I F;  4YFX E;  2R92 F;  1Y1V F;  5E18 E;  5M3M F;  1TWH E;  1HQM E;  3CQZ F;  2WB1 H;  2JA7 E;  4A3K E;  3S1R F;  3S2D F;  5C44 E;  3GTP E;  3DXJ E;  1SMY E;  4MEY E;  5IYB E;  5FJ8 E;  2E2I F;  4A3B E;  4BBR E;  3HOW E;  1I6H E;  5IYB F;  5FJ8 F;  3HOV E;  5C4J F;  3M4O F;  4XLN E;  3GTO E;  2A68 E;  5IP7 F;  1Y1W E;  2WAQ K;  2PPB E;  4A3F E;  4A3D F;  4AYB K;  5IYD F;  4XLP E;  3HOZ F;  2E2J F;  4Y52 F;  5M5X E;  2YU9 E;  3S1Q E;  5TMC E;  3I4N F;  3S1M E;  3H0G E;  4KN4 E;  3S1N E;  2NVT F;  3CQZ E;  3EQL E;  3RZD F;  2JA8 F;  3S2H E;  3RZO E;  2R93 E;  4Y52 E;  4BY7 F;  4MQ9 E;  4XSX E;  5M5W F;  2JA8 E;  1I3Q E;  1I50 E;  2JA6 F;  3RZO F;  5M3F E;  4KMU E;  2KRX A;  4Q4Z E;  3WOD E;  3GTJ E;  5E17 E;  4BXX E;  4Q5S E;  2JA5 E;  2NVY E;  3S16 F;  4G7O E;  3PO2 F;  4C2M E;  4A3F F;  1Y1W F;  5IYD E;  4JK1 E;  3HOZ E;  3HOY E;  4C3H F;  4C3I E;  5D4D E;  2VUM E;  3GTQ F;  4MEX E;  4A3C F;  2VUM F;  3H3V G;  4YG2 E;  3M3Y E;  4X6A E;  2PMZ H;  3RZD E;  1I6H F;  3FKI E;  3S1N F;  3GTM E;  1K83 F;  5D4C E;  3GTM F;  3GTO F;  4A93 F;  4G7H E;  4LK0 E;  1DZF A;  3HKZ H;  2R92 E;  2O5J E;  5M3M E;  1Y1V E;  2NVQ F;  5IP9 E;  5M5Y E;  4A3J E;  4C2M F;  4Y7N F;  5D4E E;  3HOU E;  3PO3 F;  2E2H F;  1TWF F;  1YNN K;  4KN7 E;  4BBR F;  2E2H E;  3HOW F;  1IW7 E;  1TWA E;  1TWG F;  4A3C E;  4XSZ E;  4OIP E;  4BY1 E;  3S15 E;  5C4X F;  1SFO E;  5M3F F;  1EIK A;  1R9T E;  3S14 F;  2A69 E;  4A93 E;  5C4X E;  4LK1 E;  3PO2 E;  2NVY F;  2NVX E;  3S1Q F;  4OIR E;  4A3G E;  3H0G F;  4LJZ E;  3HOX F;  3PO3 E;  1WCM E;  4A3J F;  4YFN E;  2Y0S I;  5C4J E;  5C3E F;  2B63 E;  4BY1 F;  3S15 F;  3HOV F;  2A6E E;  2JA5 F;  4A3E E;  3S14 E;  5FLM F;  2NVX F;  1TWC F;  3H3V F;  4Y7N E;  3HOU F;  5BYH E;  1QKL A;  4C3I F;  5M5Y F;  1TWC E;  1TWH F;  3GTQ E;  1WCM F;  4QIW H;  2R93 F;  3HOX E;  4OIO E;  4OIN E;  3K7A F;  2NVT E;  4ZH4 E;  4QIW K;  3GTG E;  3GTP F;  1K83 E;  3GTL E;  3GTG F;  2WAQ H;  5C3E E;  2B63 F;  1R9T F;  4AYB H;  2JA6 E;  5IPL E;  5IP7 E;  4A3I E;  5IP9 F;  1I6V E;  3S17 F;  4GZY E;  1TWF E;  2CW0 E;  3HKZ K;  5M5X F;  4OIQ E;  3I4N E;  3M3Y F;  3S1M F;  3S2D E;  2E2I E;  5IYC E;  4A3B F;  2A6H E;  5C44 F;  4X6A F;  3K7A E;  4LLG E;  3GTK E;  1SFO F;  1YNJ K;  4C3H E;  1I50 F;  1I3Q F;  4YFK E;  5M5W E;  3GTK F;  4A3M F;  5TMF E;  2WB1 I;  4BBS E; 
#chains in the Genus database with same CATH homology
 4G7Z E;  4A3L F;  4BXX F;  4A3E F;  3I4M F;  4A3G F;  2YU9 F;  2JA7 F;  2PMZ K;  4A3K F;  2R7Z F;  3HOY F;  1ZYR E;  3S2H F;  2O5I E;  4C3J F;  5IYC F;  3GTL F;  1TWA F;  3FKI F;  3GTJ F;  2BE5 E;  4BBS F;  4A3I F;  4YFX E;  2R92 F;  1Y1V F;  5E18 E;  5M3M F;  1HQM E;  3CQZ F;  3S1R F;  3S2D F;  3DXJ E;  1SMY E;  4MEY E;  2E2I F;  5IYB F;  5FJ8 F;  5C4J F;  3M4O F;  4XLN E;  2A68 E;  5IP7 F;  2WAQ K;  2PPB E;  4A3D F;  4AYB K;  5IYD F;  4XLP E;  3HOZ F;  2E2J F;  4Y52 F;  5TMC E;  3I4N F;  4KN4 E;  2NVT F;  3EQL E;  3RZD F;  4MQ9 E;  4BY7 F;  4XSX E;  5M5W F;  3RZO F;  2JA6 F;  4KMU E;  2KRX A;  4Q4Z E;  3WOD E;  5E17 E;  4Q5S E;  3S16 F;  4G7O E;  3PO2 F;  4A3F F;  1Y1W F;  4JK1 E;  5D4D E;  3GTQ F;  4MEX E;  4A3C F;  2VUM F;  3H3V G;  4YG2 E;  1I6H F;  1K83 F;  5D4C E;  3GTM F;  3GTO F;  4A93 F;  4G7H E;  4LK0 E;  2O5J E;  2NVQ F;  4C2M F;  4Y7N F;  5D4E E;  3PO3 F;  2E2H F;  1TWF F;  1YNN K;  4KN7 E;  4BBR F;  3HOW F;  1IW7 E;  1TWG F;  4XSZ E;  4OIP E;  5C4X F;  5TMF E;  5M3F F;  3S14 F;  2A69 E;  4LK1 E;  2NVY F;  3S1Q F;  4OIR E;  3H0G F;  4LJZ E;  3HOX F;  4A3J F;  4YFN E;  2Y0S I;  5C3E F;  4BY1 F;  3S15 F;  3HOV F;  2A6E E;  2JA5 F;  5FLM F;  2NVX F;  1TWC F;  3HOU F;  5BYH E;  1QKL A;  4C3I F;  5M5Y F;  1TWH F;  1WCM F;  2R93 F;  4OIO E;  4OIN E;  3K7A F;  4ZH4 E;  4QIW K;  3GTP F;  3GTG F;  2B63 F;  1R9T F;  5IPL E;  5IP9 F;  1I6V E;  3S17 F;  4GZY E;  2CW0 E;  3HKZ K;  5M5X F;  4OIQ E;  3S1M F;  3M3Y F;  3S1N F;  4X6A F;  4A3B F;  2A6H E;  5C44 F;  4LLG E;  1SFO F;  1YNJ K;  3GTK F;  1I50 F;  1I3Q F;  4YFK E;  2JA8 F;  4A3M F;  4C3H F;  2WB1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...