The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
59
|
sequence length |
201
|
structure length |
181
|
Chain Sequence |
MPGFYEIVIKVPSEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDESYIPNFLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural Insights into the Assembly of the Adeno-associated Virus Type 2 Rep68 Protein on the Integration Site AAVS1.
pubmed doi rcsb |
| molecule keywords |
Protein Rep78
|
| molecule tags |
Dna binding protein/dna
|
| source organism |
Adeno-associated virus 2
|
| total genus |
59
|
| structure length |
181
|
| sequence length |
201
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2015-06-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF08724 | Rep_N | Rep protein catalytic domain like |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Replication Protein E1; Chain: A, | Replication Protein E1; Chain: A, |
#chains in the Genus database with same CATH superfamily 1L5I A; 2IF9 A; 5DCX A; 5BYG A; 4FGN A; 2NTC A; 3QN2 A; 4GDF A; 3QK2 A; 4NBP A; 1Z1D B; 2NL8 A; 2IPR A; 4FB3 A; 2FUF A; 1RZ9 A; 5D9I A; 4ZQ9 A; 2HW0 A; 4LIF A; 4ZO0 A; 5CYN A; 1UUT A; 1M55 A; 4LMD A; 1TBD A; 2ITJ A; 3QFQ A; 1L2M A; 2TBD A; 2ITL A; #chains in the Genus database with same CATH topology 1L5I A; 2IF9 A; 4U87 A; 5DCX A; 5BYG A; 4FGN A; 2NTC A; 3QN2 A; 4GDF A; 3QK2 A; 4KW3 A; 4NBP A; 1Z1D B; 2NL8 A; 2IPR A; 4FB3 A; 2FUF A; 1RZ9 A; 5D9I A; 1F08 A; 3DKX A; 4ZQ9 A; 2HW0 A; 1KSX A; 4LIF A; 4ZO0 A; 3DKY A; 5CYN A; 1KSY A; 1UUT A; 1M55 A; 4LMD A; 1TBD A; 2ITJ A; 3QFQ A; 1L2M A; 2TBD A; 2ITL A; 1R9W A; #chains in the Genus database with same CATH homology 1L5I A; 2IF9 A; 4U87 A; 5DCX A; 5BYG A; 4FGN A; 2NTC A; 3QN2 A; 4GDF A; 3QK2 A; 4KW3 A; 4NBP A; 1Z1D B; 2NL8 A; 2IPR A; 4FB3 A; 2FUF A; 1RZ9 A; 5D9I A; 1F08 A; 3DKX A; 4ZQ9 A; 2HW0 A; 1KSX A; 4LIF A; 4ZO0 A; 3DKY A; 5CYN A; 1KSY A; 1UUT A; 1M55 A; 4LMD A; 1TBD A; 2ITJ A; 3QFQ A; 1L2M A; 2TBD A; 2ITL A; 1R9W A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...