The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
32
|
sequence length |
127
|
structure length |
127
|
Chain Sequence |
VEDPKDFPVDLHAFLSQAVFSNRTVASFAVYTTKEKAQILYKKLMEKYSVTFISRHGFGGHNILFFLTPHRHRVSAINNYCQKLCTFSFLICKGVNKEYLFYSALCRQPYAVVEESIQGGLKEHDLN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural Based Analyses of the JC Virus T-Antigen F258L Mutant Provides Evidence for DNA Dependent Conformational Changes in the C-Termini of Polyomavirus Origin Binding Domains.
pubmed doi rcsb |
| molecule tags |
Viral protein, dna binding protein
|
| source organism |
Jc polyomavirus
|
| molecule keywords |
Large T antigen
|
| total genus |
32
|
| structure length |
127
|
| sequence length |
127
|
| ec nomenclature |
ec
3.6.4.-: |
| pdb deposition date | 2015-07-30 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02217 | T_Ag_DNA_bind | Origin of replication binding protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Replication Protein E1; Chain: A, | Replication Protein E1; Chain: A, |
#chains in the Genus database with same CATH superfamily 1Z1D B; 4LIF A; 2HW0 A; 2NL8 A; 2IPR A; 5CYN A; 1RZ9 A; 2TBD A; 3QN2 A; 5DCX A; 5BYG A; 2FUF A; 4ZO0 A; 1UUT A; 1M55 A; 4ZQ9 A; 4GDF A; 3QFQ A; 5D9I A; 4NBP A; 4FGN A; 4FB3 A; 1L5I A; 4LMD A; 2ITJ A; 1L2M A; 2ITL A; 1TBD A; 3QK2 A; 2NTC A; 2IF9 A; #chains in the Genus database with same CATH topology 1Z1D B; 4LIF A; 2HW0 A; 2NL8 A; 2IPR A; 5CYN A; 4U87 A; 1KSX A; 4KW3 A; 1RZ9 A; 2TBD A; 3QN2 A; 5DCX A; 5BYG A; 1KSY A; 2FUF A; 4ZO0 A; 3DKY A; 1UUT A; 1M55 A; 1F08 A; 4ZQ9 A; 4GDF A; 3QFQ A; 5D9I A; 1R9W A; 4NBP A; 4FGN A; 4FB3 A; 1L5I A; 4LMD A; 2ITJ A; 1L2M A; 2ITL A; 1TBD A; 3QK2 A; 2NTC A; 2IF9 A; 3DKX A; #chains in the Genus database with same CATH homology 1Z1D B; 4LIF A; 2HW0 A; 2NL8 A; 2IPR A; 5CYN A; 4U87 A; 1KSX A; 4KW3 A; 1RZ9 A; 2TBD A; 3QN2 A; 5DCX A; 5BYG A; 1KSY A; 2FUF A; 4ZO0 A; 3DKY A; 1UUT A; 1M55 A; 1F08 A; 4ZQ9 A; 4GDF A; 3QFQ A; 5D9I A; 1R9W A; 4NBP A; 4FGN A; 4FB3 A; 1L5I A; 4LMD A; 2ITJ A; 1L2M A; 2ITL A; 1TBD A; 3QK2 A; 2NTC A; 2IF9 A; 3DKX A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
