5E17E

T. thermophilus transcription initiation complex having a rrr discriminator sequence and a nontemplate-strand length corresponding to tss selection at position 7 (rpo-ggg-7)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
94
structure length
94
Chain Sequence
AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLVPEDRLQKEMERLYPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiplexed protein-DNA cross-linking: Scrunching in transcription start site selection.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 24
structure length 94
sequence length 94
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.940.10 Alpha Beta Alpha-Beta Complex Eukaryotic RPB6 RNA polymerase subunit Eukaryotic RPB6 RNA polymerase subunit 5e17E00
3WODE 4GZYE 4A3LF 3FKIF 1IW7E 3M3YF 1TWGF 4A3EF 1Y1WF 3S1NF 5C4XF 5FLMF 3GTKF 3H0GF 5FJ8F 4YFKE 2A6HE 1I6VE 2CW0E 4Q5SE 2B63F 3K7AF 3S15F 5C3EF 5IYDF 2R92F 4MEXE 4A3KF 4Q4ZE 4OIPE 3M4OF 4BXXF 2PMZK 4X6AF 4KN4E 3S14F 2A6EE 4A3CF 4ZH4E 1WCMF 2WB1I 4OIOE 3HOZF 4Y7NF 4LLGE 5IP9F 5E18E 5TMCE 5C4JF 3GTJF 4A3BF 3PO2F 5M3FF 4OINE 5C44F 5E17E 3HOWF 5M5YF 4XSZE 2E2IF 4KMUE 2VUMF 4A3IF 1TWHF 4BY1F 5M5WF 2NVYF 3HOYF 2JA6F 3S1QF 1SMYE 4KN7E 1SFOF 4YFNE 3GTMF 5IPLE 4XLNE 1TWCF 3GTPF 4YFXE 3S1MF 4MEYE 2R93F 4MQ9E 4OIRE 1K83F 2O5JE 4C3JF 4A93F 1I50F 4A3FF 4A3DF 4G7HE 4LK1E 2JA7F 2Y0SI 2R7ZF 1I6HF 4OIQE 3RZDF 4LK0E 3S16F 1YNJK 5IYCF 3HOVF 1TWFF 1ZYRE 5M5XF 4YG2E 3DXJE 1YNNK 3CQZF 3GTQF 4AYBK 4XLPE 5IYBF 3S2HF 1QKLA 5M3MF 1HQME 2YU9F 3HOXF 3HKZK 3GTLF 4A3MF 3I4NF 2NVQF 4XSXE 1R9TF 3HOUF 4BY7F 5BYHE 2O5IE 1TWAF 4C3HF 3S1RF 4C2MF 2A69E 5IP7F 4G7ZE 4BBRF 3GTGF 4BBSF 2BE5E 2E2JF 5D4DE 2JA8F 2E2HF 2PPBE 1Y1VF 3H3VG 3S17F 4A3JF 4C3IF 2WAQK 5D4CE 2JA5F 2NVTF 3GTOF 3PO3F 5D4EE 4Y52F 4LJZE 3I4MF 3S2DF 4G7OE 4A3GF 3EQLE 4JK1E 2NVXF 1I3QF 5TMFE 3RZOF 2A68E
chains in the Genus database with same CATH superfamily
2R92E 3WODE 4GZYE 4A3LF 3FKIF 1IW7E 1SFOE 3M3YF 1TWGF 4A3EF 1Y1WF 3S1NF 5C4XF 5FJ8E 5FLMF 3GTKF 3GTLE 4Y52E 4A3EE 1Y1WE 3S1NE 5C4XE 3H0GF 4A3GE 5FJ8F 4YFKE 2A6HE 1I6VE 2CW0E 3HOWE 4Q5SE 2B63F 4BXXE 3K7AF 3S1RE 5C3EF 5IYDF 2R92F 4MEXE 4A3KF 5M5XE 3S15F 4Q4ZE 4OIPE 3M4OF 4BXXF 2PMZK 4X6AF 1TWHE 4KN4E 4Y7NE 4BY1E 2E2JE 3S14F 2A6EE 2NVYE 4A3CF 4QIWH 4ZH4E 1WCMF 2WB1I 4OIOE 3HOZF 3S16E 4Y7NF 4LLGE 5C44E 5IP9F 5E18E 5TMCE 5C4JF 3GTJF 3HOVE 4A3BF 3PO2F 3HOZE 5M3FF 2JA5E 2NVTE 4OINE 5C44F 3GTOE 5E17E 1K83E 3HOWF 3I4NE 5C4JE 3GTJE 2B63E 5M5YF 2VUME 4XSZE 2E2IF 4A3FE 4KMUE 5M5YE 2VUMF 4A3IF 1TWHF 4BY1F 3GTME 4C2ME 5M5WF 2NVYF 4AYBH 3HOYF 2JA6F 2YU9E 4BBSE 3H3VF 3S1QF 1SMYE 4KN7E 3FKIE 4YFNE 3HOXE 1SFOF 3GTMF 2R7ZE 5IPLE 4XLNE 2KRXA 1TWCF 2JA8E 3PO2E 1EIKA 3GTPF 4YFXE 3S1MF 1R9TE 4MEYE 3HOUE 2R93F 4MQ9E 2PMZH 4A3JE 1K83F 4OIRE 4C3JF 4C3IE 2O5JE 4A93F 3S1ME 5IYCE 1I50F 4A3FF 4A3DF 4BBRE 4G7HE 4LK1E 1I50E 5C3EE 2JA7F 2Y0SI 2JA6E 1I6HE 2R7ZF 5FLME 1TWCE 1I6HF 4OIQE 1WCME 1TWFE 4LK0E 3RZDF 3S16F 3PO3E 1YNJK 5IP9E 4A3ME 1TWGE 5IYCF 3HOVF 2WAQH 1TWFF 3RZDE 3S2DE 1ZYRE 3GTKE 4YG2E 5M5XF 4BY7E 2WB1H 3DXJE 3M4OE 1YNNK 3CQZF 3GTQF 4AYBK 4XLPE 2JA7E 5IYBF 3S2HF 4A3LE 3K7AE 1QKLA 3CQZE 4A3IE 5M3MF 4A3KE 1HQME 4X6AE 4A3BE 2E2HE 2YU9F 3HOXF 5M3ME 3HKZK 3GTLF 4A3MF 4A3CE 3I4NF 2NVQF 1TWAE 4XSXE 3H0GE 4C3HE 1R9TF 3HOUF 2R93E 4BY7F 5BYHE 2O5IE 1TWAF 4C3HF 3S1RF 5IYDE 3S15E 4C2MF 5M5WE 5IYBE 2A69E 3HOYE 5IP7F 4G7ZE 4BBRF 3GTGF 3S2HE 2BE5E 4BBSF 2Y0SH 3S17E 2E2JF 5D4DE 3S14E 2JA8F 2E2HF 3HKZH 3GTPE 2PPBE 1Y1VF 3H3VG 3S17F 4A3JF 4QIWK 4C3IF 2NVQE 2WAQK 3S1QE 5D4CE 1Y1VE 5M3FE 2JA5F 2NVTF 3GTOF 3PO3F 4A3DE 1DZFA 4Y52F 5D4EE 1I3QE 4LJZE 2NVXE 3RZOE 3I4MF 3S2DF 2E2IE 4G7OE 4A3GF 3EQLE 4JK1E 4C3JE 5IP7E 2NVXF 3GTGE 4A93E 1I3QF 5TMFE 3RZOF 3M3YE 3I4ME 2A68E 3GTQE
chains in the Genus database with same CATH topology
3WODE 4GZYE 4A3LF 3FKIF 1IW7E 3M3YF 1TWGF 4A3EF 1Y1WF 3S1NF 5C4XF 5FLMF 3GTKF 3H0GF 5FJ8F 4YFKE 2A6HE 1I6VE 2CW0E 4Q5SE 2B63F 3K7AF 3S15F 5C3EF 5IYDF 2R92F 4MEXE 4A3KF 4Q4ZE 4OIPE 3M4OF 4BXXF 2PMZK 4X6AF 4KN4E 3S14F 2A6EE 4A3CF 4ZH4E 1WCMF 2WB1I 4OIOE 3HOZF 4Y7NF 4LLGE 5IP9F 5E18E 5TMCE 5C4JF 3GTJF 4A3BF 3PO2F 5M3FF 4OINE 5C44F 5E17E 3HOWF 5M5YF 4XSZE 2E2IF 4KMUE 2VUMF 4A3IF 1TWHF 4BY1F 5M5WF 2NVYF 3HOYF 2JA6F 3S1QF 1SMYE 4KN7E 1SFOF 4YFNE 3GTMF 5IPLE 4XLNE 2KRXA 1TWCF 3GTPF 4YFXE 3S1MF 4MEYE 2R93F 4MQ9E 4OIRE 1K83F 2O5JE 4C3JF 4A93F 1I50F 4A3FF 4A3DF 4G7HE 4LK1E 2JA7F 2Y0SI 2R7ZF 1I6HF 4OIQE 3RZDF 4LK0E 3S16F 1YNJK 5IYCF 3HOVF 1TWFF 1ZYRE 5M5XF 4YG2E 3DXJE 1YNNK 3CQZF 3GTQF 4AYBK 4XLPE 5IYBF 3S2HF 1QKLA 5M3MF 1HQME 2YU9F 3HOXF 3HKZK 3GTLF 4A3MF 3I4NF 2NVQF 4XSXE 1R9TF 3HOUF 4BY7F 5BYHE 2O5IE 1TWAF 4C3HF 3S1RF 4C2MF 2A69E 5IP7F 4G7ZE 4BBRF 3GTGF 4BBSF 2BE5E 2E2JF 5D4DE 2JA8F 2E2HF 2PPBE 1Y1VF 3H3VG 3S17F 4A3JF 4QIWK 4C3IF 2WAQK 5D4CE 2JA5F 2NVTF 3GTOF 3PO3F 5D4EE 4Y52F 4LJZE 3I4MF 3S2DF 4G7OE 4A3GF 3EQLE 4JK1E 2NVXF 1I3QF 5TMFE 3RZOF 2A68E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WOD E;  4GZY E;  4A3L F;  3FKI F;  1IW7 E;  3M3Y F;  1TWG F;  4A3E F;  1Y1W F;  3S1N F;  5C4X F;  5FLM F;  3GTK F;  3H0G F;  5FJ8 F;  4YFK E;  2A6H E;  1I6V E;  2CW0 E;  4Q5S E;  2B63 F;  3K7A F;  3S15 F;  5C3E F;  5IYD F;  2R92 F;  4MEX E;  4A3K F;  4Q4Z E;  4OIP E;  3M4O F;  4BXX F;  2PMZ K;  4X6A F;  4KN4 E;  3S14 F;  2A6E E;  4A3C F;  4ZH4 E;  1WCM F;  2WB1 I;  4OIO E;  3HOZ F;  4Y7N F;  4LLG E;  5IP9 F;  5E18 E;  5TMC E;  5C4J F;  3GTJ F;  4A3B F;  3PO2 F;  5M3F F;  4OIN E;  5C44 F;  5E17 E;  3HOW F;  5M5Y F;  4XSZ E;  2E2I F;  4KMU E;  2VUM F;  4A3I F;  1TWH F;  4BY1 F;  5M5W F;  2NVY F;  3HOY F;  2JA6 F;  3S1Q F;  1SMY E;  4KN7 E;  1SFO F;  4YFN E;  3GTM F;  5IPL E;  4XLN E;  1TWC F;  3GTP F;  4YFX E;  3S1M F;  4MEY E;  2R93 F;  4MQ9 E;  4OIR E;  1K83 F;  2O5J E;  4C3J F;  4A93 F;  1I50 F;  4A3F F;  4A3D F;  4G7H E;  4LK1 E;  2JA7 F;  2Y0S I;  2R7Z F;  1I6H F;  4OIQ E;  3RZD F;  4LK0 E;  3S16 F;  1YNJ K;  5IYC F;  3HOV F;  1TWF F;  1ZYR E;  5M5X F;  4YG2 E;  3DXJ E;  1YNN K;  3CQZ F;  3GTQ F;  4AYB K;  4XLP E;  5IYB F;  3S2H F;  1QKL A;  5M3M F;  1HQM E;  2YU9 F;  3HOX F;  3HKZ K;  3GTL F;  4A3M F;  3I4N F;  2NVQ F;  4XSX E;  1R9T F;  3HOU F;  4BY7 F;  5BYH E;  2O5I E;  1TWA F;  4C3H F;  3S1R F;  4C2M F;  2A69 E;  5IP7 F;  4G7Z E;  4BBR F;  3GTG F;  4BBS F;  2BE5 E;  2E2J F;  5D4D E;  2JA8 F;  2E2H F;  2PPB E;  1Y1V F;  3H3V G;  3S17 F;  4A3J F;  4C3I F;  2WAQ K;  5D4C E;  2JA5 F;  2NVT F;  3GTO F;  3PO3 F;  5D4E E;  4Y52 F;  4LJZ E;  3I4M F;  3S2D F;  4G7O E;  4A3G F;  3EQL E;  4JK1 E;  2NVX F;  1I3Q F;  5TMF E;  3RZO F;  2A68 E; 
#chains in the Genus database with same CATH topology
 2R92 E;  3WOD E;  4GZY E;  4A3L F;  3FKI F;  1IW7 E;  1SFO E;  3M3Y F;  1TWG F;  4A3E F;  1Y1W F;  3S1N F;  5C4X F;  5FJ8 E;  5FLM F;  3GTK F;  3GTL E;  4Y52 E;  4A3E E;  1Y1W E;  3S1N E;  5C4X E;  3H0G F;  4A3G E;  5FJ8 F;  4YFK E;  2A6H E;  1I6V E;  2CW0 E;  3HOW E;  4Q5S E;  2B63 F;  4BXX E;  3K7A F;  3S1R E;  5C3E F;  5IYD F;  2R92 F;  4MEX E;  4A3K F;  5M5X E;  3S15 F;  4Q4Z E;  4OIP E;  3M4O F;  4BXX F;  2PMZ K;  4X6A F;  1TWH E;  4KN4 E;  4Y7N E;  4BY1 E;  2E2J E;  3S14 F;  2A6E E;  2NVY E;  4A3C F;  4QIW H;  4ZH4 E;  1WCM F;  2WB1 I;  4OIO E;  3HOZ F;  3S16 E;  4Y7N F;  4LLG E;  5C44 E;  5IP9 F;  5E18 E;  5TMC E;  5C4J F;  3GTJ F;  3HOV E;  4A3B F;  3PO2 F;  3HOZ E;  5M3F F;  2JA5 E;  2NVT E;  4OIN E;  5C44 F;  3GTO E;  5E17 E;  1K83 E;  3HOW F;  3I4N E;  5C4J E;  3GTJ E;  2B63 E;  5M5Y F;  2VUM E;  4XSZ E;  2E2I F;  4A3F E;  4KMU E;  5M5Y E;  2VUM F;  4A3I F;  1TWH F;  4BY1 F;  3GTM E;  4C2M E;  5M5W F;  2NVY F;  4AYB H;  3HOY F;  2JA6 F;  2YU9 E;  4BBS E;  3H3V F;  3S1Q F;  1SMY E;  4KN7 E;  3FKI E;  4YFN E;  3HOX E;  1SFO F;  3GTM F;  2R7Z E;  5IPL E;  4XLN E;  2KRX A;  1TWC F;  2JA8 E;  3PO2 E;  1EIK A;  3GTP F;  4YFX E;  3S1M F;  1R9T E;  4MEY E;  3HOU E;  2R93 F;  4MQ9 E;  2PMZ H;  4A3J E;  1K83 F;  4OIR E;  4C3J F;  4C3I E;  2O5J E;  4A93 F;  3S1M E;  5IYC E;  1I50 F;  4A3F F;  4A3D F;  4BBR E;  4G7H E;  4LK1 E;  1I50 E;  5C3E E;  2JA7 F;  2Y0S I;  2JA6 E;  1I6H E;  2R7Z F;  5FLM E;  1TWC E;  1I6H F;  4OIQ E;  1WCM E;  1TWF E;  4LK0 E;  3RZD F;  3S16 F;  3PO3 E;  1YNJ K;  5IP9 E;  4A3M E;  1TWG E;  5IYC F;  3HOV F;  2WAQ H;  1TWF F;  3RZD E;  3S2D E;  1ZYR E;  3GTK E;  4YG2 E;  5M5X F;  4BY7 E;  2WB1 H;  3DXJ E;  3M4O E;  1YNN K;  3CQZ F;  3GTQ F;  4AYB K;  4XLP E;  2JA7 E;  5IYB F;  3S2H F;  4A3L E;  3K7A E;  1QKL A;  3CQZ E;  4A3I E;  5M3M F;  4A3K E;  1HQM E;  4X6A E;  4A3B E;  2E2H E;  2YU9 F;  3HOX F;  5M3M E;  3HKZ K;  3GTL F;  4A3M F;  4A3C E;  3I4N F;  2NVQ F;  1TWA E;  4XSX E;  3H0G E;  4C3H E;  1R9T F;  3HOU F;  2R93 E;  4BY7 F;  5BYH E;  2O5I E;  1TWA F;  4C3H F;  3S1R F;  5IYD E;  3S15 E;  4C2M F;  5M5W E;  5IYB E;  2A69 E;  3HOY E;  5IP7 F;  4G7Z E;  4BBR F;  3GTG F;  3S2H E;  2BE5 E;  4BBS F;  2Y0S H;  3S17 E;  2E2J F;  5D4D E;  3S14 E;  2JA8 F;  2E2H F;  3HKZ H;  3GTP E;  2PPB E;  1Y1V F;  3H3V G;  3S17 F;  4A3J F;  4QIW K;  4C3I F;  2NVQ E;  2WAQ K;  3S1Q E;  5D4C E;  1Y1V E;  5M3F E;  2JA5 F;  2NVT F;  3GTO F;  3PO3 F;  4A3D E;  1DZF A;  4Y52 F;  5D4E E;  1I3Q E;  4LJZ E;  2NVX E;  3RZO E;  3I4M F;  3S2D F;  2E2I E;  4G7O E;  4A3G F;  3EQL E;  4JK1 E;  4C3J E;  5IP7 E;  2NVX F;  3GTG E;  4A93 E;  1I3Q F;  5TMF E;  3RZO F;  3M3Y E;  3I4M E;  2A68 E;  3GTQ E; 
#chains in the Genus database with same CATH homology
 3WOD E;  4GZY E;  4A3L F;  3FKI F;  1IW7 E;  3M3Y F;  1TWG F;  4A3E F;  1Y1W F;  3S1N F;  5C4X F;  5FLM F;  3GTK F;  3H0G F;  5FJ8 F;  4YFK E;  2A6H E;  1I6V E;  2CW0 E;  4Q5S E;  2B63 F;  3K7A F;  3S15 F;  5C3E F;  5IYD F;  2R92 F;  4MEX E;  4A3K F;  4Q4Z E;  4OIP E;  3M4O F;  4BXX F;  2PMZ K;  4X6A F;  4KN4 E;  3S14 F;  2A6E E;  4A3C F;  4ZH4 E;  1WCM F;  2WB1 I;  4OIO E;  3HOZ F;  4Y7N F;  4LLG E;  5IP9 F;  5E18 E;  5TMC E;  5C4J F;  3GTJ F;  4A3B F;  3PO2 F;  5M3F F;  4OIN E;  5C44 F;  5E17 E;  3HOW F;  5M5Y F;  4XSZ E;  2E2I F;  4KMU E;  2VUM F;  4A3I F;  1TWH F;  4BY1 F;  5M5W F;  2NVY F;  3HOY F;  2JA6 F;  3S1Q F;  1SMY E;  4KN7 E;  1SFO F;  4YFN E;  3GTM F;  5IPL E;  4XLN E;  2KRX A;  1TWC F;  3GTP F;  4YFX E;  3S1M F;  4MEY E;  2R93 F;  4MQ9 E;  4OIR E;  1K83 F;  2O5J E;  4C3J F;  4A93 F;  1I50 F;  4A3F F;  4A3D F;  4G7H E;  4LK1 E;  2JA7 F;  2Y0S I;  2R7Z F;  1I6H F;  4OIQ E;  3RZD F;  4LK0 E;  3S16 F;  1YNJ K;  5IYC F;  3HOV F;  1TWF F;  1ZYR E;  5M5X F;  4YG2 E;  3DXJ E;  1YNN K;  3CQZ F;  3GTQ F;  4AYB K;  4XLP E;  5IYB F;  3S2H F;  1QKL A;  5M3M F;  1HQM E;  2YU9 F;  3HOX F;  3HKZ K;  3GTL F;  4A3M F;  3I4N F;  2NVQ F;  4XSX E;  1R9T F;  3HOU F;  4BY7 F;  5BYH E;  2O5I E;  1TWA F;  4C3H F;  3S1R F;  4C2M F;  2A69 E;  5IP7 F;  4G7Z E;  4BBR F;  3GTG F;  4BBS F;  2BE5 E;  2E2J F;  5D4D E;  2JA8 F;  2E2H F;  2PPB E;  1Y1V F;  3H3V G;  3S17 F;  4A3J F;  4QIW K;  4C3I F;  2WAQ K;  5D4C E;  2JA5 F;  2NVT F;  3GTO F;  3PO3 F;  5D4E E;  4Y52 F;  4LJZ E;  3I4M F;  3S2D F;  4G7O E;  4A3G F;  3EQL E;  4JK1 E;  2NVX F;  1I3Q F;  5TMF E;  3RZO F;  2A68 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...