The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
2
|
sequence length |
46
|
structure length |
46
|
Chain Sequence |
GAACLCKSDGPNTRGNSMSGTIWVFGCPSGWNNCEGRAIIGYCCKQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Three-dimensional structure of the neurotoxin ATX Ia from Anemonia sulcata in aqueous solution determined by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb |
| molecule tags |
Sea anemone toxin
|
| source organism |
Anemonia sulcata
|
| molecule keywords |
ATX IA
|
| total genus |
2
|
| structure length |
46
|
| sequence length |
46
|
| ec nomenclature | |
| pdb deposition date | 1990-05-14 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00706 | Toxin_4 | Anenome neurotoxin |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Single Sheet | Anthopleurin-A | Anthopleurin-A |
#chains in the Genus database with same CATH superfamily 2SH1 A; 1B8W A; 2MN3 A; 1WQK A; 1WXN A; 1APF A; 2MUB A; 1SHI A; 1Z99 A; 2H9X A; 4GV5 A; 1AHL A; 2BDS A; 1SH1 A; 3LMS B; 1ZUE A; 2JTO A; 1ZLH B; 2K2X A; 1ZUF A; 2RNG A; 1ATX A; 3D4U B; 1D6B A; 1ZLI B; 1BDS A; 1H5O A; #chains in the Genus database with same CATH topology 2QSG A; 1GL9 B; 2SH1 A; 1B8W A; 1WQK A; 2DLA A; 1WXN A; 2MN3 A; 4YIR A; 2QSH A; 1APF A; 2MUB A; 1SHI A; 3MYV A; 1Z99 A; 2H9X A; 3MCX A; 4GV5 A; 1AHL A; 2BDS A; 2HJE A; 2HJ9 C; 1SH1 A; 2IKE A; 3LMS B; 3C30 A; 1ZUE A; 2JTO A; 1ZLH B; 2K2X A; 2XXL A; 1ZUF A; 2RNG A; 3IF4 A; 3KEZ A; 1ATX A; 1GKU B; 2JR3 A; 2B9K A; 2IKD A; 3D4U B; 1D6B A; 1ZHH B; 1ZLI B; 1BDS A; 3C38 A; 2QSF A; 1H5O A; 1EL6 A; #chains in the Genus database with same CATH homology 2QSG A; 2SH1 A; 1B8W A; 1WQK A; 2DLA A; 1WXN A; 2MN3 A; 4YIR A; 2QSH A; 1APF A; 2MUB A; 1SHI A; 3MYV A; 1Z99 A; 2H9X A; 3MCX A; 4GV5 A; 1AHL A; 2BDS A; 2HJE A; 2HJ9 C; 1SH1 A; 2IKE A; 3LMS B; 3C30 A; 1ZUE A; 2JTO A; 1ZLH B; 2K2X A; 2XXL A; 1ZUF A; 2RNG A; 3KEZ A; 1ATX A; 2JR3 A; 2B9K A; 2IKD A; 3D4U B; 1D6B A; 1ZHH B; 1ZLI B; 1BDS A; 3C38 A; 2QSF A; 1H5O A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
