2HJEA

Crystal structure of vibrio harveyi luxq periplasmic domain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
220
structure length
210
Chain Sequence
SKQQTSALIHNIFDSHFAAIQIHHDSNSKSEVIRDFYTDRDTDVLNFFFLSIDQSDPSHTPEFRFLTDHKGIIWDDGNAHFYGVNDLILDSLANRVSFSNNWYYINVMTSIGSRHMLVRRVPILDPSTGEVLGFSFNAVVLDNNFALMEKLKSESNVDNVVLVANSVPLANSLIGDEPYNVADVLQLLVIETPIVVNAVTTELCLLTVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-induced asymmetry in histidine sensor kinase complex regulates quorum sensing.
pubmed doi rcsb
source organism Vibrio harveyi
molecule tags Signaling protein
molecule keywords Autoinducer 2 sensor kinase/phosphatase luxQ
total genus 64
structure length 210
sequence length 220
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.20.100 Mainly Beta Single Sheet Anthopleurin-A Anthopleurin-A 2hjeA02
3.30.450.220 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2hjeA01
2HJ9C 3C30A 2HJEA 1ZHHB 3C38A
chains in the Genus database with same CATH superfamily
4K08A 4X1LA 3MXQA 4CLCE 1WQKA 1OTIA 2HZ5A 1ES5A 2W1TA 5EOOA 3T4LA 1OTEA 3UB7A 2Y2PA 3CPTB 4ZDXA 5HAQA 4Y2FA 3NOPC 3O3VA 5AJGA 3DTEA 1S4SA 3A3FA 2Q9MA 2EX2A 4WEJA 3R7WA 1H0MA 2C6WB 3BFFA 4QPRA 1NLZA 1F2KA 2JC7A 2WGWA 4F3LB 3FV7A 1CEGA 1XP4A 1FIKA 3GDIA 4WL9A 3ULFA 2A2LA 1T1AA 4EQIA 3R4KA 2J8YA 4X6TA 1A0KA 2GJ3A 1KDWA 5EFWA 2QJ7A 1FSWA 3OZHA 4NXEA 4KQQA 3F1PB 1VETA 2B95A 3LICA 2QMIA 1JWZA 1H8ZA 2BASA 3B3XA 2BDSA 2PRFA 2R9XA 5KMWA 1KGFA 4OLDA 3MZDA 2MJ6A 1XFQA 4MBKA 2ACGA 1S0WA 3ITAA 4PM5A 1NYYA 4F3LA 2I9VA 5J3WA 2H5SA 2IWBA 2HPBA 3RH8B 5E43A 5F68A 5F1GA 2Z2MB 1PYYA 5CHMA 5CERA 5TR7A 4OH0A 4HOIA 4MLLA 2JKRM 5AQAA 3LR4A 3CUEA 4E3IA 4RYEA 3G35A 2WZZA 4EBLA 1BLHA 3KSGA 4R38A 2QSFA 2Y2LA 2PD7A 4E3LA 3E2LA 3H82B 4H6JB 4LV1A 3NJAA 4JPMA 5CEBA 1K38A 3LIEA 1GA9A 3N7WA 5I5LA 2A24A 4ZJ1A 4MN5A 2VEAA 4CLCB 4UQIS 4ZJ2A 4WMCD 4JGQA 3W4QA 4DXCA 3LMSB 4JXGA 3GVBA 1W7FA 1EROA 4FOFA 3BQ8A 2Q0OA 4O0PA 5DF8A 5TBMB 4I5SA 3MR0A 3HCYA 3MCXA 1JWPA 2JCHA 3F1NA 3F1NB 2KDKA 1S1ZA 1STZA 3SS4A 4IBRA 4XUZA 3NHQA 2UV0E 3HLDA 3BLSA 2XR0A 2M7VA 3UDIA 3W8KA 3E2KA 1MXOA 5CTMA 5DF9A 2Y2HA 2Y8HA 3C5AA 1NRFA 4XT2B 4BL2A 1XA1A 4Q0HA 1XX2A 5FQ9A 1BZAA 4UA7A 1FILA 2EA9A 1NY0A 4N92A 4CLCD 2IWDA 4P85A 1LI9A 2XA7S 2W3GA 4L0LA 2Y2KA 3Q7VA 1KGEA 1GHPA 4R1GA 2DCFA 1MWTA 1LI0A 3G6OA 4E3KA 4FH4A 3UE6A 3T1SA 4QD4A 4ME4A 3UB6A 3FPWA 2EFXA 3EWKA 2J7VA 4JBFA 1KE0A 5L2FA 1PZPA 2ZM0A 5KIZA 5CXWA 2W27A 1BTLA 3BY9A 3UMEA 3LI9A 3GTCA 1VQQA 3BFGA 1KVLA 5HZHA 3MFDA 1MY8A 5CRFA 1N4OA 2PYRA 4OONA 2G7UA 4LRXC 2HDRA 3NIAA 1ZUFA 1YQSA 2D02A 1XJ4A 2XSSA 3B42A 4Z1WA 4HJ6A 1IKIA 2WGWB 4ID4A 1IYSA 2WYXA 1F98A 3C8CA 3ZCZA 1MPLA 4R23A 4GLQA 4YWZA 1N9BA 3PHYA 1YMXA 3PBQA 5A90A 4HIAA 2JBFA 2IWCA 2V1AA 1XJ2A 3MJQA 2GNXA 1OJ5A 2IA2A 1C3BA 3OPRA 4GNUA 1M6KA 3T4JA 4OPQA 4XT2A 1EWZA 2XROA 4GOGA 4O7DA 5KZHA 4AFIA 2HDQA 4DRTA 4XUXA 4IUKA 1NZUA 2HDSA 1SKOB 3VFFA 1N9NA 5FAQA 4QHCA 3LR0A 3M2KA 4EETB 3LY3A 3MKEA 4DMZA 4LRYC 1GSVA 1IYQA 4EUZA 1FSYA 4R4SA 1NLYA 1TEMA 1ERMA 4LPZA 3G32A 4BENA 5J7EA 1YLYA 4BD1A 3PAGA 3VE3A 3WS1A 1T19A 3OLOA 4G3KA 1G68A 3A3IA 4X56A 4WF0A 4FSFA 1E25A 1RGYA 5CGWA 3CZDA 3G2YA 4GKUA 2XF3A 3V3RA 5U47A 3OC2A 4PKYG 1SCWA 1PFLA 3FWLA 3VP0A 4BBUA 5L07A 2VGLM 3Q7ZA 1Y4OA 5HPFA 1FR1A 1H8MA 3TOIA 4U0XA 4QJGA 3VOLA 2W3FA 2LB9A 1KOUA 2LB5A 2O9BA 5K5BA 2FFFB 1F9IA 5CX7A 2XD5A 2VX8A 4KZ9A 5GLDA 2CMNA 4HH2A 1NRJA 3OPLA 2XK1A 3LGOA 1K54A 1K6SA 3SH9A 2PR5A 1W79A 4BL3A 2GX5A 4ZTKA 3LEQA 2WUQA 2H0TA 5F69A 1ACFA 4H6JA 5HDCA 3CUEC 1SH1A 4L9GA 5DJTA 5FI7A 2WKHA 4S2LA 3G4PA 2A24B 4ZRRA 3OBFA 1HLUP 3RTYA 3N4IA 2Y59A 1HTZA 2KX6A 1EI5A 3UE1A 1NJ4A 1B8WA 4R70A 3G31A 5HARA 3VOYA 3LI8A 1GHMA 5EUAA 5HW3A 3DBAA 1WYBA 2ZQ9A 3VP3A 2JR3A 2ZMVA 5AVEA 3KSIA 5DKLA 1APFA 3CAXA 4N9LA 3IF6A 1VHMA 2HF6A 2ZJ9A 1GHIA 2RNGA 1H5OA 1G6AA 1ONHA 4KZ4A 3BRMA 4GW9A 5A91A 3ZG9B 3ZG8B 4WLAA 2PR6A 3G34A 2EWWA 2XQZA 3A3EA 4PM8A 3MF0A 1K56A 4Y17A 3QHYA 5J4EA 3NECA 1LT0A 1KE3A 5DKKA 1YLTA 3MKFA 4IBXA 3B47A 4N9KA 4Z9QA 1ZC2A 3T4KA 3H9WA 4YOFA 4A5RA 2CC1A 3VFHA 5CTNA 4C75A 1K54C 1EL6A 3NDEA 2EXBA 4LV0A 4MBFA 3M6BA 1CQAA 3T4QA 1PWCA 5FASA 2JKTI 1KE4A 3KSHA 4EEUA 3VV4A 2WGVA 3T50A 1OT6A 4WZ5A 1GSWA 2XXLA 2O9CA 3C4OA 1S6RA 3LR3A 2W1TB 3E4PA 3GSGA 5FAOA 4CJNA 3IF5A 2OAP1 1TS7A 3E0YA 4OQIA 4I3JA 3E98A 4S2MA 2PU2A 1BUEA 4NXBA 3DW0A 5FEGA 1YLWA 1ODVA 2X02A 1IEMA 1L0DA 4WZ4A 3PYPA 5EVIB 3WS0A 4BD0A 4JF5A 4HI4A 5F1FA 2L4RA 2G2UA 1QMEA 2A3UA 2XGNA 4FD8A 3O5YA 2WKRA 1ESIA 2J3TD 2WADA 2V0WA 2ZC6B 1K55C 4G3WA 2ZM2A 4R0QA 4ARZA 3BFDA 1SHVA 2ZL1A 3PR6A 1Q2PA 3MQ0A 2O99A 1I2WA 1NYMA 1X0OA 3HLBA 3DWZA 2WAFA 3L7HA 1LL5A 4IVIA 4S2NC 1W8YA 3T4TA 4F94A 3HUOA 3Q07A 3N8LA 2B18A 5HAIA 2IKDA 1J3WA 1T1CA 3F1OB 3T12B 1YPRA 1LL9A 4IHQA 2ZLYA 3D4UB 4DXBA 2Y2QA 1LHYA 4EBNA 1P9WA 3P98A 1O7EA 3FG8A 3NBLA 2Y2GA 3IBJA 3IXBA 2ZQCA 1DP6A 1UWPX 4P6ZS 4B9OA 4C6YA 4ZAMA 1LLBA 1D6BA 4LCLA 3H7WA 5DFXA 2J3WA 4WZ5C 5EPHA 1SKFA 1NZOA 4S2NA 4S2JA 1L2SA 1DJAA 1M40A 2ZBBA 4LGWA 4X1MA 3LO7A 4YIRA 4ZJ3A 3TRCA 2XH9A 2ZQAA 3NC8A 2J80A 4BWIA 3HL9A 4MMNA 2XDMA 3QP5A 4DKIA 1G6OA 4E6XA 3IF6B 3NOTC 1ZUEA 1K4EA 4GHIA 2EFUA 4RX2A 1IYOA 2A49A 2WKPA 4LV3A 5MC7A 1ZKJA 5KSCA 1H3QA 3UE3A 2EWVA 4OOYA 4E6WA 1BLPA 5EECA 3ITBA 4HJ4A 2Y79A 1K4FA 1TS0A 2ZQDA 1YSPA 2VJWA 3CLOA 5JYPA 4OPZA 1FCOA 5FI6A 4P0MA 5FQMA 3RXWA 1RGZA 3CWFA 2W1RA 4JF4A 4B4XA 4R3JA 2WKEA 5F83A 1N9LA 3CI6A 4BBVA 3BFEA 1MWRA 1NWZA 4I3AA 3CJMA 3GV9A 3UB8A 5TFQA 1YM1A 3FC7A 5FDSA 4E04A 4EU0A 5EVLA 2MUBA 2VV6A 4WBGA 3NULA 4KUKA 4EQ1A 5FEFA 4E3NA 4U3TA 1ES3A 3ZVTA 1ZG4A 3MXSA 1E4DA 4HP4A 3D4FA 2G2WA 1SZVA 4K0WA 3ZNYA 4LENA 5HWWA 1BDSA 3ZVWA 1FQGA 2PT7A 1P0ZA 3W4OA 2E8JA 3IXGA 3Q1FA 3HREA 5CECA 5G18A 4DJ2A 3VMAA 1CF0A 1E3UA 2WAEA 4OQGA 3MS6A 2Y2NA 4S2KA 3IWOA 4M4XA 1ZLIB 1CI9A 5HWTA 4MDZA 2JKGA 4R3AA 5EVEA 3IX3A 1XKZA 1LSVA 3AGDA 2V0UA 4PMAA 1PZOA 3B33A 3SW1A 4KZ7A 3C4PA 5HL6A 4Y5FA 4K0XA 3PAEA 3EQUA 3SOIA 3I7JA 1Z09A 5CGSA 1BULA 4H8RA 3FZCA 4HBUA 1PNEA 4Y3IA 3S1YA 4Y0UA 1D06A 3ICYA 3MQQA 3OPHA 4WUJA 3CHWP 4JXVA 3C2WA 5HD3A 2X01A 1YLJA 5FQIA 1I5QA 5A93A 2P04A 1XJ6A 1KDSA 1L0GA 2Z2LB 4HH3A 3NOUC 1XFNA 3TSGA 3RXXA 2J9PA 3QNBA 3ZFZA 1TVFA 2VA0A 5E2EA 5AQBA 4OPRA 2B5RA 2ZC3B 4WELA 2OSUA 1BYWA 4GV5A 5HX9A 1RP5A 4OQ0A 1XJ3A 4HNBA 5DFYA 1MWSA 1S4RA 3UDXA 5FL3A 1YAXA 4Y15A 3E4QA 3CMZA 2JKFA 1CI8A 3HJIA 3TJZC 2HJ9C 2ZC4B 5LBRA 2Y2JA 3ZYTA 3A3DA 2JHEA 4OKPA 5HWVA 3WRZA 2D01A 1AWIA 4CLCC 2WGIA 4QY5A 2OWHA 3PBRA 5EM1A 1UWNX 4KG2A 4B4ZA 2JE5A 3V67A 1OJGA 3CPTA 1D7EA 1MWUA 2W3HA 4XXRA 4PM9A 4R6LA 2V8CA 4NG2A 3UE0A 1TD5A 2RCXA 2XEPA 5A92A 5FQJA 3VOZA 2J9OA 4D2OA 4EWFA 1UGUA 4WN5A 1S67L 4KZ8A 2NUPC 3EOIA 3FKWA 2VGJA 3C30A 1DY6A 1V9ZA 4MN7A 3T1RA 3OOVA 4N1HA 1VB6A 2XRNA 3GRJA 4UA6A 1ERQA 4D60A 4JGRA 5E2HA 4M3KA 1PI4A 3LIAA 4JXSA 4BMWA 4DF6A 4UQIM 5EM0A 2PYPA 2VZWA 2YKFA 3O88A 3PXPA 1PW1A 5DTTA 3ZQ5A 4Y0OA 3A0VA 4P6ZM 1OT9A 5HSQA 3TE8A 1Y28A 3P7NA 4HP9A 3MBZA 2ZD8A 1XPBA 5TGFA 5GLBA 1ZTUA 2ZMAA 1ZHHB 3JYIA 2Y2OA 3KO6A 3MYVA 4S2IA 1TS8A 3UDFA 1CJFA 3HLWA 2KOIA 4HESA 3MFXA 1Y54A 3PBSA 3UY6A 1Z6FA 3T4SA 2Z6CA 4O01A 3H7WB 4Q0JA 5IS1A 4PAUA 4OOMA 3V5MA 1PIOA 1F5MA 3BWLA 3IS2B 2ZQ8A 3UPOA 1DRMA 1GA0A 5FQQA 2EXAA 5IU1A 1WXNA 2V20A 2EX6A 4NKPA 2M1CA 3F1PA 4NXGA 1FCMA 3DTIA 2QPNA 3LEZA 5IHVA 3V39A 4MCWA 4GDBA 4GJ4A 1V9YA 4I39A 1KGGA 4KQDA 1GL9B 2VK3A 3DAVA 3MSHA 3C7UA 1H5XA 4O8GA 1YSQA 1W63Q 1K6RA 3T1XA 1GCEA 3V50A 5EV0A 5M1AA 2QWSA 2JKTM 3NDGA 3WS4A 1BLCA 3W4PA 3A0SA 4HQAA 4WYYA 2V8FA 4NK3A 4EV4A 3DTMA 3T1QB 3VE4A 4LV2A 3DWKA 2PAVP 1ATXA 3BLMA 1U60A 3UB9A 3ZG5A 3M6HA 1GKUB 4R3BA 1MKIA 2HDUA 3IH8A 5FATA 3PBTA 2P9VA 3NI9A 3BY8A 3TG9A 1YLZA 3JVVA 2PDRA 4EXOA 1AHLA 4GS9B 3ZNTA 2FFYA 3S4XA 3HLFA 2Q9NA 1K56D 4B88A 1ES2A 4DJ3A 4HBTA 4G3VA 4WM9A 3IF6C 3ZG7B 2K7SA 1KVMA 2EX9A 5FQKA 4ETXA 3MQOA 3GQZA 5E2FA 5DTSA 2QZ6A 1DP8A 2HP9A 2NUTC 4KZBA 3G2ZA 1TDLA 5DF7A 3QP6A 2OV5A 1SDNA 3IWQA 4YFMA 4KQRA 3M2JA 5E2GA 2OOLA 3GECA 2P9VB 3OPPA 3K2NA 1JTDA 3TW8A 2HV1A 2M7UA 4PM7A 5FDHA 2DNSA 2O9AA 2V1BA 2DLAA 3IHAA 3KYZA 4HEFA 1G28A 2VV7A 2ZC5B 4FCFA 4QWOA 1D1JA 4LFUA 5FAPA 1L0FA 3HUNA 5AVFA 1MC0A 5F5YA 5DTKA 3BEBA 3LYXA 4GZBA 5AQ9A 2WKQA 4L9EA 4JKTA 4RQ9A 3BFCA 2QHKA 3UPPA 4X25A 2XFTA 1K25A 5L8MA 2Y4AA 3PTEA 2RL3A 2H10A 1VM1A 3QP2A 4MBHA 3L9KA 3MZFA 1FCNA 4IJGA 4PHTA 4YINA 1WA9A 4WEKA 4CPKA 3FPVA 5M19A 3IHBA 2JN7A 3S7OA 5IT5A 1N9OA 3G30A 3KX0X 2BLSA 1QMFA 4R4RA 2ZQ7A 3Q7VB 1SKOA 2HGVA 3BECA 3NCKA 2K2NA 4UAAA 3VP4A 4GD8A 5HDDA 5FA7A 3A3JA 5CHJA 1TF1A 1OMEA 2VKSA 5C5KA 3UMDA 4Y7PA 3BJNA 1HVBA 4GHIB 1YKDA 2HP6A 3Q82A 5HD5A 2FZ0A 5GHZA 2Y2IA 5GHXA 1ESUA 4X53A 3U4LP 2XD1A 3S7NA 4E3OA 2PBYA 3VSKA 2HP5A 3KEZA 4Y0TA 3R7WB 2IKEA 4BQMA 5FSRA 3LY4A 4UA9A 1PI5A 1K57A 3E4OA 3MMHA 1JTGA 5EVIA 1PRQA 4I38A 5G4ZA 3KYQA 1O07A 4DN0A 2FH5A 4KUOA 5HPIA 1YT4A 3IS2A 4NETA 1OTAA 1VETB 1LSXA 5HL1A 4N1XA 2KLIA 3HBRA 2P7JA 2VGKA 1T18A 3D9YA 3D72A 1WE4A 1IOUA 1AXBA 3UPNA 4OOLA 3P01A 3P09A 1BT5A 4GD6A 1L0EA 2W3EA 2ZL1B 3KSFA 4WMCA 4RX3A 3S7PA 5CEDA 2ZMFA 1W8QA 5KSHA 1OTDA 3SH8A 3JVUA 4BLMA 1OTBA 1IFQA 3CITA 2QJ5A 2ZOIA 1FOFA 4LLOB 2PBDP 2ZOHA 2B9KA 5I94A 3K3CA 2V2FF 4QU3A 3C7VA 2SH1A 3EQVA 4EERA 3N8SA 2DMWA 3HLGA 3IX8A 1YLPA 3LUQA 4LRZE 1G5UA 2JTOA 3PBNA 4FTXA 4GN2A 5GHYA 4P87A 2XFSA 3OCNA 4MEZA 3SZTA 4JLFA 4JGOA 3HLEA 3HLCA 3IBRA 3PBOA 4CLCA 3ZG0A 5EE8A 1DJCA 2J3TC 4EUVA 2P74A 3FYZA 3Q81A 2YKHA 3OCLA 4IUHA 2O0YA 3MZEA 3AGFA 3CG5A 2P08A 1T1BA 3MXRA 5CGXA 1IYPA 5BOHA 4MNRA 4E3MA 3SS5A 1MBLA 4FH2A 3QP4A 1XGIA 4DE0A 1ALQA 5J8XA 3SS3A 3U2AA 5HAPA 4E3JA 2R9WA 5D3OA 1CK3A 1EW0A 1S66L 4DE2A 4OP8A 3EGDC 3A0RA 4KZ6A 2ZM8A 1GSXA 4BBTA 1Q2QA 3LR5A 4K91A 4IVKA 1HZOA 4GS9A 4DE1A 3C38A 1CEFA 2HJEA 1IKGA 1LSWA 3IWIA 1PW8A 5EOEA 1DP9A 2EX8A 4OPYA 5M18A 4ETZA 3IX4A 4HHDA 3VP2A 1NXYA 4GDNA 2VGLS 2H28A 2L1MA 5GL9A 3RJUA 3ZGAB 4DDYA 5JYOA 4X69A 2V9AA 4JXWA 4PPRA 3LIFA 3UB5P 2W3DA 5EVID 3BYDA 3ISGA 3H82A 4LCMA 1E3UD 2B02A 3DTKA 3GR2A 1JWVA 1YMSA 2VLGA 4NXFA 4RVAA 2XLNA 1ONGA 3IXDA 3VP1A 2Z6DA 5F6AA 4UEYA 4EESA 2VV8A 5DVAA 4C3QA 2WKIA 5F82A 5DJUA 2BTFP 3LIDA 3IF4A 2PD8A 3EEHA 4P6BA 1JVJA 3WRTA 2L0WA 1P97A 4KENB 3LFVA 4Y13A 4PM6A 4QY6A 3AGEA 2K2XA 3WS5A 4QB8A 2ZC7A 2K31A 1JNUA 1SHIA 1TDGA 3K3DA 4HJ3A 1PWGA 4ZBEA 3UO9A 2H9XA 2WK0A 5TBMA 3SH7A 1ES4A 1BLSA 2OWJA 3NY4A 4Q0IA 4JGPA 3IH9A 4GB7A 5FI2A 1XXMA 3S7QA 3O86A 1L3LA 2C5WB 1XA7A 2R78A 4YNRA 2OLVA 1OPXA 4Q8IA 2QKPA 1MKMA 3V3SA 1XGJA 3EEAA 5HFOA 3W2ZA 4U0TA 4KZ5A 1I2SA 4NEED 4ARZB 1IELA 4IEDA 3KYEA 3VSLA 4FUWA 1MZUA 4RA7A 4OLGA 4KG6A 1P9RA 5A8BA 2BG1A 1ZG6A 4UHUA 4GCZA 5GLAA 1RCJA 2AVXA 3T4OA 5HDSA 2Y2MA 4EEPA 2E8IA 3QNCA 4OQHA 3UNWA 4BJPA 1ZLHB 1PWDA 3HVFA 4S2PA 2Y91A 1W5DA 3GMWA 3HJKA 4OVDA 3IXHA 3LIBA 3N6IA 3HUMA 4HY8A 4JF6A 4KZAA 3BM6A 1TS6A 5AQ7A 3LCEA 1WYCA 2QYBA 2QSHA 3N8RA 3S22A 1BSGA 4CQHA 2WZXA 3WWXA 1Z99A 3ZDJA 2X71A 3IT9A 4PKYA 1LL8A 5EVIC 5G4YA 1DJBA 1K57C 2JKRI 1W63M 3O87A 1SDEA 1FR6A 1J9MA 4B93A 3FKVA 5TJJA 2INWA 2PHYA 2GDNA 4I3IA 4L9FA 1K0KA 3QP8A 4OP5A 1H8YA 3JPUA 4S2OA 4EBPA 2QSGA 1VEUA 4ESPA 1VEUB 4KG5A 4MN6A 3UN7A 2V1ZA 3D3OA 3IQAA 4X55A 3EGXC 3QP1A 5CHUA 2UWXA 5L10A 3ZHHA 3RFBA 3WS2A 4DE3A 2H0YA 2MN3A 3BQAA 3BW6A 2I72A 5GLCA 4DDSA 2Y55A 4EW7A 1K55A 2GZAA 5L09A 4X68A 2W0NA 4II7A 3F1OA 2DRWA 1S1YA 4KZ3A 2XA7M 1HD8A 2OAQ1 2PU4A 2OLUA 4KQOA
chains in the Genus database with same CATH topology
4K08A 2P7JA 3MXQA 4CLCE 2RNGA 2D01A 1WQKA 1OTIA 1T18A 2W1TA 3D72A 4CLCC 1IOUA 2OWHA 1H5OA 3PBRA 3T4LA 1OTEA 4OOLA 3UB7A 3P01A 1UWNX 4GW9A 2W3EA 3KSFA 4WLAA 2PR6A 3V67A 1OJGA 2EWWA 1D7EA 4Y2FA 3MF0A 2W3HA 3NOPC 3S7PA 2ZMFA 5AJGA 1S4SA 4R6LA 5KSHA 5J4EA 1LT0A 1OTDA 4WEJA 1TD5A 5DKKA 3JVUA 1OTBA 3R7WA 1IFQA 3CITA 3B47A 3T4KA 4QPRA 1NLZA 3H9WA 4YOFA 2QJ5A 2ZOIA 4LLOB 1UGUA 4WN5A 4F3LB 1S67L 2ZOHA 2NUPC 2B9KA 3GDIA 3EOIA 4WL9A 3K3CA 3ULFA 2A2LA 3C30A 1T1AA 3T4QA 3R4KA 1V9ZA 2GJ3A 4MN7A 2JKTI 2SH1A 3EQVA 3OOVA 2QJ7A 5EFWA 1VB6A 2XRNA 4NXEA 4JGRA 3KSHA 3F1PB 4EEUA 4EERA 3VV4A 2DMWA 3T50A 1OT6A 3LUQA 3LICA 1GSWA 4LRZE 2XXLA 2O9CA 2BASA 2JTOA 3PBNA 2BDSA 3LR3A 2W1TB 3E4PA 3LIAA 3OCNA 2MJ6A 1XFQA 2OAP1 1TS7A 3E0YA 4BMWA 4JGOA 4UQIM 3IBRA 4I3JA 3PBOA 3E98A 4CLCA 2PYPA 2VZWA 2YKFA 4NXBA 4F3LA 2I9VA 1ODVA 3PXPA 5J3WA 3ZQ5A 2J3TC 4EUVA 3PYPA 3RH8B 5F68A 4HI4A 2L4RA 2YKHA 3OCLA 4IUHA 2O0YA 2P08A 3A0VA 1T1BA 4P6ZM 1OT9A 5HSQA 3O5YA 2WKRA 4HOIA 2JKRM 2J3TD 3TE8A 2V0WA 3LR4A 3CUEA 1Y28A 3P7NA 4HP9A 4G3WA 3U2AA 3KSGA 4R38A 2QSFA 1ZTUA 1ZHHB 2PD7A 3KO6A 1EW0A 1S66L 3MYVA 4ARZA 3H82B 3EGDC 4H6JB 1TS8A 3PR6A 3NJAA 3A0RA 3MQ0A 3LIEA 2O99A 5I5LA 2A24A 1X0OA 2KOIA 1GSXA 3MFXA 4MN5A 2VEAA 4CLCB 4UQIS 4BBTA 3LR5A 4JGQA 3PBSA 4GS9A 3LMSB 3C38A 3T4SA 3T4TA 2Z6CA 2HJEA 1LSWA 3H7WB 3BQ8A 4FOFA 4O01A 4O0PA 4Q0JA 5TBMB 5IS1A 4I5SA 4PAUA 4OOMA 3MR0A 3HCYA 3MCXA 3F1NA 1DP9A 1F5MA 3BWLA 3IS2B 3F1NB 2B18A 2KDKA 4ETZA 1S1ZA 1STZA 2IKDA 1DRMA 4HHDA 1T1CA 3F1OB 5IU1A 1WXNA 2VGLS 3NHQA 4IHQA 4NKPA 2H28A 2L1MA 3D4UB 2M1CA 3F1PA 4NXGA 2M7VA 1P9WA 4MCWA 2V9AA 3FG8A 4GJ4A 3IBJA 3LIFA 2W3DA 5DF9A 2Y8HA 1DP6A 3H82A 1V9YA 4I39A 4XT2B 1UWPX 4Q0HA 4KQDA 2B02A 4P6ZS 4B9OA 2EA9A 2VLGA 4NXFA 4O8GA 1YSQA 4CLCD 1W63Q 2Z6DA 5F6AA 4UEYA 1D6BA 2XA7S 2W3GA 3H7WA 4EESA 5DFXA 2QWSA 2JKTM 2J3WA 4L0LA 3A0SA 2VV8A 4HQAA 5DJUA 3VE4A 2ZBBA 3LIDA 2PD8A 4YIRA 3EEHA 3G6OA 3TRCA 4BWIA 3UE6A 2J80A 4MMNA 2L0WA 1P97A 1ATXA 4ME4A 3UB6A 1G6OA 3FPWA 3UB9A 3LFVA 3EWKA 3NOTC 5KIZA 2W27A 3BY9A 3UMEA 1ZUEA 3LI9A 2K2XA 3PBTA 4GHIA 5HZHA 3BY8A 2K31A 1JNUA 1SHIA 3JVVA 2PDRA 3K3DA 4EXOA 2WKPA 1AHLA 4GS9B 4HJ3A 2PYRA 5MC7A 2H9XA 5TBMA 1H3QA 2G7UA 2OWJA 4LRXC 4Q0IA 3UE3A 4JGPA 2EWVA 1ZUFA 2XSSA 2D02A 1XJ4A 4DJ3A 3B42A 3S7QA 4Z1WA 4G3VA 4HJ6A 4HJ4A 2Y79A 2R78A 4YNRA 1OPXA 1TS0A 2K7SA 1YSPA 1MKMA 2QKPA 2VJWA 3CLOA 4ETXA 1F98A 3C8CA 3MQOA 3EEAA 3W2ZA 4GLQA 4YWZA 3PHYA 1DP8A 3CWFA 3PBQA 2NUTC 2W1RA 4HIAA 4NEED 4ARZB 1N9LA 2V1AA 1XJ2A 2OOLA 2GNXA 3GECA 3CI6A 1OJ5A 2IA2A 3MJQA 4BBVA 1MZUA 1NWZA 4I3AA 3UB8A 3T4JA 3K2NA 4XT2A 3FC7A 2HV1A 1P9RA 3TW8A 4E04A 4EU0A 5A8BA 2XROA 2M7UA 2MUBA 2VV6A 4GCZA 2O9AA 2V1BA 2DLAA 3KYZA 4KUKA 4EQ1A 1G28A 4AFIA 2VV7A 3T4OA 4IUKA 5HDSA 4EEPA 4HP4A 1N9NA 3LR0A 4EETB 5AVFA 1MC0A 5HWWA 1BDSA 5F5YA 4DMZA 4BJPA 2PT7A 1ZLHB 1P0ZA 4LRYC 1GSVA 3LYXA 3HJKA 1NLYA 2WKQA 4L9EA 4LPZA 3LIBA 4HY8A 4RQ9A 5J7EA 1TS6A 2QHKA 4DJ2A 3VE3A 5L8MA 1T19A 2QYBA 2QSHA 3OLOA 4G3KA 4CQHA 4M4XA 1ZLIB 5HWTA 4MDZA 1Z99A 4IJGA 4PHTA 4WF0A 1WA9A 4WEKA 4R3AA 4FSFA 3FPVA 1LSVA 2V0UA 2JN7A 3B33A 4PKYA 3SW1A 3S7OA 3OC2A 5IT5A 1N9OA 1LL8A 5G4YA 3KX0X 5HL6A 4PKYG 4Y5FA 2JKRI 1W63M 4BBUA 2VGLM 3EQUA 4B93A 5TJJA 5HPFA 1H8MA 2INWA 2PHYA 2HGVA 3VOLA 2W3FA 2LB9A 1KOUA 2LB5A 2O9BA 5K5BA 4I3IA 1F9IA 4L9FA 5CX7A 4Y3IA 2K2NA 2VX8A 1D06A 3ICYA 3MQQA 5HDDA 4WUJA 2CMNA 4HH2A 3C2WA 5HD3A 1NRJA 1TF1A 2PR5A 2GX5A 2P04A 2QSGA 1XJ6A 2VKSA 5C5KA 4MN6A 3UMDA 4HH3A 3NOUC 1XFNA 3D3OA 5F69A 3BJNA 4H6JA 5HDCA 3CUEC 1SH1A 3EGXC 4L9GA 4GHIB 5DJTA 1YKDA 2VA0A 5HD5A 3RFBA 2FZ0A 2A24B 4ZRRA 3OBFA 3S7NA 4WELA 3RTYA 2MN3A 1BYWA 3BQAA 3BW6A 4GV5A 2KX6A 3KEZA 1B8WA 4R70A 1XJ3A 4HNBA 3R7WB 2IKEA 5DFYA 1S4RA 3LI8A 5FL3A 4EW7A 1YAXA 2GZAA 3E4OA 3MMHA 3E4QA 4I38A 5G4ZA 3KYQA 2W0NA 4II7A 3DBAA 3F1OA 3HJIA 3TJZC 2HJ9C 4DN0A 5LBRA 2FH5A 1S1YA 4KUOA 5HPIA 3IS2A 2JR3A 2ZMVA 3ZYTA 2XA7M 5AVEA 3KSIA 1OTAA 2JHEA 5DKLA 1APFA 3CAXA 2OAQ1 1LSXA 1VHMA 5HWVA 2KLIA 2HF6A 4KQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJ9 C;  3C30 A;  2HJE A;  1ZHH B;  3C38 A; 
#chains in the Genus database with same CATH topology
 4K08 A;  4X1L A;  3MXQ A;  4CLC E;  1WQK A;  1OTI A;  2HZ5 A;  1ES5 A;  2W1T A;  5EOO A;  3T4L A;  1OTE A;  3UB7 A;  2Y2P A;  3CPT B;  4ZDX A;  5HAQ A;  4Y2F A;  3NOP C;  3O3V A;  5AJG A;  3DTE A;  1S4S A;  3A3F A;  2Q9M A;  2EX2 A;  4WEJ A;  3R7W A;  1H0M A;  2C6W B;  3BFF A;  4QPR A;  1NLZ A;  1F2K A;  2JC7 A;  2WGW A;  4F3L B;  3FV7 A;  1CEG A;  1XP4 A;  1FIK A;  3GDI A;  4WL9 A;  3ULF A;  2A2L A;  1T1A A;  4EQI A;  3R4K A;  2J8Y A;  4X6T A;  1A0K A;  2GJ3 A;  1KDW A;  5EFW A;  2QJ7 A;  1FSW A;  3OZH A;  4NXE A;  4KQQ A;  3F1P B;  1VET A;  2B95 A;  3LIC A;  2QMI A;  1JWZ A;  1H8Z A;  2BAS A;  3B3X A;  2BDS A;  2PRF A;  2R9X A;  5KMW A;  1KGF A;  4OLD A;  3MZD A;  2MJ6 A;  1XFQ A;  4MBK A;  2ACG A;  1S0W A;  3ITA A;  4PM5 A;  1NYY A;  4F3L A;  2I9V A;  5J3W A;  2H5S A;  2IWB A;  2HPB A;  3RH8 B;  5E43 A;  5F68 A;  5F1G A;  2Z2M B;  1PYY A;  5CHM A;  5CER A;  5TR7 A;  4OH0 A;  4HOI A;  4MLL A;  2JKR M;  5AQA A;  3LR4 A;  3CUE A;  4E3I A;  4RYE A;  3G35 A;  2WZZ A;  4EBL A;  1BLH A;  3KSG A;  4R38 A;  2QSF A;  2Y2L A;  2PD7 A;  4E3L A;  3E2L A;  3H82 B;  4H6J B;  4LV1 A;  3NJA A;  4JPM A;  5CEB A;  1K38 A;  3LIE A;  1GA9 A;  3N7W A;  5I5L A;  2A24 A;  4ZJ1 A;  4MN5 A;  2VEA A;  4CLC B;  4UQI S;  4ZJ2 A;  4WMC D;  4JGQ A;  3W4Q A;  4DXC A;  3LMS B;  4JXG A;  3GVB A;  1W7F A;  1ERO A;  4FOF A;  3BQ8 A;  2Q0O A;  4O0P A;  5DF8 A;  5TBM B;  4I5S A;  3MR0 A;  3HCY A;  3MCX A;  1JWP A;  2JCH A;  3F1N A;  3F1N B;  2KDK A;  1S1Z A;  1STZ A;  3SS4 A;  4IBR A;  4XUZ A;  3NHQ A;  2UV0 E;  3HLD A;  3BLS A;  2XR0 A;  2M7V A;  3UDI A;  3W8K A;  3E2K A;  1MXO A;  5CTM A;  5DF9 A;  2Y2H A;  2Y8H A;  3C5A A;  1NRF A;  4XT2 B;  4BL2 A;  1XA1 A;  4Q0H A;  1XX2 A;  5FQ9 A;  1BZA A;  4UA7 A;  1FIL A;  2EA9 A;  1NY0 A;  4N92 A;  4CLC D;  2IWD A;  4P85 A;  1LI9 A;  2XA7 S;  2W3G A;  4L0L A;  2Y2K A;  3Q7V A;  1KGE A;  1GHP A;  4R1G A;  2DCF A;  1MWT A;  1LI0 A;  3G6O A;  4E3K A;  4FH4 A;  3UE6 A;  3T1S A;  4QD4 A;  4ME4 A;  3UB6 A;  3FPW A;  2EFX A;  3EWK A;  2J7V A;  4JBF A;  1KE0 A;  5L2F A;  1PZP A;  2ZM0 A;  5KIZ A;  5CXW A;  2W27 A;  1BTL A;  3BY9 A;  3UME A;  3LI9 A;  3GTC A;  1VQQ A;  3BFG A;  1KVL A;  5HZH A;  3MFD A;  1MY8 A;  5CRF A;  1N4O A;  2PYR A;  4OON A;  2G7U A;  4LRX C;  2HDR A;  3NIA A;  1ZUF A;  1YQS A;  2D02 A;  1XJ4 A;  2XSS A;  3B42 A;  4Z1W A;  4HJ6 A;  1IKI A;  2WGW B;  4ID4 A;  1IYS A;  2WYX A;  1F98 A;  3C8C A;  3ZCZ A;  1MPL A;  4R23 A;  4GLQ A;  4YWZ A;  1N9B A;  3PHY A;  1YMX A;  3PBQ A;  5A90 A;  4HIA A;  2JBF A;  2IWC A;  2V1A A;  1XJ2 A;  3MJQ A;  2GNX A;  1OJ5 A;  2IA2 A;  1C3B A;  3OPR A;  4GNU A;  1M6K A;  3T4J A;  4OPQ A;  4XT2 A;  1EWZ A;  2XRO A;  4GOG A;  4O7D A;  5KZH A;  4AFI A;  2HDQ A;  4DRT A;  4XUX A;  4IUK A;  1NZU A;  2HDS A;  1SKO B;  3VFF A;  1N9N A;  5FAQ A;  4QHC A;  3LR0 A;  3M2K A;  4EET B;  3LY3 A;  3MKE A;  4DMZ A;  4LRY C;  1GSV A;  1IYQ A;  4EUZ A;  1FSY A;  4R4S A;  1NLY A;  1TEM A;  1ERM A;  4LPZ A;  3G32 A;  4BEN A;  5J7E A;  1YLY A;  4BD1 A;  3PAG A;  3VE3 A;  3WS1 A;  1T19 A;  3OLO A;  4G3K A;  1G68 A;  3A3I A;  4X56 A;  4WF0 A;  4FSF A;  1E25 A;  1RGY A;  5CGW A;  3CZD A;  3G2Y A;  4GKU A;  2XF3 A;  3V3R A;  5U47 A;  3OC2 A;  4PKY G;  1SCW A;  1PFL A;  3FWL A;  3VP0 A;  4BBU A;  5L07 A;  2VGL M;  3Q7Z A;  1Y4O A;  5HPF A;  1FR1 A;  1H8M A;  3TOI A;  4U0X A;  4QJG A;  3VOL A;  2W3F A;  2LB9 A;  1KOU A;  2LB5 A;  2O9B A;  5K5B A;  2FFF B;  1F9I A;  5CX7 A;  2XD5 A;  2VX8 A;  4KZ9 A;  5GLD A;  2CMN A;  4HH2 A;  1NRJ A;  3OPL A;  2XK1 A;  3LGO A;  1K54 A;  1K6S A;  3SH9 A;  2PR5 A;  1W79 A;  4BL3 A;  2GX5 A;  4ZTK A;  3LEQ A;  2WUQ A;  2H0T A;  5F69 A;  1ACF A;  4H6J A;  5HDC A;  3CUE C;  1SH1 A;  4L9G A;  5DJT A;  5FI7 A;  2WKH A;  4S2L A;  3G4P A;  2A24 B;  4ZRR A;  3OBF A;  1HLU P;  3RTY A;  3N4I A;  2Y59 A;  1HTZ A;  2KX6 A;  1EI5 A;  3UE1 A;  1NJ4 A;  1B8W A;  4R70 A;  3G31 A;  5HAR A;  3VOY A;  3LI8 A;  1GHM A;  5EUA A;  5HW3 A;  3DBA A;  1WYB A;  2ZQ9 A;  3VP3 A;  2JR3 A;  2ZMV A;  5AVE A;  3KSI A;  5DKL A;  1APF A;  3CAX A;  4N9L A;  3IF6 A;  1VHM A;  2HF6 A;  2ZJ9 A;  1GHI A;  2RNG A;  1H5O A;  1G6A A;  1ONH A;  4KZ4 A;  3BRM A;  4GW9 A;  5A91 A;  3ZG9 B;  3ZG8 B;  4WLA A;  2PR6 A;  3G34 A;  2EWW A;  2XQZ A;  3A3E A;  4PM8 A;  3MF0 A;  1K56 A;  4Y17 A;  3QHY A;  5J4E A;  3NEC A;  1LT0 A;  1KE3 A;  5DKK A;  1YLT A;  3MKF A;  4IBX A;  3B47 A;  4N9K A;  4Z9Q A;  1ZC2 A;  3T4K A;  3H9W A;  4YOF A;  4A5R A;  2CC1 A;  3VFH A;  5CTN A;  4C75 A;  1K54 C;  1EL6 A;  3NDE A;  2EXB A;  4LV0 A;  4MBF A;  3M6B A;  1CQA A;  3T4Q A;  1PWC A;  5FAS A;  2JKT I;  1KE4 A;  3KSH A;  4EEU A;  3VV4 A;  2WGV A;  3T50 A;  1OT6 A;  4WZ5 A;  1GSW A;  2XXL A;  2O9C A;  3C4O A;  1S6R A;  3LR3 A;  2W1T B;  3E4P A;  3GSG A;  5FAO A;  4CJN A;  3IF5 A;  2OAP 1;  1TS7 A;  3E0Y A;  4OQI A;  4I3J A;  3E98 A;  4S2M A;  2PU2 A;  1BUE A;  4NXB A;  3DW0 A;  5FEG A;  1YLW A;  1ODV A;  2X02 A;  1IEM A;  1L0D A;  4WZ4 A;  3PYP A;  5EVI B;  3WS0 A;  4BD0 A;  4JF5 A;  4HI4 A;  5F1F A;  2L4R A;  2G2U A;  1QME A;  2A3U A;  2XGN A;  4FD8 A;  3O5Y A;  2WKR A;  1ESI A;  2J3T D;  2WAD A;  2V0W A;  2ZC6 B;  1K55 C;  4G3W A;  2ZM2 A;  4R0Q A;  4ARZ A;  3BFD A;  1SHV A;  2ZL1 A;  3PR6 A;  1Q2P A;  3MQ0 A;  2O99 A;  1I2W A;  1NYM A;  1X0O A;  3HLB A;  3DWZ A;  2WAF A;  3L7H A;  1LL5 A;  4IVI A;  4S2N C;  1W8Y A;  3T4T A;  4F94 A;  3HUO A;  3Q07 A;  3N8L A;  2B18 A;  5HAI A;  2IKD A;  1J3W A;  1T1C A;  3F1O B;  3T12 B;  1YPR A;  1LL9 A;  4IHQ A;  2ZLY A;  3D4U B;  4DXB A;  2Y2Q A;  1LHY A;  4EBN A;  1P9W A;  3P98 A;  1O7E A;  3FG8 A;  3NBL A;  2Y2G A;  3IBJ A;  3IXB A;  2ZQC A;  1DP6 A;  1UWP X;  4P6Z S;  4B9O A;  4C6Y A;  4ZAM A;  1LLB A;  1D6B A;  4LCL A;  3H7W A;  5DFX A;  2J3W A;  4WZ5 C;  5EPH A;  1SKF A;  1NZO A;  4S2N A;  4S2J A;  1L2S A;  1DJA A;  1M40 A;  2ZBB A;  4LGW A;  4X1M A;  3LO7 A;  4YIR A;  4ZJ3 A;  3TRC A;  2XH9 A;  2ZQA A;  3NC8 A;  2J80 A;  4BWI A;  3HL9 A;  4MMN A;  2XDM A;  3QP5 A;  4DKI A;  1G6O A;  4E6X A;  3IF6 B;  3NOT C;  1ZUE A;  1K4E A;  4GHI A;  2EFU A;  4RX2 A;  1IYO A;  2A49 A;  2WKP A;  4LV3 A;  5MC7 A;  1ZKJ A;  5KSC A;  1H3Q A;  3UE3 A;  2EWV A;  4OOY A;  4E6W A;  1BLP A;  5EEC A;  3ITB A;  4HJ4 A;  2Y79 A;  1K4F A;  1TS0 A;  2ZQD A;  1YSP A;  2VJW A;  3CLO A;  5JYP A;  4OPZ A;  1FCO A;  5FI6 A;  4P0M A;  5FQM A;  3RXW A;  1RGZ A;  3CWF A;  2W1R A;  4JF4 A;  4B4X A;  4R3J A;  2WKE A;  5F83 A;  1N9L A;  3CI6 A;  4BBV A;  3BFE A;  1MWR A;  1NWZ A;  4I3A A;  3CJM A;  3GV9 A;  3UB8 A;  5TFQ A;  1YM1 A;  3FC7 A;  5FDS A;  4E04 A;  4EU0 A;  5EVL A;  2MUB A;  2VV6 A;  4WBG A;  3NUL A;  4KUK A;  4EQ1 A;  5FEF A;  4E3N A;  4U3T A;  1ES3 A;  3ZVT A;  1ZG4 A;  3MXS A;  1E4D A;  4HP4 A;  3D4F A;  2G2W A;  1SZV A;  4K0W A;  3ZNY A;  4LEN A;  5HWW A;  1BDS A;  3ZVW A;  1FQG A;  2PT7 A;  1P0Z A;  3W4O A;  2E8J A;  3IXG A;  3Q1F A;  3HRE A;  5CEC A;  5G18 A;  4DJ2 A;  3VMA A;  1CF0 A;  1E3U A;  2WAE A;  4OQG A;  3MS6 A;  2Y2N A;  4S2K A;  3IWO A;  4M4X A;  1ZLI B;  1CI9 A;  5HWT A;  4MDZ A;  2JKG A;  4R3A A;  5EVE A;  3IX3 A;  1XKZ A;  1LSV A;  3AGD A;  2V0U A;  4PMA A;  1PZO A;  3B33 A;  3SW1 A;  4KZ7 A;  3C4P A;  5HL6 A;  4Y5F A;  4K0X A;  3PAE A;  3EQU A;  3SOI A;  3I7J A;  1Z09 A;  5CGS A;  1BUL A;  4H8R A;  3FZC A;  4HBU A;  1PNE A;  4Y3I A;  3S1Y A;  4Y0U A;  1D06 A;  3ICY A;  3MQQ A;  3OPH A;  4WUJ A;  3CHW P;  4JXV A;  3C2W A;  5HD3 A;  2X01 A;  1YLJ A;  5FQI A;  1I5Q A;  5A93 A;  2P04 A;  1XJ6 A;  1KDS A;  1L0G A;  2Z2L B;  4HH3 A;  3NOU C;  1XFN A;  3TSG A;  3RXX A;  2J9P A;  3QNB A;  3ZFZ A;  1TVF A;  2VA0 A;  5E2E A;  5AQB A;  4OPR A;  2B5R A;  2ZC3 B;  4WEL A;  2OSU A;  1BYW A;  4GV5 A;  5HX9 A;  1RP5 A;  4OQ0 A;  1XJ3 A;  4HNB A;  5DFY A;  1MWS A;  1S4R A;  3UDX A;  5FL3 A;  1YAX A;  4Y15 A;  3E4Q A;  3CMZ A;  2JKF A;  1CI8 A;  3HJI A;  3TJZ C;  2HJ9 C;  2ZC4 B;  5LBR A;  2Y2J A;  3ZYT A;  3A3D A;  2JHE A;  4OKP A;  5HWV A;  3WRZ A;  2D01 A;  1AWI A;  4CLC C;  2WGI A;  4QY5 A;  2OWH A;  3PBR A;  5EM1 A;  1UWN X;  4KG2 A;  4B4Z A;  2JE5 A;  3V67 A;  1OJG A;  3CPT A;  1D7E A;  1MWU A;  2W3H A;  4XXR A;  4PM9 A;  4R6L A;  2V8C A;  4NG2 A;  3UE0 A;  1TD5 A;  2RCX A;  2XEP A;  5A92 A;  5FQJ A;  3VOZ A;  2J9O A;  4D2O A;  4EWF A;  1UGU A;  4WN5 A;  1S67 L;  4KZ8 A;  2NUP C;  3EOI A;  3FKW A;  2VGJ A;  3C30 A;  1DY6 A;  1V9Z A;  4MN7 A;  3T1R A;  3OOV A;  4N1H A;  1VB6 A;  2XRN A;  3GRJ A;  4UA6 A;  1ERQ A;  4D60 A;  4JGR A;  5E2H A;  4M3K A;  1PI4 A;  3LIA A;  4JXS A;  4BMW A;  4DF6 A;  4UQI M;  5EM0 A;  2PYP A;  2VZW A;  2YKF A;  3O88 A;  3PXP A;  1PW1 A;  5DTT A;  3ZQ5 A;  4Y0O A;  3A0V A;  4P6Z M;  1OT9 A;  5HSQ A;  3TE8 A;  1Y28 A;  3P7N A;  4HP9 A;  3MBZ A;  2ZD8 A;  1XPB A;  5TGF A;  5GLB A;  1ZTU A;  2ZMA A;  1ZHH B;  3JYI A;  2Y2O A;  3KO6 A;  3MYV A;  4S2I A;  1TS8 A;  3UDF A;  1CJF A;  3HLW A;  2KOI A;  4HES A;  3MFX A;  1Y54 A;  3PBS A;  3UY6 A;  1Z6F A;  3T4S A;  2Z6C A;  4O01 A;  3H7W B;  4Q0J A;  5IS1 A;  4PAU A;  4OOM A;  3V5M A;  1PIO A;  1F5M A;  3BWL A;  3IS2 B;  2ZQ8 A;  3UPO A;  1DRM A;  1GA0 A;  5FQQ A;  2EXA A;  5IU1 A;  1WXN A;  2V20 A;  2EX6 A;  4NKP A;  2M1C A;  3F1P A;  4NXG A;  1FCM A;  3DTI A;  2QPN A;  3LEZ A;  5IHV A;  3V39 A;  4MCW A;  4GDB A;  4GJ4 A;  1V9Y A;  4I39 A;  1KGG A;  4KQD A;  1GL9 B;  2VK3 A;  3DAV A;  3MSH A;  3C7U A;  1H5X A;  4O8G A;  1YSQ A;  1W63 Q;  1K6R A;  3T1X A;  1GCE A;  3V50 A;  5EV0 A;  5M1A A;  2QWS A;  2JKT M;  3NDG A;  3WS4 A;  1BLC A;  3W4P A;  3A0S A;  4HQA A;  4WYY A;  2V8F A;  4NK3 A;  4EV4 A;  3DTM A;  3T1Q B;  3VE4 A;  4LV2 A;  3DWK A;  2PAV P;  1ATX A;  3BLM A;  1U60 A;  3UB9 A;  3ZG5 A;  3M6H A;  1GKU B;  4R3B A;  1MKI A;  2HDU A;  3IH8 A;  5FAT A;  3PBT A;  2P9V A;  3NI9 A;  3BY8 A;  3TG9 A;  1YLZ A;  3JVV A;  2PDR A;  4EXO A;  1AHL A;  4GS9 B;  3ZNT A;  2FFY A;  3S4X A;  3HLF A;  2Q9N A;  1K56 D;  4B88 A;  1ES2 A;  4DJ3 A;  4HBT A;  4G3V A;  4WM9 A;  3IF6 C;  3ZG7 B;  2K7S A;  1KVM A;  2EX9 A;  5FQK A;  4ETX A;  3MQO A;  3GQZ A;  5E2F A;  5DTS A;  2QZ6 A;  1DP8 A;  2HP9 A;  2NUT C;  4KZB A;  3G2Z A;  1TDL A;  5DF7 A;  3QP6 A;  2OV5 A;  1SDN A;  3IWQ A;  4YFM A;  4KQR A;  3M2J A;  5E2G A;  2OOL A;  3GEC A;  2P9V B;  3OPP A;  3K2N A;  1JTD A;  3TW8 A;  2HV1 A;  2M7U A;  4PM7 A;  5FDH A;  2DNS A;  2O9A A;  2V1B A;  2DLA A;  3IHA A;  3KYZ A;  4HEF A;  1G28 A;  2VV7 A;  2ZC5 B;  4FCF A;  4QWO A;  1D1J A;  4LFU A;  5FAP A;  1L0F A;  3HUN A;  5AVF A;  1MC0 A;  5F5Y A;  5DTK A;  3BEB A;  3LYX A;  4GZB A;  5AQ9 A;  2WKQ A;  4L9E A;  4JKT A;  4RQ9 A;  3BFC A;  2QHK A;  3UPP A;  4X25 A;  2XFT A;  1K25 A;  5L8M A;  2Y4A A;  3PTE A;  2RL3 A;  2H10 A;  1VM1 A;  3QP2 A;  4MBH A;  3L9K A;  3MZF A;  1FCN A;  4IJG A;  4PHT A;  4YIN A;  1WA9 A;  4WEK A;  4CPK A;  3FPV A;  5M19 A;  3IHB A;  2JN7 A;  3S7O A;  5IT5 A;  1N9O A;  3G30 A;  3KX0 X;  2BLS A;  1QMF A;  4R4R A;  2ZQ7 A;  3Q7V B;  1SKO A;  2HGV A;  3BEC A;  3NCK A;  2K2N A;  4UAA A;  3VP4 A;  4GD8 A;  5HDD A;  5FA7 A;  3A3J A;  5CHJ A;  1TF1 A;  1OME A;  2VKS A;  5C5K A;  3UMD A;  4Y7P A;  3BJN A;  1HVB A;  4GHI B;  1YKD A;  2HP6 A;  3Q82 A;  5HD5 A;  2FZ0 A;  5GHZ A;  2Y2I A;  5GHX A;  1ESU A;  4X53 A;  3U4L P;  2XD1 A;  3S7N A;  4E3O A;  2PBY A;  3VSK A;  2HP5 A;  3KEZ A;  4Y0T A;  3R7W B;  2IKE A;  4BQM A;  5FSR A;  3LY4 A;  4UA9 A;  1PI5 A;  1K57 A;  3E4O A;  3MMH A;  1JTG A;  5EVI A;  1PRQ A;  4I38 A;  5G4Z A;  3KYQ A;  1O07 A;  4DN0 A;  2FH5 A;  4KUO A;  5HPI A;  1YT4 A;  3IS2 A;  4NET A;  1OTA A;  1VET B;  1LSX A;  5HL1 A;  4N1X A;  2KLI A;  3HBR A;  2P7J A;  2VGK A;  1T18 A;  3D9Y A;  3D72 A;  1WE4 A;  1IOU A;  1AXB A;  3UPN A;  4OOL A;  3P01 A;  3P09 A;  1BT5 A;  4GD6 A;  1L0E A;  2W3E A;  2ZL1 B;  3KSF A;  4WMC A;  4RX3 A;  3S7P A;  5CED A;  2ZMF A;  1W8Q A;  5KSH A;  1OTD A;  3SH8 A;  3JVU A;  4BLM A;  1OTB A;  1IFQ A;  3CIT A;  2QJ5 A;  2ZOI A;  1FOF A;  4LLO B;  2PBD P;  2ZOH A;  2B9K A;  5I94 A;  3K3C A;  2V2F F;  4QU3 A;  3C7V A;  2SH1 A;  3EQV A;  4EER A;  3N8S A;  2DMW A;  3HLG A;  3IX8 A;  1YLP A;  3LUQ A;  4LRZ E;  1G5U A;  2JTO A;  3PBN A;  4FTX A;  4GN2 A;  5GHY A;  4P87 A;  2XFS A;  3OCN A;  4MEZ A;  3SZT A;  4JLF A;  4JGO A;  3HLE A;  3HLC A;  3IBR A;  3PBO A;  4CLC A;  3ZG0 A;  5EE8 A;  1DJC A;  2J3T C;  4EUV A;  2P74 A;  3FYZ A;  3Q81 A;  2YKH A;  3OCL A;  4IUH A;  2O0Y A;  3MZE A;  3AGF A;  3CG5 A;  2P08 A;  1T1B A;  3MXR A;  5CGX A;  1IYP A;  5BOH A;  4MNR A;  4E3M A;  3SS5 A;  1MBL A;  4FH2 A;  3QP4 A;  1XGI A;  4DE0 A;  1ALQ A;  5J8X A;  3SS3 A;  3U2A A;  5HAP A;  4E3J A;  2R9W A;  5D3O A;  1CK3 A;  1EW0 A;  1S66 L;  4DE2 A;  4OP8 A;  3EGD C;  3A0R A;  4KZ6 A;  2ZM8 A;  1GSX A;  4BBT A;  1Q2Q A;  3LR5 A;  4K91 A;  4IVK A;  1HZO A;  4GS9 A;  4DE1 A;  3C38 A;  1CEF A;  2HJE A;  1IKG A;  1LSW A;  3IWI A;  1PW8 A;  5EOE A;  1DP9 A;  2EX8 A;  4OPY A;  5M18 A;  4ETZ A;  3IX4 A;  4HHD A;  3VP2 A;  1NXY A;  4GDN A;  2VGL S;  2H28 A;  2L1M A;  5GL9 A;  3RJU A;  3ZGA B;  4DDY A;  5JYO A;  4X69 A;  2V9A A;  4JXW A;  4PPR A;  3LIF A;  3UB5 P;  2W3D A;  5EVI D;  3BYD A;  3ISG A;  3H82 A;  4LCM A;  1E3U D;  2B02 A;  3DTK A;  3GR2 A;  1JWV A;  1YMS A;  2VLG A;  4NXF A;  4RVA A;  2XLN A;  1ONG A;  3IXD A;  3VP1 A;  2Z6D A;  5F6A A;  4UEY A;  4EES A;  2VV8 A;  5DVA A;  4C3Q A;  2WKI A;  5F82 A;  5DJU A;  2BTF P;  3LID A;  3IF4 A;  2PD8 A;  3EEH A;  4P6B A;  1JVJ A;  3WRT A;  2L0W A;  1P97 A;  4KEN B;  3LFV A;  4Y13 A;  4PM6 A;  4QY6 A;  3AGE A;  2K2X A;  3WS5 A;  4QB8 A;  2ZC7 A;  2K31 A;  1JNU A;  1SHI A;  1TDG A;  3K3D A;  4HJ3 A;  1PWG A;  4ZBE A;  3UO9 A;  2H9X A;  2WK0 A;  5TBM A;  3SH7 A;  1ES4 A;  1BLS A;  2OWJ A;  3NY4 A;  4Q0I A;  4JGP A;  3IH9 A;  4GB7 A;  5FI2 A;  1XXM A;  3S7Q A;  3O86 A;  1L3L A;  2C5W B;  1XA7 A;  2R78 A;  4YNR A;  2OLV A;  1OPX A;  4Q8I A;  2QKP A;  1MKM A;  3V3S A;  1XGJ A;  3EEA A;  5HFO A;  3W2Z A;  4U0T A;  4KZ5 A;  1I2S A;  4NEE D;  4ARZ B;  1IEL A;  4IED A;  3KYE A;  3VSL A;  4FUW A;  1MZU A;  4RA7 A;  4OLG A;  4KG6 A;  1P9R A;  5A8B A;  2BG1 A;  1ZG6 A;  4UHU A;  4GCZ A;  5GLA A;  1RCJ A;  2AVX A;  3T4O A;  5HDS A;  2Y2M A;  4EEP A;  2E8I A;  3QNC A;  4OQH A;  3UNW A;  4BJP A;  1ZLH B;  1PWD A;  3HVF A;  4S2P A;  2Y91 A;  1W5D A;  3GMW A;  3HJK A;  4OVD A;  3IXH A;  3LIB A;  3N6I A;  3HUM A;  4HY8 A;  4JF6 A;  4KZA A;  3BM6 A;  1TS6 A;  5AQ7 A;  3LCE A;  1WYC A;  2QYB A;  2QSH A;  3N8R A;  3S22 A;  1BSG A;  4CQH A;  2WZX A;  3WWX A;  1Z99 A;  3ZDJ A;  2X71 A;  3IT9 A;  4PKY A;  1LL8 A;  5EVI C;  5G4Y A;  1DJB A;  1K57 C;  2JKR I;  1W63 M;  3O87 A;  1SDE A;  1FR6 A;  1J9M A;  4B93 A;  3FKV A;  5TJJ A;  2INW A;  2PHY A;  2GDN A;  4I3I A;  4L9F A;  1K0K A;  3QP8 A;  4OP5 A;  1H8Y A;  3JPU A;  4S2O A;  4EBP A;  2QSG A;  1VEU A;  4ESP A;  1VEU B;  4KG5 A;  4MN6 A;  3UN7 A;  2V1Z A;  3D3O A;  3IQA A;  4X55 A;  3EGX C;  3QP1 A;  5CHU A;  2UWX A;  5L10 A;  3ZHH A;  3RFB A;  3WS2 A;  4DE3 A;  2H0Y A;  2MN3 A;  3BQA A;  3BW6 A;  2I72 A;  5GLC A;  4DDS A;  2Y55 A;  4EW7 A;  1K55 A;  2GZA A;  5L09 A;  4X68 A;  2W0N A;  4II7 A;  3F1O A;  2DRW A;  1S1Y A;  4KZ3 A;  2XA7 M;  1HD8 A;  2OAQ 1;  2PU4 A;  2OLU A;  4KQO A; 
#chains in the Genus database with same CATH homology
 4K08 A;  2P7J A;  3MXQ A;  4CLC E;  2RNG A;  2D01 A;  1WQK A;  1OTI A;  1T18 A;  2W1T A;  3D72 A;  4CLC C;  1IOU A;  2OWH A;  1H5O A;  3PBR A;  3T4L A;  1OTE A;  4OOL A;  3UB7 A;  3P01 A;  1UWN X;  4GW9 A;  2W3E A;  3KSF A;  4WLA A;  2PR6 A;  3V67 A;  1OJG A;  2EWW A;  1D7E A;  4Y2F A;  3MF0 A;  2W3H A;  3NOP C;  3S7P A;  2ZMF A;  5AJG A;  1S4S A;  4R6L A;  5KSH A;  5J4E A;  1LT0 A;  1OTD A;  4WEJ A;  1TD5 A;  5DKK A;  3JVU A;  1OTB A;  3R7W A;  1IFQ A;  3CIT A;  3B47 A;  3T4K A;  4QPR A;  1NLZ A;  3H9W A;  4YOF A;  2QJ5 A;  2ZOI A;  4LLO B;  1UGU A;  4WN5 A;  4F3L B;  1S67 L;  2ZOH A;  2NUP C;  2B9K A;  3GDI A;  3EOI A;  4WL9 A;  3K3C A;  3ULF A;  2A2L A;  3C30 A;  1T1A A;  3T4Q A;  3R4K A;  1V9Z A;  2GJ3 A;  4MN7 A;  2JKT I;  2SH1 A;  3EQV A;  3OOV A;  2QJ7 A;  5EFW A;  1VB6 A;  2XRN A;  4NXE A;  4JGR A;  3KSH A;  3F1P B;  4EEU A;  4EER A;  3VV4 A;  2DMW A;  3T50 A;  1OT6 A;  3LUQ A;  3LIC A;  1GSW A;  4LRZ E;  2XXL A;  2O9C A;  2BAS A;  2JTO A;  3PBN A;  2BDS A;  3LR3 A;  2W1T B;  3E4P A;  3LIA A;  3OCN A;  2MJ6 A;  1XFQ A;  2OAP 1;  1TS7 A;  3E0Y A;  4BMW A;  4JGO A;  4UQI M;  3IBR A;  4I3J A;  3PBO A;  3E98 A;  4CLC A;  2PYP A;  2VZW A;  2YKF A;  4NXB A;  4F3L A;  2I9V A;  1ODV A;  3PXP A;  5J3W A;  3ZQ5 A;  2J3T C;  4EUV A;  3PYP A;  3RH8 B;  5F68 A;  4HI4 A;  2L4R A;  2YKH A;  3OCL A;  4IUH A;  2O0Y A;  2P08 A;  3A0V A;  1T1B A;  4P6Z M;  1OT9 A;  5HSQ A;  3O5Y A;  2WKR A;  4HOI A;  2JKR M;  2J3T D;  3TE8 A;  2V0W A;  3LR4 A;  3CUE A;  1Y28 A;  3P7N A;  4HP9 A;  4G3W A;  3U2A A;  3KSG A;  4R38 A;  2QSF A;  1ZTU A;  1ZHH B;  2PD7 A;  3KO6 A;  1EW0 A;  1S66 L;  3MYV A;  4ARZ A;  3H82 B;  3EGD C;  4H6J B;  1TS8 A;  3PR6 A;  3NJA A;  3A0R A;  3MQ0 A;  3LIE A;  2O99 A;  5I5L A;  2A24 A;  1X0O A;  2KOI A;  1GSX A;  3MFX A;  4MN5 A;  2VEA A;  4CLC B;  4UQI S;  4BBT A;  3LR5 A;  4JGQ A;  3PBS A;  4GS9 A;  3LMS B;  3C38 A;  3T4S A;  3T4T A;  2Z6C A;  2HJE A;  1LSW A;  3H7W B;  3BQ8 A;  4FOF A;  4O01 A;  4O0P A;  4Q0J A;  5TBM B;  5IS1 A;  4I5S A;  4PAU A;  4OOM A;  3MR0 A;  3HCY A;  3MCX A;  3F1N A;  1DP9 A;  1F5M A;  3BWL A;  3IS2 B;  3F1N B;  2B18 A;  2KDK A;  4ETZ A;  1S1Z A;  1STZ A;  2IKD A;  1DRM A;  4HHD A;  1T1C A;  3F1O B;  5IU1 A;  1WXN A;  2VGL S;  3NHQ A;  4IHQ A;  4NKP A;  2H28 A;  2L1M A;  3D4U B;  2M1C A;  3F1P A;  4NXG A;  2M7V A;  1P9W A;  4MCW A;  2V9A A;  3FG8 A;  4GJ4 A;  3IBJ A;  3LIF A;  2W3D A;  5DF9 A;  2Y8H A;  1DP6 A;  3H82 A;  1V9Y A;  4I39 A;  4XT2 B;  1UWP X;  4Q0H A;  4KQD A;  2B02 A;  4P6Z S;  4B9O A;  2EA9 A;  2VLG A;  4NXF A;  4O8G A;  1YSQ A;  4CLC D;  1W63 Q;  2Z6D A;  5F6A A;  4UEY A;  1D6B A;  2XA7 S;  2W3G A;  3H7W A;  4EES A;  5DFX A;  2QWS A;  2JKT M;  2J3W A;  4L0L A;  3A0S A;  2VV8 A;  4HQA A;  5DJU A;  3VE4 A;  2ZBB A;  3LID A;  2PD8 A;  4YIR A;  3EEH A;  3G6O A;  3TRC A;  4BWI A;  3UE6 A;  2J80 A;  4MMN A;  2L0W A;  1P97 A;  1ATX A;  4ME4 A;  3UB6 A;  1G6O A;  3FPW A;  3UB9 A;  3LFV A;  3EWK A;  3NOT C;  5KIZ A;  2W27 A;  3BY9 A;  3UME A;  1ZUE A;  3LI9 A;  2K2X A;  3PBT A;  4GHI A;  5HZH A;  3BY8 A;  2K31 A;  1JNU A;  1SHI A;  3JVV A;  2PDR A;  3K3D A;  4EXO A;  2WKP A;  1AHL A;  4GS9 B;  4HJ3 A;  2PYR A;  5MC7 A;  2H9X A;  5TBM A;  1H3Q A;  2G7U A;  2OWJ A;  4LRX C;  4Q0I A;  3UE3 A;  4JGP A;  2EWV A;  1ZUF A;  2XSS A;  2D02 A;  1XJ4 A;  4DJ3 A;  3B42 A;  3S7Q A;  4Z1W A;  4G3V A;  4HJ6 A;  4HJ4 A;  2Y79 A;  2R78 A;  4YNR A;  1OPX A;  1TS0 A;  2K7S A;  1YSP A;  1MKM A;  2QKP A;  2VJW A;  3CLO A;  4ETX A;  1F98 A;  3C8C A;  3MQO A;  3EEA A;  3W2Z A;  4GLQ A;  4YWZ A;  3PHY A;  1DP8 A;  3CWF A;  3PBQ A;  2NUT C;  2W1R A;  4HIA A;  4NEE D;  4ARZ B;  1N9L A;  2V1A A;  1XJ2 A;  2OOL A;  2GNX A;  3GEC A;  3CI6 A;  1OJ5 A;  2IA2 A;  3MJQ A;  4BBV A;  1MZU A;  1NWZ A;  4I3A A;  3UB8 A;  3T4J A;  3K2N A;  4XT2 A;  3FC7 A;  2HV1 A;  1P9R A;  3TW8 A;  4E04 A;  4EU0 A;  5A8B A;  2XRO A;  2M7U A;  2MUB A;  2VV6 A;  4GCZ A;  2O9A A;  2V1B A;  2DLA A;  3KYZ A;  4KUK A;  4EQ1 A;  1G28 A;  4AFI A;  2VV7 A;  3T4O A;  4IUK A;  5HDS A;  4EEP A;  4HP4 A;  1N9N A;  3LR0 A;  4EET B;  5AVF A;  1MC0 A;  5HWW A;  1BDS A;  5F5Y A;  4DMZ A;  4BJP A;  2PT7 A;  1ZLH B;  1P0Z A;  4LRY C;  1GSV A;  3LYX A;  3HJK A;  1NLY A;  2WKQ A;  4L9E A;  4LPZ A;  3LIB A;  4HY8 A;  4RQ9 A;  5J7E A;  1TS6 A;  2QHK A;  4DJ2 A;  3VE3 A;  5L8M A;  1T19 A;  2QYB A;  2QSH A;  3OLO A;  4G3K A;  4CQH A;  4M4X A;  1ZLI B;  5HWT A;  4MDZ A;  1Z99 A;  4IJG A;  4PHT A;  4WF0 A;  1WA9 A;  4WEK A;  4R3A A;  4FSF A;  3FPV A;  1LSV A;  2V0U A;  2JN7 A;  3B33 A;  4PKY A;  3SW1 A;  3S7O A;  3OC2 A;  5IT5 A;  1N9O A;  1LL8 A;  5G4Y A;  3KX0 X;  5HL6 A;  4PKY G;  4Y5F A;  2JKR I;  1W63 M;  4BBU A;  2VGL M;  3EQU A;  4B93 A;  5TJJ A;  5HPF A;  1H8M A;  2INW A;  2PHY A;  2HGV A;  3VOL A;  2W3F A;  2LB9 A;  1KOU A;  2LB5 A;  2O9B A;  5K5B A;  4I3I A;  1F9I A;  4L9F A;  5CX7 A;  4Y3I A;  2K2N A;  2VX8 A;  1D06 A;  3ICY A;  3MQQ A;  5HDD A;  4WUJ A;  2CMN A;  4HH2 A;  3C2W A;  5HD3 A;  1NRJ A;  1TF1 A;  2PR5 A;  2GX5 A;  2P04 A;  2QSG A;  1XJ6 A;  2VKS A;  5C5K A;  4MN6 A;  3UMD A;  4HH3 A;  3NOU C;  1XFN A;  3D3O A;  5F69 A;  3BJN A;  4H6J A;  5HDC A;  3CUE C;  1SH1 A;  3EGX C;  4L9G A;  4GHI B;  5DJT A;  1YKD A;  2VA0 A;  5HD5 A;  3RFB A;  2FZ0 A;  2A24 B;  4ZRR A;  3OBF A;  3S7N A;  4WEL A;  3RTY A;  2MN3 A;  1BYW A;  3BQA A;  3BW6 A;  4GV5 A;  2KX6 A;  3KEZ A;  1B8W A;  4R70 A;  1XJ3 A;  4HNB A;  3R7W B;  2IKE A;  5DFY A;  1S4R A;  3LI8 A;  5FL3 A;  4EW7 A;  1YAX A;  2GZA A;  3E4O A;  3MMH A;  3E4Q A;  4I38 A;  5G4Z A;  3KYQ A;  2W0N A;  4II7 A;  3DBA A;  3F1O A;  3HJI A;  3TJZ C;  2HJ9 C;  4DN0 A;  5LBR A;  2FH5 A;  1S1Y A;  4KUO A;  5HPI A;  3IS2 A;  2JR3 A;  2ZMV A;  3ZYT A;  2XA7 M;  5AVE A;  3KSI A;  1OTA A;  2JHE A;  5DKL A;  1APF A;  3CAX A;  2OAQ 1;  1LSX A;  1VHM A;  5HWV A;  2KLI A;  2HF6 A;  4KQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...