2HJEA

Crystal structure of vibrio harveyi luxq periplasmic domain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
220
structure length
210
Chain Sequence
SKQQTSALIHNIFDSHFAAIQIHHDSNSKSEVIRDFYTDRDTDVLNFFFLSIDQSDPSHTPEFRFLTDHKGIIWDDGNAHFYGVNDLILDSLANRVSFSNNWYYINVMTSIGSRHMLVRRVPILDPSTGEVLGFSFNAVVLDNNFALMEKLKSESNVDNVVLVANSVPLANSLIGDEPYNVADVLQLLVIETPIVVNAVTTELCLLTVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Autoinducer 2 sensor kinase/phosphatase luxQ
publication title Ligand-induced asymmetry in histidine sensor kinase complex regulates quorum sensing.
pubmed doi rcsb
source organism Vibrio harveyi
total genus 64
structure length 210
sequence length 220
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.20.100 Mainly Beta Single Sheet Anthopleurin-A Anthopleurin-A 2hjeA02
3.30.450.220 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2hjeA01
2HJEA 3C38A 1ZHHB 2HJ9C 3C30A
chains in the Genus database with same CATH superfamily
2HDUA 3ISGA 4KZ9A 4WZ5A 4WMCA 1GHIA 2IA2A 4LCMA 4IVIA 3RTYA 1FOFA 3UB6A 2OLVA 2WZZA 3LR4A 3T1QB 2Y2KA 5J7EA 5EECA 3S7PA 3A3IA 3A0VA 4QD4A 2R9WA 2Y2PA 4UQIS 1Z09A 3E98A 3T4TA 4K91A 4R23A 1ZG4A 3OPLA 4EEPA 3IF6C 3LCEA 5I94A 3KEZA 4Y7PA 2NUTC 3LFVA 1S4SA 1WE4A 1HTZA 2J9OA 1JVJA 1KVLA 5GHZA 1BLCA 3S7NA 3IX4A 3DBAA 1MWRA 3A0RA 4N9LA 5TBMA 2W3GA 1W7FA 3S7QA 5EVEA 1FILA 4B88A 4R0QA 1P0ZA 3G2YA 4O8GA 4OONA 5FEFA 3HREA 4H6JA 2H5SA 3GSGA 5EOOA 4ARZA 1K56D 2O0YA 3PBTA 4LV2A 4HNBA 3EQVA 3VOYA 4OPQA 4R38A 1H5OA 4BL3A 3NDEA 1SZVA 4MBHA 4XUXA 1YLTA 3C7VA 2VV8A 3T4SA 4HBUA 4I3AA 1PW8A 5EM1A 3HLGA 1LL5A 4Y0TA 3HVFA 3D3OA 2ZQ8A 3VOLA 3W4PA 1KGFA 2QJ5A 3IHAA 5HAPA 3V67A 2OWHA 1W79A 1IFQA 4PM9A 2VV6A 1V9YA 4OVDA 2PR5A 4N1XA 5AQBA 3HBRA 2IWBA 1NZOA 5AQ7A 4C6YA 3T50A 4S2OA 4MBFA 1TS6A 1DP9A 3A3EA 3T4OA 2WGWA 2V20A 1K54C 1OTAA 3FV7A 3QP8A 3VV4A 5L2FA 4MNRA 3VMAA 1CJFA 1BYWA 5HWVA 3JPUA 4QY6A 2JKRM 3NCKA 2Y2IA 4UA9A 3P09A 3CLOA 3VE4A 4IUKA 3LIAA 3PXPA 4X68A 4FOFA 3ZVTA 5GHXA 2Y4AA 1L2SA 3S7OA 4I39A 5DF8A 1K38A 3TW8A 3EGDC 4GZBA 5FQMA 5KSHA 1PNEA 2Y8HA 1OTIA 4GD6A 3P7NA 4WZ4A 3LUQA 4GS9A 2PHYA 4GB7A 3VSKA 2Y2GA 4PM8A 2V2FF 3DTEA 4OP5A 2W1TA 1K55C 2E8JA 3QP4A 1NWZA 4EESA 4S2JA 3IF6A 5FQ9A 1SDEA 4DDSA 2EWWA 1J3WA 4NXBA 3S1YA 3H82B 4GCZA 1S1ZA 1MWSA 3ZNTA 1E3UA 2XFSA 4WBGA 4JGQA 3Q7ZA 2P9VB 4NK3A 3BFCA 2ZLYA 5CEBA 1QMFA 3U2AA 1H3QA 1PZPA 4OQ0A 3C4PA 4IBXA 4CLCB 5LBRA 3UB8A 5AJGA 3RXWA 3IH9A 1VEUA 4M4XA 3IX3A 4S2LA 2Y59A 1VETA 4MN5A 2EX6A 1NRFA 1RGYA 1K57C 2DMWA 2A2LA 3AGEA 2JHEA 3BYDA 4QWOA 4HJ4A 4LLOB 3H9WA 3OLOA 1Q2QA 3DWKA 1SKOA 4P87A 1ONGA 4GHIB 4CLCE 4GOGA 4ME4A 2GZAA 3ZFZA 4B4XA 4DE1A 3UE1A 3VP2A 2OWJA 4E3OA 3IWOA 2VGLM 1LT0A 1NZUA 2BDSA 4LRXC 1H8ZA 1MZUA 5CGXA 3G6OA 1L0GA 2DRWA 4DE0A 2V8CA 1K54A 2Y79A 3CG5A 2ZC7A 5FEGA 4PM7A 3SS4A 1K25A 4OOMA 1BLSA 1Y4OA 2X02A 4DMZA 4Y13A 4LV1A 2HF6A 4C3QA 5FDSA 4NG2A 4DJ2A 4KQOA 5M1AA 4R3JA 5F83A 3KSGA 1UWPX 3WRTA 4X6TA 3MYVA 1NLZA 2WKRA 4R4SA 3M2KA 3V3SA 2VJWA 4C75A 4RA7A 2XD5A 2L0WA 4EEUA 2ZD8A 1SH1A 2HV1A 3HLEA 4LV3A 4HY8A 1O07A 3NIAA 5L8MA 3E2LA 1K55A 1F9IA 1PW1A 3CPTB 4LGWA 4JXVA 3HUMA 2IKDA 3DAVA 2XF3A 4II7A 3F1OB 4E3LA 5F69A 2HGVA 3FZCA 3WS2A 2OLUA 1EW0A 3Q82A 3EGXC 4FCFA 4Z1WA 2ZMVA 3NOPC 4NETA 3IF4A 1B8WA 1YMSA 3D9YA 5A93A 3OC2A 2ZJ9A 3A3JA 3F1NB 2VGKA 2VKSA 2J8YA 1K57A 2V0UA 1NYMA 1L0FA 4FUWA 5A91A 3UB7A 3Q7VB 4FSFA 4KZ6A 3GVBA 3LICA 5AQ9A 5F5YA 5KMWA 4KUKA 5CHUA 1PWCA 4U3TA 4IVKA 3K3DA 3T4LA 5CX7A 3BFDA 4BWIA 3NJAA 1WYBA 1JWVA 3C30A 3DTKA 4MMNA 1BZAA 3MKEA 3PR6A 3NULA 3CZDA 1DJBA 1W5DA 1G6AA 3VFFA 1T1BA 2HDRA 4RX3A 4DE3A 1S6RA 2V8FA 4E6WA 1GHMA 4HESA 2Y2JA 4O7DA 3C7UA 3G4PA 4JKTA 5EM0A 3TSGA 1BDSA 5AQAA 1JWPA 3CMZA 3B33A 3UE0A 4WYYA 2ZQAA 1NJ4A 3R7WA 1MBLA 3MCXA 1ES5A 4LCLA 1TD5A 4XT2B 2GJ3A 1LSVA 4B9OA 2M7VA 3HLFA 3IXDA 1BULA 2JKTI 1TS8A 1PFLA 4I3IA 3E0YA 5KSCA 1GCEA 4YWZA 1C3BA 2WK0A 1AXBA 1JWZA 4B93A 4EETB 3CHWP 3FPWA 4FH2A 2J7VA 1PI5A 1LSXA 5HZHA 1PYYA 3OPRA 5CTMA 3ZG0A 1CK3A 3IXHA 1GSVA 1PRQA 4R4RA 1IYQA 3IX8A 3MXQA 4G3KA 2XROA 2XGNA 4X1LA 3DTIA 1KOUA 2QSGA 3MFDA 2PU4A 1ZLIB 5TR7A 3IS2A 2HP6A 5FI2A 3BFEA 2W0NA 5CRFA 3LIBA 1N9NA 1GKUB 2XRNA 4JBFA 1YM1A 3B47A 4QJGA 3RXXA 2HZ5A 3ZHHA 1XXMA 2OV5A 3N7WA 5K5BA 2H0TA 1EL6A 3LIDA 2J3TD 3MQ0A 5EVIA 1YLYA 1ZTUA 4PMAA 3UMEA 5D3OA 5CECA 1MXOA 4DKIA 2HDSA 4KZ4A 1KE4A 3KYEA 4A5RA 4ZBEA 1OJ5A 2QKPA 2G2UA 1ALQA 1AHLA 4ARZB 3NDGA 2WUQA 1QMEA 3C5AA 2QYBA 3GQZA 4G3VA 3OZHA 1D06A 1K4EA 3ZGAB 4DF6A 3BLSA 1OPXA 1OT6A 4DXCA 3ZDJA 2O9BA 3IWQA 1ES4A 2PAVP 3T1RA 4FH4A 4EBNA 5CERA 3A0SA 4BENA 5JYPA 3OPPA 2M1CA 5A92A 5FI7A 2B9KA 2Y2OA 4DXBA 4JF5A 3KSIA 1KDSA 4HIAA 4WM9A 2OAQ1 3O88A 2QSFA 4QU3A 1FIKA 2B5RA 1OT9A 2WGIA 4MN6A 4RVAA 3K2NA 2WKEA 5HSQA 2L4RA 3MSHA 2WGWB 2ZOHA 2V1ZA 1DY6A 4GKUA 4FD8A 3WWXA 3BJNA 4EERA 1ZUFA 2X01A 4QB8A 2BTFP 1E3UD 1XPBA 1ZLHB 5FA7A 1K0KA 2MN3A 4ID4A 3IXGA 2EXBA 3MXRA 1MWUA 4JGPA 3UN7A 1FR6A 3DTMA 4PHTA 1SCWA 2HDQA 1EWZA 1VHMA 3SH8A 3D4UB 3BY8A 5CTNA 3KYZA 4RQ9A 3G32A 1SKFA 4WL9A 4PKYA 2UWXA 3GR2A 4KG5A 3L9KA 1G5UA 1N4OA 5FAQA 3P01A 2NUPC 3MKFA 1ES3A 1IEMA 4CLCC 3T1XA 4LRZE 3MS6A 2G2WA 2EFXA 1MC0A 1LLBA 5CGSA 1ZKJA 3LR3A 3KX0X 3O5YA 4P0MA 4BL2A 2QZ6A 4UA7A 5FQJA 2ZQDA 3MBZA 3MZDA 4IBRA 2PU2A 2JR3A 3LMSB 1HLUP 4EWFA 3LI8A 4BLMA 3FKVA 1VEUB 2WKPA 3SW1A 2GX5A 3BLMA 2JCHA 1ERQA 3EEAA 2XEPA 2Q9NA 1LI9A 1GA0A 2V1BA 2FZ0A 2ZM8A 3NI9A 4HJ6A 3U4LP 1S0WA 1TF1A 4KG2A 4R6LA 3GMWA 4KZ3A 2VV7A 1NYYA 5HD3A 1S1YA 5FATA 1TDGA 5F6AA 2XD1A 5FQKA 3PAGA 3F1PB 4X53A 3JVUA 2WZXA 4EW7A 3UO9A 3VOZA 1YQSA 4E04A 1K6RA 3M6BA 2W1RA 2XA7M 1M40A 3ZG8B 4LRYC 4Y2FA 3VP4A 1MKIA 1YMXA 1UGUA 4P6ZM 4QHCA 2Y55A 3M2JA 3NECA 4UEYA 4EXOA 4GLQA 2FFFB 2INWA 1CI8A 2XSSA 2ZQCA 4S2NC 3L7HA 1X0OA 3UDXA 4IHQA 1SDNA 1IYPA 1I2SA 4BBVA 1CQAA 5DJUA 3WRZA 2YKHA 4ZAMA 4ETZA 3LIFA 2K2XA 3SH7A 1IYSA 1OJGA 2WKQA 3T4JA 3UB5P 3UNWA 3N8SA 3V39A 3TJZC 3KYQA 4E3KA 2VZWA 3MR0A 2RCXA 3WS4A 2YKFA 4BD1A 2OSUA 3JYIA 1ZUEA 3UB9A 5FSRA 2P08A 4OKPA 4GDBA 3RH8B 1PIOA 5HWTA 2D01A 3VSLA 4YOFA 3BQAA 1WXNA 4M3KA 1KGEA 2LB5A 3H82A 2P9VA 2ZC5B 1EROA 4S2PA 1CI9A 5DTKA 1SHIA 4NXGA 4CLCA 3H7WB 3OCNA 2K2NA 2Q9MA 3QHYA 5TGFA 4OOLA 2VLGA 4PAUA 2HPBA 4BBTA 3P98A 1T1CA 3ZG9B 3T1SA 5EVLA 2R9XA 2VGLS 1LI0A 4GV5A 5M18A 4OLGA 2H28A 1BSGA 1F98A 3HUOA 4I5SA 2A24B 1O7EA 3AGDA 5EUAA 2JKRI 4GHIA 1ESIA 3N4IA 3TG9A 1L3LA 3LEZA 3C4OA 2V1AA 4F3LB 2ZL1B 5HL6A 2EX8A 2O99A 4OH0A 3UPOA 3O87A 1GSWA 2W3FA 4HOIA 3N8LA 1D7EA 3FPVA 4HBTA 1N9OA 1YSPA 1XJ6A 1FR1A 1G28A 1RP5A 1CEGA 1RGZA 4MN7A 1W63M 3UDFA 4NEED 4ZDXA 5HPIA 1S66L 2XQZA 4OQGA 3V5MA 3I7JA 1FCMA 3BEBA 4Y0OA 4B4ZA 1XGIA 2KOIA 2XFTA 4KQRA 5GHYA 3BY9A 1KE0A 4S2NA 3SS5A 2P74A 2WKIA 4IJGA 4S2MA 1XFNA 3DWZA 2XDMA 4EUVA 4X56A 4WEKA 4EQIA 1XGJA 5HX9A 1YPRA 3W8KA 2A3UA 1KGGA 3LIEA 3PBRA 2C6WB 4S2IA 4GN2A 2V9AA 3VP3A 1BLPA 2XXLA 2KLIA 3KO6A 3CPTA 5HDSA 4HJ3A 1YLJA 5TJJA 2O9AA 3BFGA 4JPMA 4WMCD 1WYCA 5EVID 1DP6A 1ACFA 2PBYA 2A49A 3IBJA 1BLHA 3OBFA 1L0DA 2WYXA 3QNBA 3E4OA 3WS0A 2VA0A 2ZOIA 4PM6A 5GLCA 1STZA 1XX2A 4E6XA 4OPZA 5HDCA 4RYEA 4E3MA 3F1NA 3W4OA 1ZG6A 4HI4A 2Z6DA 3WS5A 4BQMA 1TVFA 4R3AA 4MLLA 2ZQ7A 2MUBA 3D72A 3PAEA 2J80A 2P04A 3EOIA 3T4QA 3T4KA 4BMWA 5FL3A 5FDHA 2JN7A 3LYXA 1Y54A 5HD5A 2GNXA 1HVBA 4UHUA 3GDIA 3PYPA 1GA9A 1K6SA 4MCWA 2CC1A 4ZRRA 3HJIA 1W8QA 4LPZA 2G7UA 2JE5A 4BBUA 4OOYA 3Q1FA 2X71A 1Z6FA 5AVFA 3S4XA 4HP4A 3UDIA 2FFYA 5EVIB 5A90A 3MMHA 1ES2A 4WN5A 2B02A 4G3WA 3CITA 4O0PA 1XJ2A 3E4PA 3B42A 2PYRA 5BOHA 4OP8A 2QSHA 1BTLA 5GLAA 4CPKA 4MDZA 2MJ6A 5HWWA 1XKZA 3LEQA 1MY8A 2ZM2A 4E3IA 3CAXA 4QY5A 3O86A 4X69A 3M6HA 4EQ1A 3IWIA 4JGOA 4YIRA 2OAP1 1SHVA 3IQAA 3RFBA 1PI4A 4GDNA 2EX9A 2J3TC 1Z99A 3G30A 5DVAA 4HQAA 4LFUA 2ZMAA 4OLDA 2HP5A 2HJ9C 4HHDA 1TDLA 2WAFA 4UQIM 3HLWA 5TBMB 4Z9QA 4Y17A 1I5QA 4X25A 5CEDA 2IWDA 4H6JB 4R3BA 3FG8A 2Q0OA 4U0TA 1T19A 4P85A 5MC7A 3MFXA 5HAIA 4CQHA 5HL1A 2DNSA 5EOEA 1OMEA 2XK1A 1YKDA 3HLDA 3BECA 5DF9A 3HCYA 4OPRA 3MQOA 4Q0HA 1N9LA 2Z6CA 3C38A 4WLAA 5EPHA 2WADA 3VFHA 3V3RA 2PD7A 3QP2A 5U47A 5IU1A 1OTBA 2W3HA 2JKFA 3VP0A 5FQIA 4KZAA 2UV0E 1VM1A 4DRTA 4DDYA 5JYOA 4Y3IA 4PM5A 4YFMA 1FQGA 4XUZA 3FC7A 2ZBBA 2W3EA 1VB6A 4XXRA 3A3FA 1LL8A 2ZQ9A 3MF0A 5EV0A 4H8RA 1OTEA 3MJQA 1ODVA 3TE8A 1YLPA 1F5MA 3TRCA 4Y15A 3FYZA 1FSWA 5IS1A 3B3XA 4HP9A 5EFWA 1NXYA 4X55A 1AWIA 2I72A 5GL9A 2JBFA 4HEFA 3CWFA 2KX6A 5E43A 1J9MA 5KZHA 4NKPA 2QWSA 4OQHA 4U0XA 1Y28A 2ZM0A 3Q81A 2O9CA 2LB9A 4KQDA 1N9BA 4GS9B 4WUJA 2D02A 1HZOA 4FTXA 2W1TB 3MXSA 1IKIA 3W2ZA 4ZTKA 3IF6B 2PYPA 4AFIA 3PBNA 1M6KA 5DKLA 4KZBA 3N6IA 5AVEA 2RNGA 3LR0A 1LL9A 4LV0A 4YINA 1NLYA 4NXEA 2GDNA 5E2GA 4CJNA 1G68A 3IHBA 4KG6A 3EWKA 3ZNYA 2P7JA 3W4QA 3ZCZA 1WQKA 1NY0A 4JLFA 2RL3A 2VGJA 5L09A 2WGVA 5I5LA 4EUZA 3A3DA 2PBDP 1LHYA 1HD8A 5F68A 5CHJA 2ZC4B 5HAQA 4GD8A 4CLCD 5FAPA 4O01A 1VETB 1GL9B 4I3JA 4ESPA 1EI5A 4GNUA 3G31A 1ATXA 1FCOA 5IT5A 2R78A 2W27A 2QMIA 5J8XA 2AVXA 2H9XA 3GECA 5CXWA 2CMNA 1DJAA 2I9VA 1SKOB 3PBSA 2E8IA 3NOUC 3UPNA 2BASA 4WF0A 1H5XA 3E4QA 1U60A 3ZVWA 5C5KA 4N9KA 1S4RA 2Y2MA 1JNUA 3QP1A 4HH2A 3CUEC 4NXFA 3BQ8A 2EX2A 3R4KA 1P9RA 1P9WA 4F94A 5IHVA 1K56A 1FSYA 2Y91A 5DKKA 1DP8A 2SH1A 4GW9A 4DN0A 1H8YA 2Y2NA 5FQQA 4JXSA 4WEJA 4Q0JA 4GJ4A 2H10A 4D60A 1P97A 1S67L 5DFXA 3RJUA 3OCLA 1YLWA 3ZG5A 3GV9A 1IYOA 4IUHA 3QNCA 4EU0A 1XA7A 4HH3A 2WAEA 2XA7S 4BD0A 2DLAA 1ZC2A 4P6ZS 1A0KA 1OTDA 5FAOA 4UAAA 3FKWA 5HPFA 4K08A 3PTEA 4D2OA 1KE3A 2OOLA 2DCFA 4LENA 4Q0IA 1ESUA 3F1PA 2HP9A 2QJ7A 5G18A 1L0EA 2PRFA 1MWTA 3D4FA 3BFFA 4KZ8A 1APFA 3MZFA 4E3NA 3VE3A 4KENB 3GTCA 2L1MA 2EXAA 1IOUA 3CI6A 3HJKA 3IF5A 3KSHA 2ACGA 1TS0A 5G4YA 3SZTA 3C2WA 4IEDA 1T1AA 3NOTC 4EBLA 4PKYG 2ZMFA 3UMDA 2Y2HA 3UE3A 1TS7A 5KIZA 2XH9A 4N92A 5HARA 2JKTM 3GRJA 3FWLA 2XLNA 5F1FA 3OOVA 2PD8A 3ZG7B 4BJPA 3G34A 1H8MA 1PWGA 4E3JA 1MKMA 2FH5A 5CHMA 4MEZA 3LI9A 1YLZA 3MQQA 1W8YA 3S22A 3ICYA 4DE2A 2V0WA 1TEMA 3K3CA 3ITAA 2J9PA 2VK3A 4UA6A 4KZ7A 5F1GA 3CUEA 4P6BA 5GLDA 5DTTA 5A8BA 2EWVA 2QPNA 3H7WA 2PR6A 1VQQA 3IH8A 2PT7A 1IELA 5CGWA 3VP1A 4JGRA 4Y5FA 1UWNX 5L07A 5DFYA 5E2FA 4JF4A 2Z2LB 1GSXA 4R1GA 2BG1A 4K0WA 2IKEA 3MZEA 4S2KA 5GLBA 3C8CA 4JF6A 1ZHHB 2JTOA 1E25A 1JTGA 3EEHA 3TOIA 1PWDA 4L9FA 4Y0UA 3HLCA 1V9ZA 2KDKA 5J3WA 5G4ZA 1CF0A 2A24A 3ZQ5A 4ZJ1A 3IT9A 3ULFA 3R7WB 1XJ3A 5M19A 3SOIA 3ITBA 4ZJ3A 4F3LA 2JC7A 2ZL1A 2PDRA 4WZ5C 5EE8A 1FCNA 1CEFA 3O3VA 2J3WA 1F2KA 1ONHA 2H0YA 5DTSA 4EBPA 3LY4A 5EVIC 2XR0A 2ZC3B 4X1MA 3UE6A 1Q2PA 3BM6A 3LR5A 3DW0A 3F1OA 1XP4A 3BRMA 1H0MA 3SS3A 1DRMA 5DJTA 1K4FA 2B95A 1XJ4A 3ZYTA 3AGFA 2QHKA 2Z2MB 2B18A 3BWLA 2K31A 1BT5A 3LGOA 1WA9A 4RX2A 5L10A 2Y2LA 1I2WA 4DJ3A 4I38A 3HUNA 3JVVA 2BLSA 5E2EA 1YAXA 3NY4A 2JKGA 2IWCA 2W3DA 4N1HA 1RCJA 4L9GA 3V50A 5HFOA 4JXGA 4KZ5A 3IS2B 1GHPA 1PZOA 4L9EA 1IKGA 3EQUA 3Q7VA 5HDDA 1YSQA 3HLBA 4L0LA 3LY3A 3G2ZA 4WELA 1XFQA 1YT4A 3UPPA 2EA9A 2HJEA 5FASA 1KVMA 3WS1A 4Q8IA 2EFUA 4YNRA 2WKHA 1W63Q 3NHQA 1KDWA 3G35A 3PBQA 3HL9A 3PHYA 3OPHA 4R70A 1BUEA 2K7SA 4KUOA 3E2KA 3LO7A 4OQIA 5E2HA 3T12B 1JTDA 3NC8A 3UY6A 1T18A 3QP6A 3IBRA 4K0XA 4ZJ2A 4MBKA 5J4EA 4OPYA 1MPLA 2M7UA 3IXBA 4JXWA 3CJMA 1G6OA 5TFQA 3BW6A 1DJCA 3Q07A 4EV4A 4KQQA 5HW3A 2Y2QA 4PPRA 4XT2A 1ERMA 3KSFA 1E4DA 2C5WB 1D6BA 1LSWA 5DF7A 5F82A 2VX8A 3NBLA 4ETXA 4QPRA 2VEAA 3QP5A 1XA1A 2ZC6B 3N8RA 1NRJA 3SH9A 3PBOA 5FI6A 1D1JA
chains in the Genus database with same CATH topology
3K3DA 3T4LA 5CX7A 3EWKA 4BWIA 3NJAA 2IA2A 3C30A 2P7JA 1WQKA 4MMNA 1SHIA 4NXGA 5I5LA 3RTYA 4CLCA 3UB6A 3PR6A 3H7WB 3OCNA 2K2NA 3LR4A 5J7EA 3S7PA 1T1BA 4OOLA 5F68A 2VLGA 4PAUA 3A0VA 4BBTA 4CLCD 4O01A 4UQIS 4I3JA 1ATXA 1T1CA 5IT5A 2R78A 2W27A 3E98A 3T4TA 2VGLS 1BDSA 4GV5A 2H9XA 3GECA 2CMNA 4EEPA 2H28A 2I9VA 1F98A 3B33A 3PBSA 4I5SA 2A24B 3KEZA 3NOUC 3R7WA 2BASA 2JKRI 2NUTC 4GHIA 4WF0A 3E4QA 3LFVA 3MCXA 1S4SA 1TD5A 2V1AA 5C5KA 4F3LB 1S4RA 4XT2B 2GJ3A 1JNUA 5HL6A 4HH2A 1LSVA 3CUEC 2O99A 4NXFA 3BQ8A 2M7VA 3S7NA 4B9OA 3R4KA 3DBAA 1P9RA 1TS8A 2JKTI 3A0RA 5TBMA 4I3IA 1GSWA 3E0YA 2W3FA 4HOIA 2W3GA 1P9WA 4YWZA 3S7QA 1D7EA 3FPVA 5DKKA 1DP8A 2SH1A 4GW9A 1N9OA 1P0ZA 4B93A 4DN0A 1YSPA 4O8GA 1XJ6A 4H6JA 1G28A 4ARZA 4MN7A 4WEJA 1W63M 4EETB 4Q0JA 2O0YA 3PBTA 4GJ4A 4HNBA 4NEED 5HPIA 3FPWA 1S66L 1P97A 1S67L 3EQVA 5DFXA 3OCLA 4R38A 1H5OA 5HZHA 1LSXA 4IUHA 2KOIA 2VV8A 3T4SA 4I3AA 3BY9A 4EU0A 4HH3A 1GSVA 2XA7S 3D3OA 3MXQA 3VOLA 4IJGA 2DLAA 4G3KA 2XROA 1XFNA 2QJ5A 1KOUA 4P6ZS 2QSGA 3V67A 4EUVA 1OTDA 1ZLIB 2OWHA 4WEKA 1IFQA 3IS2A 2VV6A 2W0NA 5HPFA 4K08A 3LIBA 1V9YA 1N9NA 2PR5A 3LIEA 2OOLA 3PBRA 4Q0IA 2XRNA 3F1PA 3B47A 2QJ7A 3T50A 2V9AA 1TS6A 1DP9A 3T4OA 2XXLA 1OTAA 5K5BA 3VV4A 2KLIA 1APFA 3LIDA 2J3TD 3KO6A 3VE3A 3MQ0A 1ZTUA 4HJ3A 5HDSA 3UMEA 1BYWA 5TJJA 2O9AA 5HWVA 2L1MA 1IOUA 3CI6A 3HJKA 3KSHA 1OJ5A 2JKRM 2QKPA 1TS0A 5G4YA 3C2WA 1DP6A 1T1AA 3NOTC 1AHLA 4ARZB 4PKYG 3CLOA 3VE4A 2ZMFA 3UMDA 4IUKA 3IBJA 3LIAA 2QYBA 3PXPA 3OBFA 3UE3A 1TS7A 4FOFA 3E4OA 4G3VA 5KIZA 1D06A 2VA0A 2ZOIA 2JKTM 1OPXA 1OT6A 1STZA 2O9BA 3S7OA 4I39A 5HDCA 3OOVA 3TW8A 3EGDC 2PD8A 5KSHA 4BJPA 3F1NA 4HI4A 2Z6DA 1H8MA 2Y8HA 1OTIA 3P7NA 4R3AA 3A0SA 3LUQA 4GS9A 2PHYA 2MUBA 3D72A 2M1CA 2J80A 1MKMA 2B9KA 2P04A 3EOIA 2FH5A 3T4QA 3T4KA 2W1TA 4BMWA 5FL3A 3KSIA 2JN7A 3LYXA 1NWZA 4EESA 3LI9A 4HIAA 5HD5A 3MQQA 2GNXA 3GDIA 3PYPA 2OAQ1 3ICYA 4MCWA 4ZRRA 3HJIA 2QSFA 4LPZA 2EWWA 2V0WA 2G7UA 4NXBA 1OT9A 4BBUA 3K3CA 4MN6A 3H82B 4GCZA 1S1ZA 3K2NA 5HSQA 4JGQA 2L4RA 3CUEA 2ZOHA 5AVFA 3U2AA 1H3QA 3BJNA 4EERA 4HP4A 1ZUFA 5A8BA 2EWVA 1ZLHB 4CLCB 3MMHA 5LBRA 3H7WA 2PR6A 3UB8A 2PT7A 4WN5A 2MN3A 2B02A 5AJGA 4G3WA 4JGRA 4Y5FA 1UWNX 3CITA 5DFYA 4O0PA 1XJ2A 3E4PA 3B42A 2PYRA 4M4XA 1GSXA 2QSHA 4JGPA 2IKEA 4MN5A 3C8CA 4PHTA 4MDZA 1ZHHB 2JTOA 2MJ6A 2DMWA 5HWWA 2A2LA 3EEHA 2JHEA 1VHMA 4L9FA 3D4UB 3BY8A 3CAXA 4HJ4A 4LLOB 3H9WA 4EQ1A 3OLOA 4JGOA 4YIRA 1V9ZA 2OAP1 2KDKA 3KYZA 5G4ZA 2A24A 4RQ9A 5J3WA 3ZQ5A 4WL9A 4PKYA 3ULFA 3RFBA 3R7WB 1XJ3A 4GHIB 4CLCE 2J3TC 1Z99A 4HQAA 2GZAA 4ME4A 4F3LA 2PDRA 2HJ9C 4HHDA 3P01A 2NUPC 2J3WA 4UQIM 5TBMB 2OWJA 4CLCC 3UE6A 4LRZE 2VGLM 3LR5A 1LT0A 3F1OA 1MC0A 2BDSA 4LRXC 4H6JB 1MZUA 3G6OA 3LR3A 3FG8A 1T19A 3KX0X 1DRMA 5DJTA 2Y79A 3O5YA 5MC7A 3MFXA 1XJ4A 3ZYTA 2QHKA 4CQHA 4OOMA 2B18A 3BWLA 1YKDA 2K31A 2JR3A 3LMSB 5DF9A 3HCYA 4DMZA 1WA9A 3LI8A 3MQOA 2HF6A 4Q0HA 2WKPA 4DJ3A 4DJ2A 3SW1A 1N9LA 2GX5A 3C38A 2Z6CA 4I38A 4KQOA 3JVVA 4WLAA 3EEAA 3KSGA 1UWPX 3MYVA 1YAXA 2PD7A 2V1BA 2W3DA 2FZ0A 4L9GA 5IU1A 1NLZA 4HJ6A 3IS2B 1TF1A 2WKRA 4R6LA 1OTBA 2W3HA 4L9EA 2VJWA 2VV7A 3EQUA 5HD3A 1S1YA 5HDDA 1YSQA 4Y3IA 4L0LA 5F6AA 2L0WA 4EEUA 3F1PB 1SH1A 4WELA 1XFQA 2HV1A 2EA9A 3JVUA 3FC7A 4EW7A 2HJEA 4HY8A 2ZBBA 5L8MA 2W3EA 4YNRA 4E04A 1VB6A 1W63Q 2W1RA 2XA7M 3NHQA 1LL8A 1F9IA 4LRYC 4Y2FA 3MF0A 3PBQA 3PHYA 1UGUA 4P6ZM 1OTEA 2K7SA 4KUOA 4R70A 4UEYA 3MJQA 1ODVA 4EXOA 3TE8A 4GLQA 1F5MA 3TRCA 2IKDA 2INWA 4II7A 3F1OB 2XSSA 5IS1A 5F69A 4HP9A 5EFWA 2HGVA 1EW0A 1X0OA 4IHQA 1T18A 3EGXC 4Z1WA 4BBVA 5DJUA 3IBRA 2YKHA 3CWFA 2KX6A 4ETZA 2ZMVA 3NOPC 5J4EA 1B8WA 3LIFA 4NKPA 2QWSA 2M7UA 2K2XA 1OJGA 2WKQA 3T4JA 1G6OA 3OC2A 1Y28A 3BW6A 2O9CA 3F1NB 3TJZC 3KYQA 2LB9A 2VZWA 4KQDA 4GS9B 4WUJA 2VKSA 2V0UA 3MR0A 4XT2A 2D02A 2YKFA 3KSFA 2W1TB 1ZUEA 1D6BA 1LSWA 3UB9A 3W2ZA 2P08A 2PYPA 2VX8A 3PBNA 4AFIA 5DKLA 3RH8B 3UB7A 4ETXA 4FSFA 5AVEA 5HWTA 2RNGA 2D01A 3LR0A 3LICA 5F5YA 4YOFA 4QPRA 3BQAA 1WXNA 2VEAA 2LB5A 3H82A 4KUKA 1NLYA 1NRJA 4NXEA 3PBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJE A;  3C38 A;  1ZHH B;  2HJ9 C;  3C30 A; 
#chains in the Genus database with same CATH topology
 2HDU A;  3ISG A;  4KZ9 A;  4WZ5 A;  4WMC A;  1GHI A;  2IA2 A;  4LCM A;  4IVI A;  3RTY A;  1FOF A;  3UB6 A;  2OLV A;  2WZZ A;  3LR4 A;  3T1Q B;  2Y2K A;  5J7E A;  5EEC A;  3S7P A;  3A3I A;  3A0V A;  4QD4 A;  2R9W A;  2Y2P A;  4UQI S;  1Z09 A;  3E98 A;  3T4T A;  4K91 A;  4R23 A;  1ZG4 A;  3OPL A;  4EEP A;  3IF6 C;  3LCE A;  5I94 A;  3KEZ A;  4Y7P A;  2NUT C;  3LFV A;  1S4S A;  1WE4 A;  1HTZ A;  2J9O A;  1JVJ A;  1KVL A;  5GHZ A;  1BLC A;  3S7N A;  3IX4 A;  3DBA A;  1MWR A;  3A0R A;  4N9L A;  5TBM A;  2W3G A;  1W7F A;  3S7Q A;  5EVE A;  1FIL A;  4B88 A;  4R0Q A;  1P0Z A;  3G2Y A;  4O8G A;  4OON A;  5FEF A;  3HRE A;  4H6J A;  2H5S A;  3GSG A;  5EOO A;  4ARZ A;  1K56 D;  2O0Y A;  3PBT A;  4LV2 A;  4HNB A;  3EQV A;  3VOY A;  4OPQ A;  4R38 A;  1H5O A;  4BL3 A;  3NDE A;  1SZV A;  4MBH A;  4XUX A;  1YLT A;  3C7V A;  2VV8 A;  3T4S A;  4HBU A;  4I3A A;  1PW8 A;  5EM1 A;  3HLG A;  1LL5 A;  4Y0T A;  3HVF A;  3D3O A;  2ZQ8 A;  3VOL A;  3W4P A;  1KGF A;  2QJ5 A;  3IHA A;  5HAP A;  3V67 A;  2OWH A;  1W79 A;  1IFQ A;  4PM9 A;  2VV6 A;  1V9Y A;  4OVD A;  2PR5 A;  4N1X A;  5AQB A;  3HBR A;  2IWB A;  1NZO A;  5AQ7 A;  4C6Y A;  3T50 A;  4S2O A;  4MBF A;  1TS6 A;  1DP9 A;  3A3E A;  3T4O A;  2WGW A;  2V20 A;  1K54 C;  1OTA A;  3FV7 A;  3QP8 A;  3VV4 A;  5L2F A;  4MNR A;  3VMA A;  1CJF A;  1BYW A;  5HWV A;  3JPU A;  4QY6 A;  2JKR M;  3NCK A;  2Y2I A;  4UA9 A;  3P09 A;  3CLO A;  3VE4 A;  4IUK A;  3LIA A;  3PXP A;  4X68 A;  4FOF A;  3ZVT A;  5GHX A;  2Y4A A;  1L2S A;  3S7O A;  4I39 A;  5DF8 A;  1K38 A;  3TW8 A;  3EGD C;  4GZB A;  5FQM A;  5KSH A;  1PNE A;  2Y8H A;  1OTI A;  4GD6 A;  3P7N A;  4WZ4 A;  3LUQ A;  4GS9 A;  2PHY A;  4GB7 A;  3VSK A;  2Y2G A;  4PM8 A;  2V2F F;  3DTE A;  4OP5 A;  2W1T A;  1K55 C;  2E8J A;  3QP4 A;  1NWZ A;  4EES A;  4S2J A;  3IF6 A;  5FQ9 A;  1SDE A;  4DDS A;  2EWW A;  1J3W A;  4NXB A;  3S1Y A;  3H82 B;  4GCZ A;  1S1Z A;  1MWS A;  3ZNT A;  1E3U A;  2XFS A;  4WBG A;  4JGQ A;  3Q7Z A;  2P9V B;  4NK3 A;  3BFC A;  2ZLY A;  5CEB A;  1QMF A;  3U2A A;  1H3Q A;  1PZP A;  4OQ0 A;  3C4P A;  4IBX A;  4CLC B;  5LBR A;  3UB8 A;  5AJG A;  3RXW A;  3IH9 A;  1VEU A;  4M4X A;  3IX3 A;  4S2L A;  2Y59 A;  1VET A;  4MN5 A;  2EX6 A;  1NRF A;  1RGY A;  1K57 C;  2DMW A;  2A2L A;  3AGE A;  2JHE A;  3BYD A;  4QWO A;  4HJ4 A;  4LLO B;  3H9W A;  3OLO A;  1Q2Q A;  3DWK A;  1SKO A;  4P87 A;  1ONG A;  4GHI B;  4CLC E;  4GOG A;  4ME4 A;  2GZA A;  3ZFZ A;  4B4X A;  4DE1 A;  3UE1 A;  3VP2 A;  2OWJ A;  4E3O A;  3IWO A;  2VGL M;  1LT0 A;  1NZU A;  2BDS A;  4LRX C;  1H8Z A;  1MZU A;  5CGX A;  3G6O A;  1L0G A;  2DRW A;  4DE0 A;  2V8C A;  1K54 A;  2Y79 A;  3CG5 A;  2ZC7 A;  5FEG A;  4PM7 A;  3SS4 A;  1K25 A;  4OOM A;  1BLS A;  1Y4O A;  2X02 A;  4DMZ A;  4Y13 A;  4LV1 A;  2HF6 A;  4C3Q A;  5FDS A;  4NG2 A;  4DJ2 A;  4KQO A;  5M1A A;  4R3J A;  5F83 A;  3KSG A;  1UWP X;  3WRT A;  4X6T A;  3MYV A;  1NLZ A;  2WKR A;  4R4S A;  3M2K A;  3V3S A;  2VJW A;  4C75 A;  4RA7 A;  2XD5 A;  2L0W A;  4EEU A;  2ZD8 A;  1SH1 A;  2HV1 A;  3HLE A;  4LV3 A;  4HY8 A;  1O07 A;  3NIA A;  5L8M A;  3E2L A;  1K55 A;  1F9I A;  1PW1 A;  3CPT B;  4LGW A;  4JXV A;  3HUM A;  2IKD A;  3DAV A;  2XF3 A;  4II7 A;  3F1O B;  4E3L A;  5F69 A;  2HGV A;  3FZC A;  3WS2 A;  2OLU A;  1EW0 A;  3Q82 A;  3EGX C;  4FCF A;  4Z1W A;  2ZMV A;  3NOP C;  4NET A;  3IF4 A;  1B8W A;  1YMS A;  3D9Y A;  5A93 A;  3OC2 A;  2ZJ9 A;  3A3J A;  3F1N B;  2VGK A;  2VKS A;  2J8Y A;  1K57 A;  2V0U A;  1NYM A;  1L0F A;  4FUW A;  5A91 A;  3UB7 A;  3Q7V B;  4FSF A;  4KZ6 A;  3GVB A;  3LIC A;  5AQ9 A;  5F5Y A;  5KMW A;  4KUK A;  5CHU A;  1PWC A;  4U3T A;  4IVK A;  3K3D A;  3T4L A;  5CX7 A;  3BFD A;  4BWI A;  3NJA A;  1WYB A;  1JWV A;  3C30 A;  3DTK A;  4MMN A;  1BZA A;  3MKE A;  3PR6 A;  3NUL A;  3CZD A;  1DJB A;  1W5D A;  1G6A A;  3VFF A;  1T1B A;  2HDR A;  4RX3 A;  4DE3 A;  1S6R A;  2V8F A;  4E6W A;  1GHM A;  4HES A;  2Y2J A;  4O7D A;  3C7U A;  3G4P A;  4JKT A;  5EM0 A;  3TSG A;  1BDS A;  5AQA A;  1JWP A;  3CMZ A;  3B33 A;  3UE0 A;  4WYY A;  2ZQA A;  1NJ4 A;  3R7W A;  1MBL A;  3MCX A;  1ES5 A;  4LCL A;  1TD5 A;  4XT2 B;  2GJ3 A;  1LSV A;  4B9O A;  2M7V A;  3HLF A;  3IXD A;  1BUL A;  2JKT I;  1TS8 A;  1PFL A;  4I3I A;  3E0Y A;  5KSC A;  1GCE A;  4YWZ A;  1C3B A;  2WK0 A;  1AXB A;  1JWZ A;  4B93 A;  4EET B;  3CHW P;  3FPW A;  4FH2 A;  2J7V A;  1PI5 A;  1LSX A;  5HZH A;  1PYY A;  3OPR A;  5CTM A;  3ZG0 A;  1CK3 A;  3IXH A;  1GSV A;  1PRQ A;  4R4R A;  1IYQ A;  3IX8 A;  3MXQ A;  4G3K A;  2XRO A;  2XGN A;  4X1L A;  3DTI A;  1KOU A;  2QSG A;  3MFD A;  2PU4 A;  1ZLI B;  5TR7 A;  3IS2 A;  2HP6 A;  5FI2 A;  3BFE A;  2W0N A;  5CRF A;  3LIB A;  1N9N A;  1GKU B;  2XRN A;  4JBF A;  1YM1 A;  3B47 A;  4QJG A;  3RXX A;  2HZ5 A;  3ZHH A;  1XXM A;  2OV5 A;  3N7W A;  5K5B A;  2H0T A;  1EL6 A;  3LID A;  2J3T D;  3MQ0 A;  5EVI A;  1YLY A;  1ZTU A;  4PMA A;  3UME A;  5D3O A;  5CEC A;  1MXO A;  4DKI A;  2HDS A;  4KZ4 A;  1KE4 A;  3KYE A;  4A5R A;  4ZBE A;  1OJ5 A;  2QKP A;  2G2U A;  1ALQ A;  1AHL A;  4ARZ B;  3NDG A;  2WUQ A;  1QME A;  3C5A A;  2QYB A;  3GQZ A;  4G3V A;  3OZH A;  1D06 A;  1K4E A;  3ZGA B;  4DF6 A;  3BLS A;  1OPX A;  1OT6 A;  4DXC A;  3ZDJ A;  2O9B A;  3IWQ A;  1ES4 A;  2PAV P;  3T1R A;  4FH4 A;  4EBN A;  5CER A;  3A0S A;  4BEN A;  5JYP A;  3OPP A;  2M1C A;  5A92 A;  5FI7 A;  2B9K A;  2Y2O A;  4DXB A;  4JF5 A;  3KSI A;  1KDS A;  4HIA A;  4WM9 A;  2OAQ 1;  3O88 A;  2QSF A;  4QU3 A;  1FIK A;  2B5R A;  1OT9 A;  2WGI A;  4MN6 A;  4RVA A;  3K2N A;  2WKE A;  5HSQ A;  2L4R A;  3MSH A;  2WGW B;  2ZOH A;  2V1Z A;  1DY6 A;  4GKU A;  4FD8 A;  3WWX A;  3BJN A;  4EER A;  1ZUF A;  2X01 A;  4QB8 A;  2BTF P;  1E3U D;  1XPB A;  1ZLH B;  5FA7 A;  1K0K A;  2MN3 A;  4ID4 A;  3IXG A;  2EXB A;  3MXR A;  1MWU A;  4JGP A;  3UN7 A;  1FR6 A;  3DTM A;  4PHT A;  1SCW A;  2HDQ A;  1EWZ A;  1VHM A;  3SH8 A;  3D4U B;  3BY8 A;  5CTN A;  3KYZ A;  4RQ9 A;  3G32 A;  1SKF A;  4WL9 A;  4PKY A;  2UWX A;  3GR2 A;  4KG5 A;  3L9K A;  1G5U A;  1N4O A;  5FAQ A;  3P01 A;  2NUP C;  3MKF A;  1ES3 A;  1IEM A;  4CLC C;  3T1X A;  4LRZ E;  3MS6 A;  2G2W A;  2EFX A;  1MC0 A;  1LLB A;  5CGS A;  1ZKJ A;  3LR3 A;  3KX0 X;  3O5Y A;  4P0M A;  4BL2 A;  2QZ6 A;  4UA7 A;  5FQJ A;  2ZQD A;  3MBZ A;  3MZD A;  4IBR A;  2PU2 A;  2JR3 A;  3LMS B;  1HLU P;  4EWF A;  3LI8 A;  4BLM A;  3FKV A;  1VEU B;  2WKP A;  3SW1 A;  2GX5 A;  3BLM A;  2JCH A;  1ERQ A;  3EEA A;  2XEP A;  2Q9N A;  1LI9 A;  1GA0 A;  2V1B A;  2FZ0 A;  2ZM8 A;  3NI9 A;  4HJ6 A;  3U4L P;  1S0W A;  1TF1 A;  4KG2 A;  4R6L A;  3GMW A;  4KZ3 A;  2VV7 A;  1NYY A;  5HD3 A;  1S1Y A;  5FAT A;  1TDG A;  5F6A A;  2XD1 A;  5FQK A;  3PAG A;  3F1P B;  4X53 A;  3JVU A;  2WZX A;  4EW7 A;  3UO9 A;  3VOZ A;  1YQS A;  4E04 A;  1K6R A;  3M6B A;  2W1R A;  2XA7 M;  1M40 A;  3ZG8 B;  4LRY C;  4Y2F A;  3VP4 A;  1MKI A;  1YMX A;  1UGU A;  4P6Z M;  4QHC A;  2Y55 A;  3M2J A;  3NEC A;  4UEY A;  4EXO A;  4GLQ A;  2FFF B;  2INW A;  1CI8 A;  2XSS A;  2ZQC A;  4S2N C;  3L7H A;  1X0O A;  3UDX A;  4IHQ A;  1SDN A;  1IYP A;  1I2S A;  4BBV A;  1CQA A;  5DJU A;  3WRZ A;  2YKH A;  4ZAM A;  4ETZ A;  3LIF A;  2K2X A;  3SH7 A;  1IYS A;  1OJG A;  2WKQ A;  3T4J A;  3UB5 P;  3UNW A;  3N8S A;  3V39 A;  3TJZ C;  3KYQ A;  4E3K A;  2VZW A;  3MR0 A;  2RCX A;  3WS4 A;  2YKF A;  4BD1 A;  2OSU A;  3JYI A;  1ZUE A;  3UB9 A;  5FSR A;  2P08 A;  4OKP A;  4GDB A;  3RH8 B;  1PIO A;  5HWT A;  2D01 A;  3VSL A;  4YOF A;  3BQA A;  1WXN A;  4M3K A;  1KGE A;  2LB5 A;  3H82 A;  2P9V A;  2ZC5 B;  1ERO A;  4S2P A;  1CI9 A;  5DTK A;  1SHI A;  4NXG A;  4CLC A;  3H7W B;  3OCN A;  2K2N A;  2Q9M A;  3QHY A;  5TGF A;  4OOL A;  2VLG A;  4PAU A;  2HPB A;  4BBT A;  3P98 A;  1T1C A;  3ZG9 B;  3T1S A;  5EVL A;  2R9X A;  2VGL S;  1LI0 A;  4GV5 A;  5M18 A;  4OLG A;  2H28 A;  1BSG A;  1F98 A;  3HUO A;  4I5S A;  2A24 B;  1O7E A;  3AGD A;  5EUA A;  2JKR I;  4GHI A;  1ESI A;  3N4I A;  3TG9 A;  1L3L A;  3LEZ A;  3C4O A;  2V1A A;  4F3L B;  2ZL1 B;  5HL6 A;  2EX8 A;  2O99 A;  4OH0 A;  3UPO A;  3O87 A;  1GSW A;  2W3F A;  4HOI A;  3N8L A;  1D7E A;  3FPV A;  4HBT A;  1N9O A;  1YSP A;  1XJ6 A;  1FR1 A;  1G28 A;  1RP5 A;  1CEG A;  1RGZ A;  4MN7 A;  1W63 M;  3UDF A;  4NEE D;  4ZDX A;  5HPI A;  1S66 L;  2XQZ A;  4OQG A;  3V5M A;  3I7J A;  1FCM A;  3BEB A;  4Y0O A;  4B4Z A;  1XGI A;  2KOI A;  2XFT A;  4KQR A;  5GHY A;  3BY9 A;  1KE0 A;  4S2N A;  3SS5 A;  2P74 A;  2WKI A;  4IJG A;  4S2M A;  1XFN A;  3DWZ A;  2XDM A;  4EUV A;  4X56 A;  4WEK A;  4EQI A;  1XGJ A;  5HX9 A;  1YPR A;  3W8K A;  2A3U A;  1KGG A;  3LIE A;  3PBR A;  2C6W B;  4S2I A;  4GN2 A;  2V9A A;  3VP3 A;  1BLP A;  2XXL A;  2KLI A;  3KO6 A;  3CPT A;  5HDS A;  4HJ3 A;  1YLJ A;  5TJJ A;  2O9A A;  3BFG A;  4JPM A;  4WMC D;  1WYC A;  5EVI D;  1DP6 A;  1ACF A;  2PBY A;  2A49 A;  3IBJ A;  1BLH A;  3OBF A;  1L0D A;  2WYX A;  3QNB A;  3E4O A;  3WS0 A;  2VA0 A;  2ZOI A;  4PM6 A;  5GLC A;  1STZ A;  1XX2 A;  4E6X A;  4OPZ A;  5HDC A;  4RYE A;  4E3M A;  3F1N A;  3W4O A;  1ZG6 A;  4HI4 A;  2Z6D A;  3WS5 A;  4BQM A;  1TVF A;  4R3A A;  4MLL A;  2ZQ7 A;  2MUB A;  3D72 A;  3PAE A;  2J80 A;  2P04 A;  3EOI A;  3T4Q A;  3T4K A;  4BMW A;  5FL3 A;  5FDH A;  2JN7 A;  3LYX A;  1Y54 A;  5HD5 A;  2GNX A;  1HVB A;  4UHU A;  3GDI A;  3PYP A;  1GA9 A;  1K6S A;  4MCW A;  2CC1 A;  4ZRR A;  3HJI A;  1W8Q A;  4LPZ A;  2G7U A;  2JE5 A;  4BBU A;  4OOY A;  3Q1F A;  2X71 A;  1Z6F A;  5AVF A;  3S4X A;  4HP4 A;  3UDI A;  2FFY A;  5EVI B;  5A90 A;  3MMH A;  1ES2 A;  4WN5 A;  2B02 A;  4G3W A;  3CIT A;  4O0P A;  1XJ2 A;  3E4P A;  3B42 A;  2PYR A;  5BOH A;  4OP8 A;  2QSH A;  1BTL A;  5GLA A;  4CPK A;  4MDZ A;  2MJ6 A;  5HWW A;  1XKZ A;  3LEQ A;  1MY8 A;  2ZM2 A;  4E3I A;  3CAX A;  4QY5 A;  3O86 A;  4X69 A;  3M6H A;  4EQ1 A;  3IWI A;  4JGO A;  4YIR A;  2OAP 1;  1SHV A;  3IQA A;  3RFB A;  1PI4 A;  4GDN A;  2EX9 A;  2J3T C;  1Z99 A;  3G30 A;  5DVA A;  4HQA A;  4LFU A;  2ZMA A;  4OLD A;  2HP5 A;  2HJ9 C;  4HHD A;  1TDL A;  2WAF A;  4UQI M;  3HLW A;  5TBM B;  4Z9Q A;  4Y17 A;  1I5Q A;  4X25 A;  5CED A;  2IWD A;  4H6J B;  4R3B A;  3FG8 A;  2Q0O A;  4U0T A;  1T19 A;  4P85 A;  5MC7 A;  3MFX A;  5HAI A;  4CQH A;  5HL1 A;  2DNS A;  5EOE A;  1OME A;  2XK1 A;  1YKD A;  3HLD A;  3BEC A;  5DF9 A;  3HCY A;  4OPR A;  3MQO A;  4Q0H A;  1N9L A;  2Z6C A;  3C38 A;  4WLA A;  5EPH A;  2WAD A;  3VFH A;  3V3R A;  2PD7 A;  3QP2 A;  5U47 A;  5IU1 A;  1OTB A;  2W3H A;  2JKF A;  3VP0 A;  5FQI A;  4KZA A;  2UV0 E;  1VM1 A;  4DRT A;  4DDY A;  5JYO A;  4Y3I A;  4PM5 A;  4YFM A;  1FQG A;  4XUZ A;  3FC7 A;  2ZBB A;  2W3E A;  1VB6 A;  4XXR A;  3A3F A;  1LL8 A;  2ZQ9 A;  3MF0 A;  5EV0 A;  4H8R A;  1OTE A;  3MJQ A;  1ODV A;  3TE8 A;  1YLP A;  1F5M A;  3TRC A;  4Y15 A;  3FYZ A;  1FSW A;  5IS1 A;  3B3X A;  4HP9 A;  5EFW A;  1NXY A;  4X55 A;  1AWI A;  2I72 A;  5GL9 A;  2JBF A;  4HEF A;  3CWF A;  2KX6 A;  5E43 A;  1J9M A;  5KZH A;  4NKP A;  2QWS A;  4OQH A;  4U0X A;  1Y28 A;  2ZM0 A;  3Q81 A;  2O9C A;  2LB9 A;  4KQD A;  1N9B A;  4GS9 B;  4WUJ A;  2D02 A;  1HZO A;  4FTX A;  2W1T B;  3MXS A;  1IKI A;  3W2Z A;  4ZTK A;  3IF6 B;  2PYP A;  4AFI A;  3PBN A;  1M6K A;  5DKL A;  4KZB A;  3N6I A;  5AVE A;  2RNG A;  3LR0 A;  1LL9 A;  4LV0 A;  4YIN A;  1NLY A;  4NXE A;  2GDN A;  5E2G A;  4CJN A;  1G68 A;  3IHB A;  4KG6 A;  3EWK A;  3ZNY A;  2P7J A;  3W4Q A;  3ZCZ A;  1WQK A;  1NY0 A;  4JLF A;  2RL3 A;  2VGJ A;  5L09 A;  2WGV A;  5I5L A;  4EUZ A;  3A3D A;  2PBD P;  1LHY A;  1HD8 A;  5F68 A;  5CHJ A;  2ZC4 B;  5HAQ A;  4GD8 A;  4CLC D;  5FAP A;  4O01 A;  1VET B;  1GL9 B;  4I3J A;  4ESP A;  1EI5 A;  4GNU A;  3G31 A;  1ATX A;  1FCO A;  5IT5 A;  2R78 A;  2W27 A;  2QMI A;  5J8X A;  2AVX A;  2H9X A;  3GEC A;  5CXW A;  2CMN A;  1DJA A;  2I9V A;  1SKO B;  3PBS A;  2E8I A;  3NOU C;  3UPN A;  2BAS A;  4WF0 A;  1H5X A;  3E4Q A;  1U60 A;  3ZVW A;  5C5K A;  4N9K A;  1S4R A;  2Y2M A;  1JNU A;  3QP1 A;  4HH2 A;  3CUE C;  4NXF A;  3BQ8 A;  2EX2 A;  3R4K A;  1P9R A;  1P9W A;  4F94 A;  5IHV A;  1K56 A;  1FSY A;  2Y91 A;  5DKK A;  1DP8 A;  2SH1 A;  4GW9 A;  4DN0 A;  1H8Y A;  2Y2N A;  5FQQ A;  4JXS A;  4WEJ A;  4Q0J A;  4GJ4 A;  2H10 A;  4D60 A;  1P97 A;  1S67 L;  5DFX A;  3RJU A;  3OCL A;  1YLW A;  3ZG5 A;  3GV9 A;  1IYO A;  4IUH A;  3QNC A;  4EU0 A;  1XA7 A;  4HH3 A;  2WAE A;  2XA7 S;  4BD0 A;  2DLA A;  1ZC2 A;  4P6Z S;  1A0K A;  1OTD A;  5FAO A;  4UAA A;  3FKW A;  5HPF A;  4K08 A;  3PTE A;  4D2O A;  1KE3 A;  2OOL A;  2DCF A;  4LEN A;  4Q0I A;  1ESU A;  3F1P A;  2HP9 A;  2QJ7 A;  5G18 A;  1L0E A;  2PRF A;  1MWT A;  3D4F A;  3BFF A;  4KZ8 A;  1APF A;  3MZF A;  4E3N A;  3VE3 A;  4KEN B;  3GTC A;  2L1M A;  2EXA A;  1IOU A;  3CI6 A;  3HJK A;  3IF5 A;  3KSH A;  2ACG A;  1TS0 A;  5G4Y A;  3SZT A;  3C2W A;  4IED A;  1T1A A;  3NOT C;  4EBL A;  4PKY G;  2ZMF A;  3UMD A;  2Y2H A;  3UE3 A;  1TS7 A;  5KIZ A;  2XH9 A;  4N92 A;  5HAR A;  2JKT M;  3GRJ A;  3FWL A;  2XLN A;  5F1F A;  3OOV A;  2PD8 A;  3ZG7 B;  4BJP A;  3G34 A;  1H8M A;  1PWG A;  4E3J A;  1MKM A;  2FH5 A;  5CHM A;  4MEZ A;  3LI9 A;  1YLZ A;  3MQQ A;  1W8Y A;  3S22 A;  3ICY A;  4DE2 A;  2V0W A;  1TEM A;  3K3C A;  3ITA A;  2J9P A;  2VK3 A;  4UA6 A;  4KZ7 A;  5F1G A;  3CUE A;  4P6B A;  5GLD A;  5DTT A;  5A8B A;  2EWV A;  2QPN A;  3H7W A;  2PR6 A;  1VQQ A;  3IH8 A;  2PT7 A;  1IEL A;  5CGW A;  3VP1 A;  4JGR A;  4Y5F A;  1UWN X;  5L07 A;  5DFY A;  5E2F A;  4JF4 A;  2Z2L B;  1GSX A;  4R1G A;  2BG1 A;  4K0W A;  2IKE A;  3MZE A;  4S2K A;  5GLB A;  3C8C A;  4JF6 A;  1ZHH B;  2JTO A;  1E25 A;  1JTG A;  3EEH A;  3TOI A;  1PWD A;  4L9F A;  4Y0U A;  3HLC A;  1V9Z A;  2KDK A;  5J3W A;  5G4Z A;  1CF0 A;  2A24 A;  3ZQ5 A;  4ZJ1 A;  3IT9 A;  3ULF A;  3R7W B;  1XJ3 A;  5M19 A;  3SOI A;  3ITB A;  4ZJ3 A;  4F3L A;  2JC7 A;  2ZL1 A;  2PDR A;  4WZ5 C;  5EE8 A;  1FCN A;  1CEF A;  3O3V A;  2J3W A;  1F2K A;  1ONH A;  2H0Y A;  5DTS A;  4EBP A;  3LY4 A;  5EVI C;  2XR0 A;  2ZC3 B;  4X1M A;  3UE6 A;  1Q2P A;  3BM6 A;  3LR5 A;  3DW0 A;  3F1O A;  1XP4 A;  3BRM A;  1H0M A;  3SS3 A;  1DRM A;  5DJT A;  1K4F A;  2B95 A;  1XJ4 A;  3ZYT A;  3AGF A;  2QHK A;  2Z2M B;  2B18 A;  3BWL A;  2K31 A;  1BT5 A;  3LGO A;  1WA9 A;  4RX2 A;  5L10 A;  2Y2L A;  1I2W A;  4DJ3 A;  4I38 A;  3HUN A;  3JVV A;  2BLS A;  5E2E A;  1YAX A;  3NY4 A;  2JKG A;  2IWC A;  2W3D A;  4N1H A;  1RCJ A;  4L9G A;  3V50 A;  5HFO A;  4JXG A;  4KZ5 A;  3IS2 B;  1GHP A;  1PZO A;  4L9E A;  1IKG A;  3EQU A;  3Q7V A;  5HDD A;  1YSQ A;  3HLB A;  4L0L A;  3LY3 A;  3G2Z A;  4WEL A;  1XFQ A;  1YT4 A;  3UPP A;  2EA9 A;  2HJE A;  5FAS A;  1KVM A;  3WS1 A;  4Q8I A;  2EFU A;  4YNR A;  2WKH A;  1W63 Q;  3NHQ A;  1KDW A;  3G35 A;  3PBQ A;  3HL9 A;  3PHY A;  3OPH A;  4R70 A;  1BUE A;  2K7S A;  4KUO A;  3E2K A;  3LO7 A;  4OQI A;  5E2H A;  3T12 B;  1JTD A;  3NC8 A;  3UY6 A;  1T18 A;  3QP6 A;  3IBR A;  4K0X A;  4ZJ2 A;  4MBK A;  5J4E A;  4OPY A;  1MPL A;  2M7U A;  3IXB A;  4JXW A;  3CJM A;  1G6O A;  5TFQ A;  3BW6 A;  1DJC A;  3Q07 A;  4EV4 A;  4KQQ A;  5HW3 A;  2Y2Q A;  4PPR A;  4XT2 A;  1ERM A;  3KSF A;  1E4D A;  2C5W B;  1D6B A;  1LSW A;  5DF7 A;  5F82 A;  2VX8 A;  3NBL A;  4ETX A;  4QPR A;  2VEA A;  3QP5 A;  1XA1 A;  2ZC6 B;  3N8R A;  1NRJ A;  3SH9 A;  3PBO A;  5FI6 A;  1D1J A; 
#chains in the Genus database with same CATH homology
 3K3D A;  3T4L A;  5CX7 A;  3EWK A;  4BWI A;  3NJA A;  2IA2 A;  3C30 A;  2P7J A;  1WQK A;  4MMN A;  1SHI A;  4NXG A;  5I5L A;  3RTY A;  4CLC A;  3UB6 A;  3PR6 A;  3H7W B;  3OCN A;  2K2N A;  3LR4 A;  5J7E A;  3S7P A;  1T1B A;  4OOL A;  5F68 A;  2VLG A;  4PAU A;  3A0V A;  4BBT A;  4CLC D;  4O01 A;  4UQI S;  4I3J A;  1ATX A;  1T1C A;  5IT5 A;  2R78 A;  2W27 A;  3E98 A;  3T4T A;  2VGL S;  1BDS A;  4GV5 A;  2H9X A;  3GEC A;  2CMN A;  4EEP A;  2H28 A;  2I9V A;  1F98 A;  3B33 A;  3PBS A;  4I5S A;  2A24 B;  3KEZ A;  3NOU C;  3R7W A;  2BAS A;  2JKR I;  2NUT C;  4GHI A;  4WF0 A;  3E4Q A;  3LFV A;  3MCX A;  1S4S A;  1TD5 A;  2V1A A;  5C5K A;  4F3L B;  1S4R A;  4XT2 B;  2GJ3 A;  1JNU A;  5HL6 A;  4HH2 A;  1LSV A;  3CUE C;  2O99 A;  4NXF A;  3BQ8 A;  2M7V A;  3S7N A;  4B9O A;  3R4K A;  3DBA A;  1P9R A;  1TS8 A;  2JKT I;  3A0R A;  5TBM A;  4I3I A;  1GSW A;  3E0Y A;  2W3F A;  4HOI A;  2W3G A;  1P9W A;  4YWZ A;  3S7Q A;  1D7E A;  3FPV A;  5DKK A;  1DP8 A;  2SH1 A;  4GW9 A;  1N9O A;  1P0Z A;  4B93 A;  4DN0 A;  1YSP A;  4O8G A;  1XJ6 A;  4H6J A;  1G28 A;  4ARZ A;  4MN7 A;  4WEJ A;  1W63 M;  4EET B;  4Q0J A;  2O0Y A;  3PBT A;  4GJ4 A;  4HNB A;  4NEE D;  5HPI A;  3FPW A;  1S66 L;  1P97 A;  1S67 L;  3EQV A;  5DFX A;  3OCL A;  4R38 A;  1H5O A;  5HZH A;  1LSX A;  4IUH A;  2KOI A;  2VV8 A;  3T4S A;  4I3A A;  3BY9 A;  4EU0 A;  4HH3 A;  1GSV A;  2XA7 S;  3D3O A;  3MXQ A;  3VOL A;  4IJG A;  2DLA A;  4G3K A;  2XRO A;  1XFN A;  2QJ5 A;  1KOU A;  4P6Z S;  2QSG A;  3V67 A;  4EUV A;  1OTD A;  1ZLI B;  2OWH A;  4WEK A;  1IFQ A;  3IS2 A;  2VV6 A;  2W0N A;  5HPF A;  4K08 A;  3LIB A;  1V9Y A;  1N9N A;  2PR5 A;  3LIE A;  2OOL A;  3PBR A;  4Q0I A;  2XRN A;  3F1P A;  3B47 A;  2QJ7 A;  3T50 A;  2V9A A;  1TS6 A;  1DP9 A;  3T4O A;  2XXL A;  1OTA A;  5K5B A;  3VV4 A;  2KLI A;  1APF A;  3LID A;  2J3T D;  3KO6 A;  3VE3 A;  3MQ0 A;  1ZTU A;  4HJ3 A;  5HDS A;  3UME A;  1BYW A;  5TJJ A;  2O9A A;  5HWV A;  2L1M A;  1IOU A;  3CI6 A;  3HJK A;  3KSH A;  1OJ5 A;  2JKR M;  2QKP A;  1TS0 A;  5G4Y A;  3C2W A;  1DP6 A;  1T1A A;  3NOT C;  1AHL A;  4ARZ B;  4PKY G;  3CLO A;  3VE4 A;  2ZMF A;  3UMD A;  4IUK A;  3IBJ A;  3LIA A;  2QYB A;  3PXP A;  3OBF A;  3UE3 A;  1TS7 A;  4FOF A;  3E4O A;  4G3V A;  5KIZ A;  1D06 A;  2VA0 A;  2ZOI A;  2JKT M;  1OPX A;  1OT6 A;  1STZ A;  2O9B A;  3S7O A;  4I39 A;  5HDC A;  3OOV A;  3TW8 A;  3EGD C;  2PD8 A;  5KSH A;  4BJP A;  3F1N A;  4HI4 A;  2Z6D A;  1H8M A;  2Y8H A;  1OTI A;  3P7N A;  4R3A A;  3A0S A;  3LUQ A;  4GS9 A;  2PHY A;  2MUB A;  3D72 A;  2M1C A;  2J80 A;  1MKM A;  2B9K A;  2P04 A;  3EOI A;  2FH5 A;  3T4Q A;  3T4K A;  2W1T A;  4BMW A;  5FL3 A;  3KSI A;  2JN7 A;  3LYX A;  1NWZ A;  4EES A;  3LI9 A;  4HIA A;  5HD5 A;  3MQQ A;  2GNX A;  3GDI A;  3PYP A;  2OAQ 1;  3ICY A;  4MCW A;  4ZRR A;  3HJI A;  2QSF A;  4LPZ A;  2EWW A;  2V0W A;  2G7U A;  4NXB A;  1OT9 A;  4BBU A;  3K3C A;  4MN6 A;  3H82 B;  4GCZ A;  1S1Z A;  3K2N A;  5HSQ A;  4JGQ A;  2L4R A;  3CUE A;  2ZOH A;  5AVF A;  3U2A A;  1H3Q A;  3BJN A;  4EER A;  4HP4 A;  1ZUF A;  5A8B A;  2EWV A;  1ZLH B;  4CLC B;  3MMH A;  5LBR A;  3H7W A;  2PR6 A;  3UB8 A;  2PT7 A;  4WN5 A;  2MN3 A;  2B02 A;  5AJG A;  4G3W A;  4JGR A;  4Y5F A;  1UWN X;  3CIT A;  5DFY A;  4O0P A;  1XJ2 A;  3E4P A;  3B42 A;  2PYR A;  4M4X A;  1GSX A;  2QSH A;  4JGP A;  2IKE A;  4MN5 A;  3C8C A;  4PHT A;  4MDZ A;  1ZHH B;  2JTO A;  2MJ6 A;  2DMW A;  5HWW A;  2A2L A;  3EEH A;  2JHE A;  1VHM A;  4L9F A;  3D4U B;  3BY8 A;  3CAX A;  4HJ4 A;  4LLO B;  3H9W A;  4EQ1 A;  3OLO A;  4JGO A;  4YIR A;  1V9Z A;  2OAP 1;  2KDK A;  3KYZ A;  5G4Z A;  2A24 A;  4RQ9 A;  5J3W A;  3ZQ5 A;  4WL9 A;  4PKY A;  3ULF A;  3RFB A;  3R7W B;  1XJ3 A;  4GHI B;  4CLC E;  2J3T C;  1Z99 A;  4HQA A;  2GZA A;  4ME4 A;  4F3L A;  2PDR A;  2HJ9 C;  4HHD A;  3P01 A;  2NUP C;  2J3W A;  4UQI M;  5TBM B;  2OWJ A;  4CLC C;  3UE6 A;  4LRZ E;  2VGL M;  3LR5 A;  1LT0 A;  3F1O A;  1MC0 A;  2BDS A;  4LRX C;  4H6J B;  1MZU A;  3G6O A;  3LR3 A;  3FG8 A;  1T19 A;  3KX0 X;  1DRM A;  5DJT A;  2Y79 A;  3O5Y A;  5MC7 A;  3MFX A;  1XJ4 A;  3ZYT A;  2QHK A;  4CQH A;  4OOM A;  2B18 A;  3BWL A;  1YKD A;  2K31 A;  2JR3 A;  3LMS B;  5DF9 A;  3HCY A;  4DMZ A;  1WA9 A;  3LI8 A;  3MQO A;  2HF6 A;  4Q0H A;  2WKP A;  4DJ3 A;  4DJ2 A;  3SW1 A;  1N9L A;  2GX5 A;  3C38 A;  2Z6C A;  4I38 A;  4KQO A;  3JVV A;  4WLA A;  3EEA A;  3KSG A;  1UWP X;  3MYV A;  1YAX A;  2PD7 A;  2V1B A;  2W3D A;  2FZ0 A;  4L9G A;  5IU1 A;  1NLZ A;  4HJ6 A;  3IS2 B;  1TF1 A;  2WKR A;  4R6L A;  1OTB A;  2W3H A;  4L9E A;  2VJW A;  2VV7 A;  3EQU A;  5HD3 A;  1S1Y A;  5HDD A;  1YSQ A;  4Y3I A;  4L0L A;  5F6A A;  2L0W A;  4EEU A;  3F1P B;  1SH1 A;  4WEL A;  1XFQ A;  2HV1 A;  2EA9 A;  3JVU A;  3FC7 A;  4EW7 A;  2HJE A;  4HY8 A;  2ZBB A;  5L8M A;  2W3E A;  4YNR A;  4E04 A;  1VB6 A;  1W63 Q;  2W1R A;  2XA7 M;  3NHQ A;  1LL8 A;  1F9I A;  4LRY C;  4Y2F A;  3MF0 A;  3PBQ A;  3PHY A;  1UGU A;  4P6Z M;  1OTE A;  2K7S A;  4KUO A;  4R70 A;  4UEY A;  3MJQ A;  1ODV A;  4EXO A;  3TE8 A;  4GLQ A;  1F5M A;  3TRC A;  2IKD A;  2INW A;  4II7 A;  3F1O B;  2XSS A;  5IS1 A;  5F69 A;  4HP9 A;  5EFW A;  2HGV A;  1EW0 A;  1X0O A;  4IHQ A;  1T18 A;  3EGX C;  4Z1W A;  4BBV A;  5DJU A;  3IBR A;  2YKH A;  3CWF A;  2KX6 A;  4ETZ A;  2ZMV A;  3NOP C;  5J4E A;  1B8W A;  3LIF A;  4NKP A;  2QWS A;  2M7U A;  2K2X A;  1OJG A;  2WKQ A;  3T4J A;  1G6O A;  3OC2 A;  1Y28 A;  3BW6 A;  2O9C A;  3F1N B;  3TJZ C;  3KYQ A;  2LB9 A;  2VZW A;  4KQD A;  4GS9 B;  4WUJ A;  2VKS A;  2V0U A;  3MR0 A;  4XT2 A;  2D02 A;  2YKF A;  3KSF A;  2W1T B;  1ZUE A;  1D6B A;  1LSW A;  3UB9 A;  3W2Z A;  2P08 A;  2PYP A;  2VX8 A;  3PBN A;  4AFI A;  5DKL A;  3RH8 B;  3UB7 A;  4ETX A;  4FSF A;  5AVE A;  5HWT A;  2RNG A;  2D01 A;  3LR0 A;  3LIC A;  5F5Y A;  4YOF A;  4QPR A;  3BQA A;  1WXN A;  2VEA A;  2LB5 A;  3H82 A;  4KUK A;  1NLY A;  1NRJ A;  4NXE A;  3PBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...