2HJEA

Crystal structure of vibrio harveyi luxq periplasmic domain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
220
structure length
210
Chain Sequence
SKQQTSALIHNIFDSHFAAIQIHHDSNSKSEVIRDFYTDRDTDVLNFFFLSIDQSDPSHTPEFRFLTDHKGIIWDDGNAHFYGVNDLILDSLANRVSFSNNWYYINVMTSIGSRHMLVRRVPILDPSTGEVLGFSFNAVVLDNNFALMEKLKSESNVDNVVLVANSVPLANSLIGDEPYNVADVLQLLVIETPIVVNAVTTELCLLTVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autoinducer 2 sensor kinase/phosphatase luxQ
publication title Ligand-induced asymmetry in histidine sensor kinase complex regulates quorum sensing.
pubmed doi rcsb
source organism Vibrio harveyi
molecule tags Signaling protein
total genus 64
structure length 210
sequence length 220
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.20.100 Mainly Beta Single Sheet Anthopleurin-A Anthopleurin-A 2hjeA02
3.30.450.220 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2hjeA01
1ZHHB 2HJEA 3C30A 2HJ9C 3C38A
chains in the Genus database with same CATH superfamily
4CLCB 4QD4A 1LT0A 3LMSB 1IYSA 3CMZA 4X1LA 2JTOA 2PYRA 3LR4A 3GQZA 5FAQA 2O9AA 3MMHA 1LSWA 4JGQA 4NXEA 3LO7A 3NOTC 3IBJA 1UWPX 3BFGA 3PR6A 4N1HA 4Q0JA 3M6BA 5CEDA 4FSFA 4RA7A 2HJEA 5EM1A 1ZG4A 1H8MA 1ONHA 4JXSA 3Q7VA 5EECA 1YMXA 4IBXA 1RGYA 4WUJA 5CGWA 3ZG8B 4JLFA 3MJQA 3CG5A 4OPZA 4GDBA 4DMZA 3E4QA 3LYXA 4Y13A 3O3VA 1MWSA 5TBMA 1OTDA 4WMCD 4IVIA 1PW1A 5CHUA 4U3TA 5EVLA 2E8IA 2R78A 4KZ8A 2Y2JA 3LR3A 1VM1A 3NOPC 4N9KA 1ES5A 2XGNA 4E3NA 4F94A 3C4OA 4HNBA 5FI6A 5J3WA 2LB5A 2ZC6B 2HPBA 2J8YA 1YKDA 2V2FF 2A49A 3WWXA 3SS4A 4HP9A 3ZG9B 3IX4A 1H3QA 5AQAA 4BBTA 3QP8A 1TDGA 4YIRA 3C30A 2WAEA 3TRCA 1LSXA 3W4PA 3PBTA 5JYPA 1FCMA 4OLGA 5CGSA 1ERMA 3PYPA 3MYVA 1NJ4A 4MBFA 2B02A 1TS0A 5FQKA 3VP0A 5KIZA 4GNUA 3OPRA 4E3OA 3B33A 5CHMA 1HTZA 4RYEA 4R3JA 3GDIA 4OQGA 5F68A 2J9OA 3IWOA 3F1OB 3KYQA 3SS3A 4JGOA 3BW6A 2V0WA 1W7FA 2VGKA 1K55A 3KSIA 2E8JA 4EUZA 2W27A 4PM7A 2V0UA 4EUVA 4N9LA 4B4ZA 3IH8A 3FZCA 3LEZA 1ES2A 4Y0TA 3BLSA 3AGDA 4LENA 1L2SA 1HVBA 1OT9A 2XQZA 4EBLA 1LHYA 1ZC2A 3U4LP 3IT9A 1XP4A 3IXGA 3WS4A 5J7EA 3MKEA 1L0GA 2GNXA 3SH9A 1F98A 4X1MA 3R7WB 3SS5A 3D3OA 5HZHA 1BUEA 3GRJA 4OLDA 4FCFA 4WZ4A 1W8QA 3W4QA 2NUTC 1RP5A 1V9YA 4KUKA 3VSKA 4CLCD 4X55A 5FQQA 1LI0A 2JC7A 2CC1A 5IU1A 1BSGA 4EQ1A 4JXWA 1MKMA 3WS1A 2IWCA 3A0RA 4HJ4A 4DE1A 1IOUA 3Q07A 2JBFA 4E3IA 1IELA 5AJGA 3MSHA 2WKIA 3RTYA 1L0DA 3L9KA 4UQIM 3OZHA 3MQ0A 2IA2A 1KDWA 3WS5A 1GHIA 3ICYA 1FSWA 1ONGA 2Y91A 4Q0IA 2HF6A 1Z99A 1XGIA 4P85A 4UQIS 5FEFA 5E43A 4B93A 4GZBA 4PM5A 3T4SA 4HI4A 2OSUA 3RFBA 1GCEA 1K6RA 3IXDA 1OTBA 1APFA 3CWFA 5DFXA 4JGRA 4OONA 3UB6A 1YSQA 3D4UB 5HX9A 2B18A 2XA7M 5FL3A 2EX6A 5HDCA 3BFEA 2RCXA 2VLGA 5FAPA 4R0QA 4O01A 5L07A 3DWKA 2XA7S 3D72A 4LRYC 4Y17A 4MBHA 2XH9A 1K56A 4JGPA 4IEDA 5HARA 4R38A 2Y2IA 4OOYA 4U0XA 5JYOA 1ES3A 5F6AA 4HJ3A 1OJGA 3EQUA 4FD8A 4OPRA 2A24B 3E2KA 3BFFA 3UNWA 4BLMA 4NK3A 2INWA 4GV5A 2EXBA 1XJ6A 3BEBA 3VOLA 2PD8A 3TG9A 1S1ZA 1YLTA 4DE3A 3LIEA 1GA9A 1O7EA 2W1TA 5E2HA 2JE5A 4ZJ1A 2OWHA 3CAXA 4GS9A 3D9YA 4GDNA 4GCZA 2Y2PA 3UB5P 3UPOA 3T1RA 3BLMA 3MQOA 1BULA 1TF1A 5FQIA 4LV2A 3N7WA 2ZC7A 3LY4A 3AGEA 2K31A 3LIFA 2A24A 5MC7A 1LL8A 2PR5A 1NLZA 5L09A 1G6OA 1MXOA 1YPRA 2AVXA 2ZMAA 4S2NA 4MDZA 3U2AA 1JNUA 5KSCA 3KEZA 3MCXA 1TS6A 3E0YA 3KX0X 1MC0A 1KE3A 1JWPA 3FPVA 3PBOA 4GHIA 4RQ9A 2VK3A 3T4LA 2WGWB 5F5YA 4LLOB 3JVUA 4DDSA 1IYOA 2QKPA 1C3BA 1D6BA 2D02A 3JPUA 1MWRA 1NYYA 1B8WA 1YLJA 3OPHA 1MWTA 2V20A 1SDNA 4U0TA 3VE4A 4H8RA 1T18A 4BQMA 1FIKA 2A3UA 3G31A 2XEPA 1H0MA 2PRFA 3GV9A 1S6RA 1K56D 2Q0OA 3MFDA 3HLBA 3H7WA 2H9XA 3OOVA 2J3TC 4JXVA 3ZGAB 4EESA 1K57A 2B5RA 5KMWA 5EE8A 2Q9NA 3BQAA 4MMNA 3VMAA 3OLOA 1EW0A 4FH4A 1ATXA 4GJ4A 4CPKA 2QWSA 4WYYA 4OOLA 4HJ6A 3KYEA 3DTEA 2JKFA 1NZUA 1K25A 1LSVA 2PU2A 4JF4A 1CK3A 4PM6A 3ISGA 3QHYA 3SH8A 2WGWA 1L0FA 1M40A 3BJNA 3O88A 1Y54A 4BL3A 4DE0A 5EM0A 1N9BA 4Y0OA 4PKYG 1EWZA 4EXOA 3S7OA 4EWFA 1BTLA 1GA0A 2K2XA 4BBVA 3W8KA 3ZVTA 4UEYA 1ESIA 2ZM2A 4OQIA 1K0KA 3G35A 3HVFA 1AXBA 3LUQA 2ZM8A 1VHMA 4UA6A 4LV1A 5GL9A 3T4JA 3A3DA 2V9AA 3W2ZA 2SH1A 5KSHA 5TR7A 2DNSA 1PWDA 3UB7A 1ALQA 1G6AA 4WMCA 1PZPA 1N4OA 2ZMVA 2WKHA 2JKRI 2ZQ8A 1GSWA 2DLAA 3D4FA 2ZMFA 2VV7A 3UE6A 2CMNA 3UB8A 2WAFA 2Z2LB 1PI5A 4K08A 1CI9A 4MCWA 4LFUA 3LI9A 5BOHA 4S2IA 3G2ZA 2ZQDA 1XA7A 3N4IA 3S7PA 2Q9MA 3VSLA 3IS2A 3A3EA 3LIBA 5F69A 4WEJA 4OP5A 3NECA 2EFUA 4DDYA 1XXMA 1ERQA 2Y2OA 3EWKA 4L9FA 1YAXA 2GX5A 4OP8A 3QP5A 2W3GA 1H5XA 5G4ZA 2C6WB 2PBDP 2ZL1B 1MY8A 4QWOA 2WZXA 2OAQ1 4XUZA 1K4EA 4QB8A 1PI4A 2XFSA 2H28A 5CX7A 4G3VA 4PPRA 1T1CA 1SCWA 3MS6A 1BT5A 3GECA 1GSXA 1ZG6A 3LFVA 3AGFA 1YLPA 5FDSA 2VKSA 5DTTA 4HBTA 2G7UA 1KE0A 3UMEA 3EOIA 4X68A 1I2SA 1FR6A 3PTEA 2VZWA 3LICA 2ACGA 2X71A 4YINA 3NDEA 4KZBA 1XGJA 1T1BA 4DJ3A 4E3KA 4M4XA 4Y0UA 1NRFA 3OCLA 2QJ7A 2BDSA 4KZ6A 1FOFA 1GL9B 4X69A 3BQ8A 5EOEA 1AHLA 3ITAA 4L9EA 2BTFP 1FCOA 2ZL1A 4P0MA 2W3HA 1PFLA 4F3LB 3H82B 3LEQA 4CLCA 5CRFA 1LL5A 4QU3A 3JYIA 3E98A 1CQAA 5GLAA 3NBLA 5AVEA 5HAPA 1ZTUA 4GN2A 2RNGA 2VJWA 5J8XA 2X02A 3CHWP 3IHAA 5EVIC 1YLYA 4OQ0A 3IQAA 4R4SA 2HDRA 3Q82A 2MN3A 1D1JA 1JWZA 2C5WB 1W63Q 5A91A 3QNCA 1XFQA 4BD1A 4WF0A 5HD3A 4UA9A 2MJ6A 1A0KA 1HZOA 4WEKA 3DW0A 1BLCA 4DF6A 5HPIA 2XD5A 1S1YA 1G28A 3UPPA 4PAUA 3H82A 1TVFA 3MKFA 3HJKA 1CEFA 3E4PA 1ESUA 4ZTKA 2W3DA 4I3AA 3HJIA 4S2KA 1MKIA 3HLCA 1BLHA 5AQ7A 2QMIA 2VV8A 3KSHA 4Y7PA 1FSYA 3NHQA 2HDUA 3S4XA 4P6ZM 4O0PA 2WKQA 2DRWA 3PBQA 2M1CA 1ZKJA 3R4KA 2WGVA 3ZG0A 1J9MA 2R9XA 3IBRA 2QSHA 2Y2KA 2QZ6A 4P6ZS 2Z2MB 2OAP1 1LL9A 1ES4A 2FFFB 2Y4AA 2VA0A 1BYWA 3IXHA 3Q7ZA 2QSFA 4K0WA 3T1XA 2JKGA 2PAVP 4ZDXA 3ULFA 2ZQAA 5FAOA 3A3IA 2ZOIA 5DKKA 1D06A 4IVKA 1K55C 3E4OA 5EFWA 4R6LA 3BECA 4PMAA 3G6OA 3F1OA 1E25A 2HZ5A 2V1AA 1GKUB 1S67L 3CPTB 4S2PA 1ZHHB 3ZG5A 1Q2PA 2QYBA 1WQKA 5I5LA 2O99A 5HFOA 5HWTA 1K6SA 3QNBA 3VE3A 4E3LA 1CJFA 3FYZA 5J4EA 3HLWA 4GB7A 1BDSA 2PD7A 1NWZA 2DCFA 2ZBBA 1YLWA 4WZ5A 1T19A 4HQAA 2EX2A 2MUBA 3A3JA 4KUOA 4KENB 3HCYA 3EGXC 3R7WA 4BMWA 5HAIA 1Z6FA 2EFXA 4I39A 3IF4A 3RXWA 1IKIA 4EEUA 3LIDA 1XJ2A 3ZVWA 2HP5A 2G2UA 3EGDC 1QMEA 1I5QA 4GLQA 4HEFA 4YWZA 1E3UD 3GTCA 1XFNA 2D01A 1N9LA 1NYMA 5M19A 2GDNA 2I9VA 3MFXA 4Q8IA 3CPTA 1BZAA 3BYDA 1V9ZA 5DTSA 3LI8A 5IS1A 3A0SA 5CHJA 3IWIA 4KG6A 1FILA 4C6YA 4Q0HA 3VP3A 3VP4A 4R3AA 1EL6A 2L1MA 4IJGA 3MR0A 2VEAA 2WKEA 4WM9A 5DJTA 2RL3A 3IWQA 2XLNA 4DRTA 3N8SA 4S2JA 1K54C 2P9VB 1TDLA 2Y2QA 4GW9A 3PBSA 3MZEA 4KZ9A 3HUOA 4GD8A 1VB6A 3NC8A 1CF0A 2P04A 4QY5A 1VETB 5G18A 3RXXA 3C5AA 5CTMA 4PM8A 4KZ3A 3T4KA 4L0LA 5HSQA 3V39A 3T4OA 4GOGA 5LBRA 4DXCA 1YM1A 2XRNA 3E2LA 3KYZA 1KVMA 3UE3A 5TFQA 1N9NA 2P74A 2FZ0A 1T1AA 3B42A 3EEHA 4OPYA 4IUKA 3FKVA 4XXRA 5AQBA 4N92A 4R4RA 2XK1A 4BWIA 4LRXC 2Y55A 3V50A 3DAVA 3MXRA 2OOLA 1M6KA 1L3LA 4E3JA 1PRQA 4MN7A 4XT2B 2H10A 5C5KA 3MZFA 4AFIA 2P9VA 2L0WA 3IF6B 2W0NA 2LB9A 1PNEA 4ARZB 1XPBA 3ITBA 3F1PB 1OTEA 1VETA 4MLLA 1KGEA 1DY6A 3CITA 2JHEA 4R3BA 5DF7A 4FH2A 1J3WA 2KLIA 1NLYA 2WUQA 4S2LA 5G4YA 3BY9A 3HLGA 3O87A 5GLCA 3CUEC 3VOYA 1WE4A 4MEZA 2XD1A 1BLSA 1XX2A 2HP9A 1FQGA 2G2WA 2O9CA 2OWJA 3KO6A 3NIAA 3M6HA 3NI9A 3F1NB 3P09A 5FQMA 3P01A 5HDSA 3MBZA 4IBRA 3IHBA 3EQVA 5E2FA 1G68A 5M1AA 4ARZA 3F1PA 3CLOA 1H8ZA 2K2NA 2I72A 2PU4A 1RGZA 4Y3IA 4NKPA 3FV7A 5HL1A 3QP2A 2P08A 3IF6C 1GHMA 4A5RA 1Y4OA 1XJ3A 5HDDA 3IX8A 2PHYA 5L10A 3WS2A 3UO9A 5CECA 1XJ4A 4O8GA 4DJ2A 4R70A 1VEUB 2A2LA 3S22A 1W63M 4FUWA 1CI8A 4LCLA 4KZAA 3WS0A 2UV0E 4ID4A 4NXBA 5DVAA 2XXLA 3BY8A 4X56A 3W4OA 1DJCA 2V8FA 4UA7A 4ME4A 1EROA 1K4FA 4KZ7A 2WK0A 3UY6A 2IKEA 1DRMA 4Y5FA 1KE4A 5EVEA 1IFQA 3C2WA 3LCEA 3HLFA 4Y2FA 2ZM0A 4ESPA 2EX8A 3PAGA 4WLAA 3M2KA 2VGLM 5K5BA 1NRJA 4EBPA 4ETXA 2EWWA 3GR2A 5A8BA 4QPRA 2VGJA 4EERA 4HP4A 1ZLHB 2J3TD 4QY6A 1YSPA 4CLCE 4FOFA 4CQHA 2VGLS 1JTDA 2O9BA 3MXQA 2J80A 2XFTA 1MWUA 4EU0A 5IT5A 3MXSA 5HL6A 3DTMA 1SHIA 4MN6A 3VFFA 3LGOA 5TGFA 5F1GA 1MBLA 3T12B 5AVFA 3NOUC 4UHUA 3CI6A 3FG8A 3C7VA 4KG2A 5DKLA 1L0EA 4E04A 5FI7A 1P0ZA 5EVIB 4BENA 3CZDA 2X01A 1CEGA 3Q7VB 4D60A 3BM6A 4N1XA 3BFDA 1FR1A 4M3KA 1LLBA 1KOUA 3NY4A 5F83A 4L9GA 3G2YA 5TBMB 4BL2A 1ZUFA 3HREA 4NXFA 2W1RA 4X25A 1O07A 3B3XA 1DJBA 2HDSA 5EUAA 2B9KA 3WRTA 2JN7A 4YFMA 4YOFA 1ZUEA 3K2NA 5DFYA 2PYPA 1WXNA 4E6WA 4HESA 5M18A 3PBNA 2W3FA 3C8CA 2ZD8A 2WADA 5EVIA 4LRZE 4EQIA 3IXBA 3C4PA 3PAEA 3GVBA 2GJ3A 3DTKA 1SKFA 2OV5A 3B47A 1U60A 4OQHA 3LR0A 5EPHA 4I38A 1SHVA 2KX6A 1N9OA 2WGIA 3PHYA 1ODVA 3V67A 2JKTM 4DE2A 1OTIA 3N6IA 2ZOHA 3PXPA 3Q81A 3TSGA 2K7SA 2VV6A 3G34A 2R9WA 3RH8B 1SZVA 2O0YA 1HD8A 3UMDA 3A3FA 1P9WA 4LV0A 2J3WA 4CLCC 3LR5A 5EV0A 5FQ9A 3EEAA 1SDEA 2QHKA 3HLEA 3A0VA 3FPWA 5HD5A 3UB9A 3V5MA 1PW8A 4NEED 2QSGA 4F3LA 1E3UA 1STZA 2WYXA 2M7VA 3T1SA 5E2GA 2M7UA 2J7VA 4XUXA 1HLUP 3ZG7B 3MF0A 4DXBA 1XKZA 2V8CA 4IUHA 4KQOA 4D2OA 3ZFZA 2PBYA 4G3KA 2Z6CA 4JF5A 4OKPA 1IYPA 1S66L 4IHQA 1ACFA 1TEMA 4NETA 4B4XA 4JKTA 1IYQA 5I94A 4LV3A 4R23A 3WRZA 4PHTA 4WN5A 2ZC5B 3HUMA 1VQQA 2PT7A 3K3DA 3PBRA 2EXAA 3SH7A 3H9WA 4II7A 3V3SA 1P9RA 5EVID 2EX9A 3GMWA 4HY8A 1UGUA 4JXGA 2QPNA 3T1QB 1W79A 1NZOA 4ZAMA 4JF6A 3KSFA 4B88A 4KG5A 1Y28A 2BG1A 1IKGA 2QJ5A 3FC7A 4OPQA 3CJMA 3ZNTA 3MZDA 2P7JA 3S7QA 3Q1FA 4EETB 2OLUA 3M2JA 3NDGA 4Z9QA 3UN7A 2UWXA 5AQ9A 3K3CA 4I5SA 1XA1A 1YLZA 3T4TA 4HH3A 3OPLA 5CTNA 1WYBA 1S4RA 1D7EA 5DF8A 5L2FA 2NUPC 3FWLA 3VP2A 5F1FA 3HLDA 4ETZA 3G30A 1DP8A 2Y2LA 5U47A 2JKTI 2YKFA 2VX8A 2V1BA 5GHXA 5CEBA 4ZJ3A 3TOIA 1SKOB 4KQDA 2Y2MA 1NY0A 2ZJ9A 1I2WA 3P7NA 2B95A 4P87A 4C75A 5A93A 1KGGA 2FH5A 4WZ5C 2W1TB 2V1ZA 4RX2A 3HUNA 5EOOA 2GZAA 3I7JA 3T4QA 2Y2HA 4GS9B 2L4RA 5GLDA 5IHVA 2H5SA 2HP6A 5FEGA 1K54A 3C7UA 5HW3A 4JPMA 5CERA 3JVVA 3OCNA 3TJZC 4HIAA 1WYCA 5FI2A 4EEPA 1GHPA 4QJGA 5FASA 2KDKA 4P6BA 3NULA 2EA9A 4HHDA 1KDSA 1SKOA 5FATA 5FDHA 3UDFA 1JWVA 5GHYA 2WKRA 4MN5A 3QP1A 2Y8HA 2XF3A 1YT4A 3VOZA 3OC2A 1Z09A 4OH0A 1PWCA 4ZBEA 4KQQA 4EV4A 1W8YA 4GHIB 5FA7A 4E3MA 4RVAA 2FFYA 4LGWA 2ZQ7A 2Y2NA 5D3OA 1YQSA 1H8YA 1S0WA 1KVLA 3N8LA 4O7DA 2KOIA 2JKRM 1PZOA 4I3IA 1MPLA 2Y79A 2XROA 5DTKA 3IH9A 2WKPA 1IEMA 3TE8A 1TD5A 4DKIA 4MBKA 5HPFA 3DWZA 3H7WB 3S7NA 4X53A 2PDRA 1JVJA 5CGXA 4UAAA 3TW8A 4NXGA 3S1YA 2XR0A 4R1GA 3UDXA 3CUEA 2W3EA 1WA9A 1OMEA 1KGFA 2H0TA 3UE1A 4S2NC 2PR6A 4CJNA 3C38A 3ZDJA 1DP9A 5HWWA 2Z6DA 1SH1A 1RCJA 2DMWA 1H5OA 1BLPA 4I3JA 4K91A 4FTXA 1OJ5A 3VP1A 4WELA 3ZNYA 3LY3A 1PIOA 3BRMA 2Y2GA 4HOIA 3UDIA 3BWLA 1F9IA 1PWGA 4ZRRA 1LI9A 4XT2A 2J9PA 3LIAA 3GSGA 3IF6A 3VV4A 4ZJ2A 5CXWA 2HGVA 5HWVA 1GSVA 5FSRA 1ZLIB 1UWNX 1EI5A 5F82A 1DP6A 2OLVA 3QP6A 2BLSA 3NCKA 4E6XA 4X6TA 4B9OA 2HV1A 2JR3A 2ZC3B 3KSGA 2YKHA 4BJPA 1K57C 2HDQA 3NJAA 5GHZA 3ZHHA 3DBAA 3L7HA 4LCMA 3T50A 3FKWA 1MZUA 4HBUA 3O5YA 5KZHA 4RX3A 3HL9A 2Y59A 1TS8A 4GKUA 4OOMA 1QMFA 3F1NA 4OVDA 4JBFA 1FCNA 4EW7A 4K0XA 3IX3A 4WL9A 3IS2B 2EWVA 3UE0A 5DJUA 4H6JB 3VFHA 4WBGA 3SZTA 3ZCZA 4BD0A 1OPXA 2ZC4B 2JCHA 1Q2QA 5GLBA 3SOIA 2IWDA 2WZZA 1OT6A 1S4SA 3HBRA 3RJUA 3DTIA 1F2KA 5FQJA 4PKYA 2HJ9C 3ZYTA 5HAQA 3BFCA 2XSSA 3UPNA 4YNRA 1F5MA 3G4PA 4S2MA 3OPPA 1G5UA 1VEUA 1P97A 3OBFA 2ZQ9A 3V3RA 5L8MA 3IF5A 1JTGA 4KQRA 4PM9A 1PYYA 4NG2A 4HH2A 5A90A 4KZ4A 4G3WA 4MNRA 3QP4A 5A92A 3MQQA 2H0YA 4LPZA 2ZQCA 4H6JA 1OTAA 2IKDA 5E2EA 1AWIA 2ZLYA 4GD6A 1E4DA 1W5DA 1K38A 1NXYA 3P98A 2IWBA 3SW1A 1YMSA 2BASA 4S2OA 4DN0A 2XDMA 4EBNA 4KZ5A 3G32A 1X0OA 4C3QA 5TJJA 3N8RA 3ZQ5A 5DF9A 1DJAA 3O86A 1TS7A 4Y15A 4Z1WA 4BBUA 4QHCA
chains in the Genus database with same CATH topology
4CLCB 1S66L 1LT0A 4HJ6A 4IHQA 3LMSB 4R3AA 2JTOA 2L1MA 2PYRA 3LR4A 1LSVA 2O9AA 4IJGA 3MMHA 3MR0A 2VEAA 1LSWA 5DJTA 4JGQA 4NXEA 3BJNA 4PHTA 3NOTC 3IBJA 1UWPX 4WN5A 3PR6A 4Q0JA 2PT7A 3K3DA 3PBRA 4GW9A 3PBSA 4FSFA 3H9WA 4II7A 4PKYG 2HJEA 1P9RA 4EXOA 1VB6A 3S7OA 4HY8A 2K2XA 1UGUA 2P04A 1H8MA 4BBVA 3T4KA 3KSFA 4L0LA 5HSQA 4UEYA 3T4OA 1Y28A 5LBRA 2QJ5A 3FC7A 2XRNA 3LUQA 3KYZA 1VHMA 4WUJA 3UE3A 1N9NA 3MJQA 2FZ0A 1T1AA 4DMZA 3E4QA 3LYXA 3B42A 3EEHA 2P7JA 4IUKA 3S7QA 5TBMA 1OTDA 3T4JA 4EETB 2V9AA 3W2ZA 2SH1A 5KSHA 2R78A 3UB7A 3K3CA 4BWIA 4LRXC 4I5SA 3LR3A 3T4TA 3NOPC 2OOLA 4HH3A 2ZMVA 2JKRI 4MN7A 4XT2B 1S4RA 1GSWA 5C5KA 1D7EA 2DLAA 4AFIA 2ZMFA 4HNBA 2NUPC 5J3WA 2L0WA 2LB5A 2W0NA 2LB9A 2VV7A 3UE6A 1YKDA 4ARZB 4ETZA 1DP8A 3F1PB 2CMNA 3UB8A 4K08A 4HP9A 2JKTI 2YKFA 2VX8A 1OTEA 4MCWA 3LI9A 2V1BA 1H3QA 3CITA 2JHEA 3S7PA 3IS2A 3LIBA 5F69A 4KQDA 4WEJA 4BBTA 4YIRA 2KLIA 3C30A 1NLYA 3TRCA 1LSXA 5G4YA 3EWKA 3P7NA 3BY9A 4L9FA 3PBTA 1YAXA 3CUEC 2FH5A 2GX5A 3PYPA 2W3GA 3MYVA 2W1TB 2B02A 1TS0A 5G4ZA 5KIZA 2O9CA 2OWJA 3T4QA 2GZAA 3KO6A 4GS9B 2L4RA 3F1NB 3B33A 3P01A 2OAQ1 5HDSA 3GDIA 2H28A 5CX7A 3EQVA 4G3VA 5F68A 1T1CA 3JVVA 3OCNA 3TJZC 4ARZA 4HIAA 3F1OB 3F1PA 3KYQA 3CLOA 4EEPA 4JGOA 3BW6A 3GECA 1GSXA 2V0WA 3KSIA 3LFVA 2K2NA 2KDKA 2W27A 2V0UA 4EUVA 2VKSA 2EA9A 4Y3IA 2G7UA 3UMEA 3EOIA 4NKPA 4HHDA 1OT9A 2P08A 2WKRA 4MN5A 2Y8HA 2VZWA 3LICA 1XJ3A 5HDDA 3OC2A 2PHYA 5J7EA 2GNXA 1T1BA 4DJ3A 1F98A 3R7WB 4M4XA 1XJ4A 3D3OA 4O8GA 4R70A 4DJ2A 5HZHA 2A2LA 1W63M 4GHIB 3OCLA 2QJ7A 2BDSA 2NUTC 1V9YA 3BQ8A 1AHLA 4KUKA 4L9EA 4CLCD 2W3HA 4NXBA 4F3LB 3H82B 4CLCA 2XXLA 2KOIA 5IU1A 2JKRM 3BY8A 4I3IA 2Y79A 4EQ1A 2XROA 1MKMA 3E98A 4ME4A 3A0RA 2WKPA 4HJ4A 3TE8A 5AVEA 2IKEA 1DRMA 4Y5FA 1IOUA 1ZTUA 1IFQA 1TD5A 3C2WA 2RNGA 4Y2FA 2VJWA 5AJGA 4WLAA 2VGLM 5HPFA 5K5BA 3H7WB 3S7NA 3RTYA 1NRJA 2PDRA 4UQIM 4ETXA 2EWWA 3MQ0A 3TW8A 5A8BA 4NXGA 4QPRA 2MN3A 2IA2A 4EERA 4HP4A 3ICYA 1ZLHB 2J3TD 1YSPA 4CLCE 1W63Q 3CUEA 4FOFA 4CQHA 1XFQA 2VGLS 4Q0IA 2O9BA 1WA9A 2W3EA 2HF6A 3MXQA 1Z99A 2J80A 4WF0A 4UQIS 5HD3A 4EU0A 5IT5A 4B93A 5HL6A 2MJ6A 3T4SA 4HI4A 3RFBA 4WEKA 2PR6A 1SHIA 3C38A 4MN6A 1OTBA 3CWFA 1APFA 1DP9A 5HWWA 2Z6DA 5DFXA 4JGRA 1SH1A 3UB6A 5HPIA 1YSQA 3D4UB 1S1YA 2DMWA 1H5OA 2B18A 1G28A 4PAUA 4I3JA 5AVFA 3H82A 3NOUC 2XA7M 1OJ5A 3HJKA 4WELA 5FL3A 3CI6A 3E4PA 3FG8A 2W3DA 5DKLA 5HDCA 4I3AA 3HJIA 4E04A 4HOIA 2VLGA 1P0ZA 3BWLA 1F9IA 4O01A 4ZRRA 2VV8A 4XT2A 2XA7S 3LIAA 3KSHA 3D72A 4LRYC 3NHQA 3VV4A 4JGPA 4P6ZM 4R38A 2HGVA 5HWVA 1KOUA 4O0PA 2WKQA 1GSVA 1ZLIB 1UWNX 3PBQA 5F6AA 2M1CA 4HJ3A 4L9GA 1OJGA 3EQUA 1DP6A 2A24B 3R4KA 5TBMB 4B9OA 2HV1A 1ZUFA 3IBRA 2QSHA 2JR3A 4P6ZS 3KSGA 4NXFA 2W1RA 2YKHA 2INWA 4GV5A 4BJPA 3NJAA 1XJ6A 2OAP1 3VOLA 2PD8A 2B9KA 2JN7A 3DBAA 4YOFA 1ZUEA 1S1ZA 3T50A 2VA0A 1BYWA 1MZUA 3K2NA 3LIEA 3O5YA 5DFYA 2W1TA 2QSFA 2PYPA 1WXNA 3ULFA 1TS8A 2OWHA 3CAXA 2W3FA 3PBNA 3C8CA 4GS9A 4OOMA 2ZOIA 5DKKA 3F1NA 1D06A 4GCZA 4LRZE 4EW7A 3E4OA 5EFWA 2GJ3A 4WL9A 3IS2B 4R6LA 2EWVA 5DJUA 3B47A 4H6JB 3MQOA 3LR0A 3G6OA 1TF1A 4I38A 3F1OA 1OPXA 2KX6A 1N9OA 3PHYA 2V1AA 2K31A 3LIFA 1ODVA 2A24A 2JKTM 1S67L 3V67A 5MC7A 1LL8A 1ZHHB 2PR5A 1OTIA 1NLZA 1OT6A 1WQKA 2QYBA 2ZOHA 1S4SA 1G6OA 2O99A 3PXPA 5I5LA 5HWTA 4MDZA 3U2AA 3VE3A 5J4EA 4PKYA 2K7SA 1JNUA 2VV6A 1BDSA 2PD7A 2HJ9C 3KEZA 1NWZA 3RH8B 3ZYTA 2ZBBA 3MCXA 1T19A 1TS6A 4HQAA 3E0YA 2XSSA 2O0YA 3KX0X 2MUBA 4KUOA 4YNRA 3UMDA 1MC0A 1P9WA 2J3WA 3HCYA 1F5MA 3EGXC 3R7WA 4BMWA 4I39A 4CLCC 3LR5A 3FPVA 1P97A 2QHKA 3EEAA 3OBFA 3A0VA 3PBOA 4GHIA 4RQ9A 3FPWA 3T4LA 5HD5A 4EEUA 5F5YA 3LIDA 4LLOB 3JVUA 5L8MA 3UB9A 2QKPA 1XJ2A 1D6BA 3EGDC 2D02A 4NEED 4GLQA 4YWZA 2QSGA 4F3LA 1B8WA 4HH2A 1STZA 1XFNA 4G3WA 2D01A 1N9LA 2M7VA 3MQQA 4LPZA 3VE4A 4H6JA 1T18A 1OTAA 2M7UA 2IKDA 2I9VA 3SW1A 2BASA 4DN0A 3MFXA 3OOVA 3H7WA 2H9XA 2J3TC 3MF0A 4EESA 1X0OA 1V9ZA 4IUHA 4KQOA 3LI8A 5TJJA 5IS1A 3ZQ5A 5DF9A 3A0SA 3BQAA 4MMNA 3OLOA 1EW0A 1TS7A 1ATXA 4G3KA 4GJ4A 4Q0HA 2QWSA 2Z6CA 4Z1WA 4BBUA 4OOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZHH B;  2HJE A;  3C30 A;  2HJ9 C;  3C38 A; 
#chains in the Genus database with same CATH topology
 4CLC B;  4QD4 A;  1LT0 A;  3LMS B;  1IYS A;  3CMZ A;  4X1L A;  2JTO A;  2PYR A;  3LR4 A;  3GQZ A;  5FAQ A;  2O9A A;  3MMH A;  1LSW A;  4JGQ A;  4NXE A;  3LO7 A;  3NOT C;  3IBJ A;  1UWP X;  3BFG A;  3PR6 A;  4N1H A;  4Q0J A;  3M6B A;  5CED A;  4FSF A;  4RA7 A;  2HJE A;  5EM1 A;  1ZG4 A;  1H8M A;  1ONH A;  4JXS A;  3Q7V A;  5EEC A;  1YMX A;  4IBX A;  1RGY A;  4WUJ A;  5CGW A;  3ZG8 B;  4JLF A;  3MJQ A;  3CG5 A;  4OPZ A;  4GDB A;  4DMZ A;  3E4Q A;  3LYX A;  4Y13 A;  3O3V A;  1MWS A;  5TBM A;  1OTD A;  4WMC D;  4IVI A;  1PW1 A;  5CHU A;  4U3T A;  5EVL A;  2E8I A;  2R78 A;  4KZ8 A;  2Y2J A;  3LR3 A;  1VM1 A;  3NOP C;  4N9K A;  1ES5 A;  2XGN A;  4E3N A;  4F94 A;  3C4O A;  4HNB A;  5FI6 A;  5J3W A;  2LB5 A;  2ZC6 B;  2HPB A;  2J8Y A;  1YKD A;  2V2F F;  2A49 A;  3WWX A;  3SS4 A;  4HP9 A;  3ZG9 B;  3IX4 A;  1H3Q A;  5AQA A;  4BBT A;  3QP8 A;  1TDG A;  4YIR A;  3C30 A;  2WAE A;  3TRC A;  1LSX A;  3W4P A;  3PBT A;  5JYP A;  1FCM A;  4OLG A;  5CGS A;  1ERM A;  3PYP A;  3MYV A;  1NJ4 A;  4MBF A;  2B02 A;  1TS0 A;  5FQK A;  3VP0 A;  5KIZ A;  4GNU A;  3OPR A;  4E3O A;  3B33 A;  5CHM A;  1HTZ A;  4RYE A;  4R3J A;  3GDI A;  4OQG A;  5F68 A;  2J9O A;  3IWO A;  3F1O B;  3KYQ A;  3SS3 A;  4JGO A;  3BW6 A;  2V0W A;  1W7F A;  2VGK A;  1K55 A;  3KSI A;  2E8J A;  4EUZ A;  2W27 A;  4PM7 A;  2V0U A;  4EUV A;  4N9L A;  4B4Z A;  3IH8 A;  3FZC A;  3LEZ A;  1ES2 A;  4Y0T A;  3BLS A;  3AGD A;  4LEN A;  1L2S A;  1HVB A;  1OT9 A;  2XQZ A;  4EBL A;  1LHY A;  1ZC2 A;  3U4L P;  3IT9 A;  1XP4 A;  3IXG A;  3WS4 A;  5J7E A;  3MKE A;  1L0G A;  2GNX A;  3SH9 A;  1F98 A;  4X1M A;  3R7W B;  3SS5 A;  3D3O A;  5HZH A;  1BUE A;  3GRJ A;  4OLD A;  4FCF A;  4WZ4 A;  1W8Q A;  3W4Q A;  2NUT C;  1RP5 A;  1V9Y A;  4KUK A;  3VSK A;  4CLC D;  4X55 A;  5FQQ A;  1LI0 A;  2JC7 A;  2CC1 A;  5IU1 A;  1BSG A;  4EQ1 A;  4JXW A;  1MKM A;  3WS1 A;  2IWC A;  3A0R A;  4HJ4 A;  4DE1 A;  1IOU A;  3Q07 A;  2JBF A;  4E3I A;  1IEL A;  5AJG A;  3MSH A;  2WKI A;  3RTY A;  1L0D A;  3L9K A;  4UQI M;  3OZH A;  3MQ0 A;  2IA2 A;  1KDW A;  3WS5 A;  1GHI A;  3ICY A;  1FSW A;  1ONG A;  2Y91 A;  4Q0I A;  2HF6 A;  1Z99 A;  1XGI A;  4P85 A;  4UQI S;  5FEF A;  5E43 A;  4B93 A;  4GZB A;  4PM5 A;  3T4S A;  4HI4 A;  2OSU A;  3RFB A;  1GCE A;  1K6R A;  3IXD A;  1OTB A;  1APF A;  3CWF A;  5DFX A;  4JGR A;  4OON A;  3UB6 A;  1YSQ A;  3D4U B;  5HX9 A;  2B18 A;  2XA7 M;  5FL3 A;  2EX6 A;  5HDC A;  3BFE A;  2RCX A;  2VLG A;  5FAP A;  4R0Q A;  4O01 A;  5L07 A;  3DWK A;  2XA7 S;  3D72 A;  4LRY C;  4Y17 A;  4MBH A;  2XH9 A;  1K56 A;  4JGP A;  4IED A;  5HAR A;  4R38 A;  2Y2I A;  4OOY A;  4U0X A;  5JYO A;  1ES3 A;  5F6A A;  4HJ3 A;  1OJG A;  3EQU A;  4FD8 A;  4OPR A;  2A24 B;  3E2K A;  3BFF A;  3UNW A;  4BLM A;  4NK3 A;  2INW A;  4GV5 A;  2EXB A;  1XJ6 A;  3BEB A;  3VOL A;  2PD8 A;  3TG9 A;  1S1Z A;  1YLT A;  4DE3 A;  3LIE A;  1GA9 A;  1O7E A;  2W1T A;  5E2H A;  2JE5 A;  4ZJ1 A;  2OWH A;  3CAX A;  4GS9 A;  3D9Y A;  4GDN A;  4GCZ A;  2Y2P A;  3UB5 P;  3UPO A;  3T1R A;  3BLM A;  3MQO A;  1BUL A;  1TF1 A;  5FQI A;  4LV2 A;  3N7W A;  2ZC7 A;  3LY4 A;  3AGE A;  2K31 A;  3LIF A;  2A24 A;  5MC7 A;  1LL8 A;  2PR5 A;  1NLZ A;  5L09 A;  1G6O A;  1MXO A;  1YPR A;  2AVX A;  2ZMA A;  4S2N A;  4MDZ A;  3U2A A;  1JNU A;  5KSC A;  3KEZ A;  3MCX A;  1TS6 A;  3E0Y A;  3KX0 X;  1MC0 A;  1KE3 A;  1JWP A;  3FPV A;  3PBO A;  4GHI A;  4RQ9 A;  2VK3 A;  3T4L A;  2WGW B;  5F5Y A;  4LLO B;  3JVU A;  4DDS A;  1IYO A;  2QKP A;  1C3B A;  1D6B A;  2D02 A;  3JPU A;  1MWR A;  1NYY A;  1B8W A;  1YLJ A;  3OPH A;  1MWT A;  2V20 A;  1SDN A;  4U0T A;  3VE4 A;  4H8R A;  1T18 A;  4BQM A;  1FIK A;  2A3U A;  3G31 A;  2XEP A;  1H0M A;  2PRF A;  3GV9 A;  1S6R A;  1K56 D;  2Q0O A;  3MFD A;  3HLB A;  3H7W A;  2H9X A;  3OOV A;  2J3T C;  4JXV A;  3ZGA B;  4EES A;  1K57 A;  2B5R A;  5KMW A;  5EE8 A;  2Q9N A;  3BQA A;  4MMN A;  3VMA A;  3OLO A;  1EW0 A;  4FH4 A;  1ATX A;  4GJ4 A;  4CPK A;  2QWS A;  4WYY A;  4OOL A;  4HJ6 A;  3KYE A;  3DTE A;  2JKF A;  1NZU A;  1K25 A;  1LSV A;  2PU2 A;  4JF4 A;  1CK3 A;  4PM6 A;  3ISG A;  3QHY A;  3SH8 A;  2WGW A;  1L0F A;  1M40 A;  3BJN A;  3O88 A;  1Y54 A;  4BL3 A;  4DE0 A;  5EM0 A;  1N9B A;  4Y0O A;  4PKY G;  1EWZ A;  4EXO A;  3S7O A;  4EWF A;  1BTL A;  1GA0 A;  2K2X A;  4BBV A;  3W8K A;  3ZVT A;  4UEY A;  1ESI A;  2ZM2 A;  4OQI A;  1K0K A;  3G35 A;  3HVF A;  1AXB A;  3LUQ A;  2ZM8 A;  1VHM A;  4UA6 A;  4LV1 A;  5GL9 A;  3T4J A;  3A3D A;  2V9A A;  3W2Z A;  2SH1 A;  5KSH A;  5TR7 A;  2DNS A;  1PWD A;  3UB7 A;  1ALQ A;  1G6A A;  4WMC A;  1PZP A;  1N4O A;  2ZMV A;  2WKH A;  2JKR I;  2ZQ8 A;  1GSW A;  2DLA A;  3D4F A;  2ZMF A;  2VV7 A;  3UE6 A;  2CMN A;  3UB8 A;  2WAF A;  2Z2L B;  1PI5 A;  4K08 A;  1CI9 A;  4MCW A;  4LFU A;  3LI9 A;  5BOH A;  4S2I A;  3G2Z A;  2ZQD A;  1XA7 A;  3N4I A;  3S7P A;  2Q9M A;  3VSL A;  3IS2 A;  3A3E A;  3LIB A;  5F69 A;  4WEJ A;  4OP5 A;  3NEC A;  2EFU A;  4DDY A;  1XXM A;  1ERQ A;  2Y2O A;  3EWK A;  4L9F A;  1YAX A;  2GX5 A;  4OP8 A;  3QP5 A;  2W3G A;  1H5X A;  5G4Z A;  2C6W B;  2PBD P;  2ZL1 B;  1MY8 A;  4QWO A;  2WZX A;  2OAQ 1;  4XUZ A;  1K4E A;  4QB8 A;  1PI4 A;  2XFS A;  2H28 A;  5CX7 A;  4G3V A;  4PPR A;  1T1C A;  1SCW A;  3MS6 A;  1BT5 A;  3GEC A;  1GSX A;  1ZG6 A;  3LFV A;  3AGF A;  1YLP A;  5FDS A;  2VKS A;  5DTT A;  4HBT A;  2G7U A;  1KE0 A;  3UME A;  3EOI A;  4X68 A;  1I2S A;  1FR6 A;  3PTE A;  2VZW A;  3LIC A;  2ACG A;  2X71 A;  4YIN A;  3NDE A;  4KZB A;  1XGJ A;  1T1B A;  4DJ3 A;  4E3K A;  4M4X A;  4Y0U A;  1NRF A;  3OCL A;  2QJ7 A;  2BDS A;  4KZ6 A;  1FOF A;  1GL9 B;  4X69 A;  3BQ8 A;  5EOE A;  1AHL A;  3ITA A;  4L9E A;  2BTF P;  1FCO A;  2ZL1 A;  4P0M A;  2W3H A;  1PFL A;  4F3L B;  3H82 B;  3LEQ A;  4CLC A;  5CRF A;  1LL5 A;  4QU3 A;  3JYI A;  3E98 A;  1CQA A;  5GLA A;  3NBL A;  5AVE A;  5HAP A;  1ZTU A;  4GN2 A;  2RNG A;  2VJW A;  5J8X A;  2X02 A;  3CHW P;  3IHA A;  5EVI C;  1YLY A;  4OQ0 A;  3IQA A;  4R4S A;  2HDR A;  3Q82 A;  2MN3 A;  1D1J A;  1JWZ A;  2C5W B;  1W63 Q;  5A91 A;  3QNC A;  1XFQ A;  4BD1 A;  4WF0 A;  5HD3 A;  4UA9 A;  2MJ6 A;  1A0K A;  1HZO A;  4WEK A;  3DW0 A;  1BLC A;  4DF6 A;  5HPI A;  2XD5 A;  1S1Y A;  1G28 A;  3UPP A;  4PAU A;  3H82 A;  1TVF A;  3MKF A;  3HJK A;  1CEF A;  3E4P A;  1ESU A;  4ZTK A;  2W3D A;  4I3A A;  3HJI A;  4S2K A;  1MKI A;  3HLC A;  1BLH A;  5AQ7 A;  2QMI A;  2VV8 A;  3KSH A;  4Y7P A;  1FSY A;  3NHQ A;  2HDU A;  3S4X A;  4P6Z M;  4O0P A;  2WKQ A;  2DRW A;  3PBQ A;  2M1C A;  1ZKJ A;  3R4K A;  2WGV A;  3ZG0 A;  1J9M A;  2R9X A;  3IBR A;  2QSH A;  2Y2K A;  2QZ6 A;  4P6Z S;  2Z2M B;  2OAP 1;  1LL9 A;  1ES4 A;  2FFF B;  2Y4A A;  2VA0 A;  1BYW A;  3IXH A;  3Q7Z A;  2QSF A;  4K0W A;  3T1X A;  2JKG A;  2PAV P;  4ZDX A;  3ULF A;  2ZQA A;  5FAO A;  3A3I A;  2ZOI A;  5DKK A;  1D06 A;  4IVK A;  1K55 C;  3E4O A;  5EFW A;  4R6L A;  3BEC A;  4PMA A;  3G6O A;  3F1O A;  1E25 A;  2HZ5 A;  2V1A A;  1GKU B;  1S67 L;  3CPT B;  4S2P A;  1ZHH B;  3ZG5 A;  1Q2P A;  2QYB A;  1WQK A;  5I5L A;  2O99 A;  5HFO A;  5HWT A;  1K6S A;  3QNB A;  3VE3 A;  4E3L A;  1CJF A;  3FYZ A;  5J4E A;  3HLW A;  4GB7 A;  1BDS A;  2PD7 A;  1NWZ A;  2DCF A;  2ZBB A;  1YLW A;  4WZ5 A;  1T19 A;  4HQA A;  2EX2 A;  2MUB A;  3A3J A;  4KUO A;  4KEN B;  3HCY A;  3EGX C;  3R7W A;  4BMW A;  5HAI A;  1Z6F A;  2EFX A;  4I39 A;  3IF4 A;  3RXW A;  1IKI A;  4EEU A;  3LID A;  1XJ2 A;  3ZVW A;  2HP5 A;  2G2U A;  3EGD C;  1QME A;  1I5Q A;  4GLQ A;  4HEF A;  4YWZ A;  1E3U D;  3GTC A;  1XFN A;  2D01 A;  1N9L A;  1NYM A;  5M19 A;  2GDN A;  2I9V A;  3MFX A;  4Q8I A;  3CPT A;  1BZA A;  3BYD A;  1V9Z A;  5DTS A;  3LI8 A;  5IS1 A;  3A0S A;  5CHJ A;  3IWI A;  4KG6 A;  1FIL A;  4C6Y A;  4Q0H A;  3VP3 A;  3VP4 A;  4R3A A;  1EL6 A;  2L1M A;  4IJG A;  3MR0 A;  2VEA A;  2WKE A;  4WM9 A;  5DJT A;  2RL3 A;  3IWQ A;  2XLN A;  4DRT A;  3N8S A;  4S2J A;  1K54 C;  2P9V B;  1TDL A;  2Y2Q A;  4GW9 A;  3PBS A;  3MZE A;  4KZ9 A;  3HUO A;  4GD8 A;  1VB6 A;  3NC8 A;  1CF0 A;  2P04 A;  4QY5 A;  1VET B;  5G18 A;  3RXX A;  3C5A A;  5CTM A;  4PM8 A;  4KZ3 A;  3T4K A;  4L0L A;  5HSQ A;  3V39 A;  3T4O A;  4GOG A;  5LBR A;  4DXC A;  1YM1 A;  2XRN A;  3E2L A;  3KYZ A;  1KVM A;  3UE3 A;  5TFQ A;  1N9N A;  2P74 A;  2FZ0 A;  1T1A A;  3B42 A;  3EEH A;  4OPY A;  4IUK A;  3FKV A;  4XXR A;  5AQB A;  4N92 A;  4R4R A;  2XK1 A;  4BWI A;  4LRX C;  2Y55 A;  3V50 A;  3DAV A;  3MXR A;  2OOL A;  1M6K A;  1L3L A;  4E3J A;  1PRQ A;  4MN7 A;  4XT2 B;  2H10 A;  5C5K A;  3MZF A;  4AFI A;  2P9V A;  2L0W A;  3IF6 B;  2W0N A;  2LB9 A;  1PNE A;  4ARZ B;  1XPB A;  3ITB A;  3F1P B;  1OTE A;  1VET A;  4MLL A;  1KGE A;  1DY6 A;  3CIT A;  2JHE A;  4R3B A;  5DF7 A;  4FH2 A;  1J3W A;  2KLI A;  1NLY A;  2WUQ A;  4S2L A;  5G4Y A;  3BY9 A;  3HLG A;  3O87 A;  5GLC A;  3CUE C;  3VOY A;  1WE4 A;  4MEZ A;  2XD1 A;  1BLS A;  1XX2 A;  2HP9 A;  1FQG A;  2G2W A;  2O9C A;  2OWJ A;  3KO6 A;  3NIA A;  3M6H A;  3NI9 A;  3F1N B;  3P09 A;  5FQM A;  3P01 A;  5HDS A;  3MBZ A;  4IBR A;  3IHB A;  3EQV A;  5E2F A;  1G68 A;  5M1A A;  4ARZ A;  3F1P A;  3CLO A;  1H8Z A;  2K2N A;  2I72 A;  2PU4 A;  1RGZ A;  4Y3I A;  4NKP A;  3FV7 A;  5HL1 A;  3QP2 A;  2P08 A;  3IF6 C;  1GHM A;  4A5R A;  1Y4O A;  1XJ3 A;  5HDD A;  3IX8 A;  2PHY A;  5L10 A;  3WS2 A;  3UO9 A;  5CEC A;  1XJ4 A;  4O8G A;  4DJ2 A;  4R70 A;  1VEU B;  2A2L A;  3S22 A;  1W63 M;  4FUW A;  1CI8 A;  4LCL A;  4KZA A;  3WS0 A;  2UV0 E;  4ID4 A;  4NXB A;  5DVA A;  2XXL A;  3BY8 A;  4X56 A;  3W4O A;  1DJC A;  2V8F A;  4UA7 A;  4ME4 A;  1ERO A;  1K4F A;  4KZ7 A;  2WK0 A;  3UY6 A;  2IKE A;  1DRM A;  4Y5F A;  1KE4 A;  5EVE A;  1IFQ A;  3C2W A;  3LCE A;  3HLF A;  4Y2F A;  2ZM0 A;  4ESP A;  2EX8 A;  3PAG A;  4WLA A;  3M2K A;  2VGL M;  5K5B A;  1NRJ A;  4EBP A;  4ETX A;  2EWW A;  3GR2 A;  5A8B A;  4QPR A;  2VGJ A;  4EER A;  4HP4 A;  1ZLH B;  2J3T D;  4QY6 A;  1YSP A;  4CLC E;  4FOF A;  4CQH A;  2VGL S;  1JTD A;  2O9B A;  3MXQ A;  2J80 A;  2XFT A;  1MWU A;  4EU0 A;  5IT5 A;  3MXS A;  5HL6 A;  3DTM A;  1SHI A;  4MN6 A;  3VFF A;  3LGO A;  5TGF A;  5F1G A;  1MBL A;  3T12 B;  5AVF A;  3NOU C;  4UHU A;  3CI6 A;  3FG8 A;  3C7V A;  4KG2 A;  5DKL A;  1L0E A;  4E04 A;  5FI7 A;  1P0Z A;  5EVI B;  4BEN A;  3CZD A;  2X01 A;  1CEG A;  3Q7V B;  4D60 A;  3BM6 A;  4N1X A;  3BFD A;  1FR1 A;  4M3K A;  1LLB A;  1KOU A;  3NY4 A;  5F83 A;  4L9G A;  3G2Y A;  5TBM B;  4BL2 A;  1ZUF A;  3HRE A;  4NXF A;  2W1R A;  4X25 A;  1O07 A;  3B3X A;  1DJB A;  2HDS A;  5EUA A;  2B9K A;  3WRT A;  2JN7 A;  4YFM A;  4YOF A;  1ZUE A;  3K2N A;  5DFY A;  2PYP A;  1WXN A;  4E6W A;  4HES A;  5M18 A;  3PBN A;  2W3F A;  3C8C A;  2ZD8 A;  2WAD A;  5EVI A;  4LRZ E;  4EQI A;  3IXB A;  3C4P A;  3PAE A;  3GVB A;  2GJ3 A;  3DTK A;  1SKF A;  2OV5 A;  3B47 A;  1U60 A;  4OQH A;  3LR0 A;  5EPH A;  4I38 A;  1SHV A;  2KX6 A;  1N9O A;  2WGI A;  3PHY A;  1ODV A;  3V67 A;  2JKT M;  4DE2 A;  1OTI A;  3N6I A;  2ZOH A;  3PXP A;  3Q81 A;  3TSG A;  2K7S A;  2VV6 A;  3G34 A;  2R9W A;  3RH8 B;  1SZV A;  2O0Y A;  1HD8 A;  3UMD A;  3A3F A;  1P9W A;  4LV0 A;  2J3W A;  4CLC C;  3LR5 A;  5EV0 A;  5FQ9 A;  3EEA A;  1SDE A;  2QHK A;  3HLE A;  3A0V A;  3FPW A;  5HD5 A;  3UB9 A;  3V5M A;  1PW8 A;  4NEE D;  2QSG A;  4F3L A;  1E3U A;  1STZ A;  2WYX A;  2M7V A;  3T1S A;  5E2G A;  2M7U A;  2J7V A;  4XUX A;  1HLU P;  3ZG7 B;  3MF0 A;  4DXB A;  1XKZ A;  2V8C A;  4IUH A;  4KQO A;  4D2O A;  3ZFZ A;  2PBY A;  4G3K A;  2Z6C A;  4JF5 A;  4OKP A;  1IYP A;  1S66 L;  4IHQ A;  1ACF A;  1TEM A;  4NET A;  4B4X A;  4JKT A;  1IYQ A;  5I94 A;  4LV3 A;  4R23 A;  3WRZ A;  4PHT A;  4WN5 A;  2ZC5 B;  3HUM A;  1VQQ A;  2PT7 A;  3K3D A;  3PBR A;  2EXA A;  3SH7 A;  3H9W A;  4II7 A;  3V3S A;  1P9R A;  5EVI D;  2EX9 A;  3GMW A;  4HY8 A;  1UGU A;  4JXG A;  2QPN A;  3T1Q B;  1W79 A;  1NZO A;  4ZAM A;  4JF6 A;  3KSF A;  4B88 A;  4KG5 A;  1Y28 A;  2BG1 A;  1IKG A;  2QJ5 A;  3FC7 A;  4OPQ A;  3CJM A;  3ZNT A;  3MZD A;  2P7J A;  3S7Q A;  3Q1F A;  4EET B;  2OLU A;  3M2J A;  3NDG A;  4Z9Q A;  3UN7 A;  2UWX A;  5AQ9 A;  3K3C A;  4I5S A;  1XA1 A;  1YLZ A;  3T4T A;  4HH3 A;  3OPL A;  5CTN A;  1WYB A;  1S4R A;  1D7E A;  5DF8 A;  5L2F A;  2NUP C;  3FWL A;  3VP2 A;  5F1F A;  3HLD A;  4ETZ A;  3G30 A;  1DP8 A;  2Y2L A;  5U47 A;  2JKT I;  2YKF A;  2VX8 A;  2V1B A;  5GHX A;  5CEB A;  4ZJ3 A;  3TOI A;  1SKO B;  4KQD A;  2Y2M A;  1NY0 A;  2ZJ9 A;  1I2W A;  3P7N A;  2B95 A;  4P87 A;  4C75 A;  5A93 A;  1KGG A;  2FH5 A;  4WZ5 C;  2W1T B;  2V1Z A;  4RX2 A;  3HUN A;  5EOO A;  2GZA A;  3I7J A;  3T4Q A;  2Y2H A;  4GS9 B;  2L4R A;  5GLD A;  5IHV A;  2H5S A;  2HP6 A;  5FEG A;  1K54 A;  3C7U A;  5HW3 A;  4JPM A;  5CER A;  3JVV A;  3OCN A;  3TJZ C;  4HIA A;  1WYC A;  5FI2 A;  4EEP A;  1GHP A;  4QJG A;  5FAS A;  2KDK A;  4P6B A;  3NUL A;  2EA9 A;  4HHD A;  1KDS A;  1SKO A;  5FAT A;  5FDH A;  3UDF A;  1JWV A;  5GHY A;  2WKR A;  4MN5 A;  3QP1 A;  2Y8H A;  2XF3 A;  1YT4 A;  3VOZ A;  3OC2 A;  1Z09 A;  4OH0 A;  1PWC A;  4ZBE A;  4KQQ A;  4EV4 A;  1W8Y A;  4GHI B;  5FA7 A;  4E3M A;  4RVA A;  2FFY A;  4LGW A;  2ZQ7 A;  2Y2N A;  5D3O A;  1YQS A;  1H8Y A;  1S0W A;  1KVL A;  3N8L A;  4O7D A;  2KOI A;  2JKR M;  1PZO A;  4I3I A;  1MPL A;  2Y79 A;  2XRO A;  5DTK A;  3IH9 A;  2WKP A;  1IEM A;  3TE8 A;  1TD5 A;  4DKI A;  4MBK A;  5HPF A;  3DWZ A;  3H7W B;  3S7N A;  4X53 A;  2PDR A;  1JVJ A;  5CGX A;  4UAA A;  3TW8 A;  4NXG A;  3S1Y A;  2XR0 A;  4R1G A;  3UDX A;  3CUE A;  2W3E A;  1WA9 A;  1OME A;  1KGF A;  2H0T A;  3UE1 A;  4S2N C;  2PR6 A;  4CJN A;  3C38 A;  3ZDJ A;  1DP9 A;  5HWW A;  2Z6D A;  1SH1 A;  1RCJ A;  2DMW A;  1H5O A;  1BLP A;  4I3J A;  4K91 A;  4FTX A;  1OJ5 A;  3VP1 A;  4WEL A;  3ZNY A;  3LY3 A;  1PIO A;  3BRM A;  2Y2G A;  4HOI A;  3UDI A;  3BWL A;  1F9I A;  1PWG A;  4ZRR A;  1LI9 A;  4XT2 A;  2J9P A;  3LIA A;  3GSG A;  3IF6 A;  3VV4 A;  4ZJ2 A;  5CXW A;  2HGV A;  5HWV A;  1GSV A;  5FSR A;  1ZLI B;  1UWN X;  1EI5 A;  5F82 A;  1DP6 A;  2OLV A;  3QP6 A;  2BLS A;  3NCK A;  4E6X A;  4X6T A;  4B9O A;  2HV1 A;  2JR3 A;  2ZC3 B;  3KSG A;  2YKH A;  4BJP A;  1K57 C;  2HDQ A;  3NJA A;  5GHZ A;  3ZHH A;  3DBA A;  3L7H A;  4LCM A;  3T50 A;  3FKW A;  1MZU A;  4HBU A;  3O5Y A;  5KZH A;  4RX3 A;  3HL9 A;  2Y59 A;  1TS8 A;  4GKU A;  4OOM A;  1QMF A;  3F1N A;  4OVD A;  4JBF A;  1FCN A;  4EW7 A;  4K0X A;  3IX3 A;  4WL9 A;  3IS2 B;  2EWV A;  3UE0 A;  5DJU A;  4H6J B;  3VFH A;  4WBG A;  3SZT A;  3ZCZ A;  4BD0 A;  1OPX A;  2ZC4 B;  2JCH A;  1Q2Q A;  5GLB A;  3SOI A;  2IWD A;  2WZZ A;  1OT6 A;  1S4S A;  3HBR A;  3RJU A;  3DTI A;  1F2K A;  5FQJ A;  4PKY A;  2HJ9 C;  3ZYT A;  5HAQ A;  3BFC A;  2XSS A;  3UPN A;  4YNR A;  1F5M A;  3G4P A;  4S2M A;  3OPP A;  1G5U A;  1VEU A;  1P97 A;  3OBF A;  2ZQ9 A;  3V3R A;  5L8M A;  3IF5 A;  1JTG A;  4KQR A;  4PM9 A;  1PYY A;  4NG2 A;  4HH2 A;  5A90 A;  4KZ4 A;  4G3W A;  4MNR A;  3QP4 A;  5A92 A;  3MQQ A;  2H0Y A;  4LPZ A;  2ZQC A;  4H6J A;  1OTA A;  2IKD A;  5E2E A;  1AWI A;  2ZLY A;  4GD6 A;  1E4D A;  1W5D A;  1K38 A;  1NXY A;  3P98 A;  2IWB A;  3SW1 A;  1YMS A;  2BAS A;  4S2O A;  4DN0 A;  2XDM A;  4EBN A;  4KZ5 A;  3G32 A;  1X0O A;  4C3Q A;  5TJJ A;  3N8R A;  3ZQ5 A;  5DF9 A;  1DJA A;  3O86 A;  1TS7 A;  4Y15 A;  4Z1W A;  4BBU A;  4QHC A; 
#chains in the Genus database with same CATH homology
 4CLC B;  1S66 L;  1LT0 A;  4HJ6 A;  4IHQ A;  3LMS B;  4R3A A;  2JTO A;  2L1M A;  2PYR A;  3LR4 A;  1LSV A;  2O9A A;  4IJG A;  3MMH A;  3MR0 A;  2VEA A;  1LSW A;  5DJT A;  4JGQ A;  4NXE A;  3BJN A;  4PHT A;  3NOT C;  3IBJ A;  1UWP X;  4WN5 A;  3PR6 A;  4Q0J A;  2PT7 A;  3K3D A;  3PBR A;  4GW9 A;  3PBS A;  4FSF A;  3H9W A;  4II7 A;  4PKY G;  2HJE A;  1P9R A;  4EXO A;  1VB6 A;  3S7O A;  4HY8 A;  2K2X A;  1UGU A;  2P04 A;  1H8M A;  4BBV A;  3T4K A;  3KSF A;  4L0L A;  5HSQ A;  4UEY A;  3T4O A;  1Y28 A;  5LBR A;  2QJ5 A;  3FC7 A;  2XRN A;  3LUQ A;  3KYZ A;  1VHM A;  4WUJ A;  3UE3 A;  1N9N A;  3MJQ A;  2FZ0 A;  1T1A A;  4DMZ A;  3E4Q A;  3LYX A;  3B42 A;  3EEH A;  2P7J A;  4IUK A;  3S7Q A;  5TBM A;  1OTD A;  3T4J A;  4EET B;  2V9A A;  3W2Z A;  2SH1 A;  5KSH A;  2R78 A;  3UB7 A;  3K3C A;  4BWI A;  4LRX C;  4I5S A;  3LR3 A;  3T4T A;  3NOP C;  2OOL A;  4HH3 A;  2ZMV A;  2JKR I;  4MN7 A;  4XT2 B;  1S4R A;  1GSW A;  5C5K A;  1D7E A;  2DLA A;  4AFI A;  2ZMF A;  4HNB A;  2NUP C;  5J3W A;  2L0W A;  2LB5 A;  2W0N A;  2LB9 A;  2VV7 A;  3UE6 A;  1YKD A;  4ARZ B;  4ETZ A;  1DP8 A;  3F1P B;  2CMN A;  3UB8 A;  4K08 A;  4HP9 A;  2JKT I;  2YKF A;  2VX8 A;  1OTE A;  4MCW A;  3LI9 A;  2V1B A;  1H3Q A;  3CIT A;  2JHE A;  3S7P A;  3IS2 A;  3LIB A;  5F69 A;  4KQD A;  4WEJ A;  4BBT A;  4YIR A;  2KLI A;  3C30 A;  1NLY A;  3TRC A;  1LSX A;  5G4Y A;  3EWK A;  3P7N A;  3BY9 A;  4L9F A;  3PBT A;  1YAX A;  3CUE C;  2FH5 A;  2GX5 A;  3PYP A;  2W3G A;  3MYV A;  2W1T B;  2B02 A;  1TS0 A;  5G4Z A;  5KIZ A;  2O9C A;  2OWJ A;  3T4Q A;  2GZA A;  3KO6 A;  4GS9 B;  2L4R A;  3F1N B;  3B33 A;  3P01 A;  2OAQ 1;  5HDS A;  3GDI A;  2H28 A;  5CX7 A;  3EQV A;  4G3V A;  5F68 A;  1T1C A;  3JVV A;  3OCN A;  3TJZ C;  4ARZ A;  4HIA A;  3F1O B;  3F1P A;  3KYQ A;  3CLO A;  4EEP A;  4JGO A;  3BW6 A;  3GEC A;  1GSX A;  2V0W A;  3KSI A;  3LFV A;  2K2N A;  2KDK A;  2W27 A;  2V0U A;  4EUV A;  2VKS A;  2EA9 A;  4Y3I A;  2G7U A;  3UME A;  3EOI A;  4NKP A;  4HHD A;  1OT9 A;  2P08 A;  2WKR A;  4MN5 A;  2Y8H A;  2VZW A;  3LIC A;  1XJ3 A;  5HDD A;  3OC2 A;  2PHY A;  5J7E A;  2GNX A;  1T1B A;  4DJ3 A;  1F98 A;  3R7W B;  4M4X A;  1XJ4 A;  3D3O A;  4O8G A;  4R70 A;  4DJ2 A;  5HZH A;  2A2L A;  1W63 M;  4GHI B;  3OCL A;  2QJ7 A;  2BDS A;  2NUT C;  1V9Y A;  3BQ8 A;  1AHL A;  4KUK A;  4L9E A;  4CLC D;  2W3H A;  4NXB A;  4F3L B;  3H82 B;  4CLC A;  2XXL A;  2KOI A;  5IU1 A;  2JKR M;  3BY8 A;  4I3I A;  2Y79 A;  4EQ1 A;  2XRO A;  1MKM A;  3E98 A;  4ME4 A;  3A0R A;  2WKP A;  4HJ4 A;  3TE8 A;  5AVE A;  2IKE A;  1DRM A;  4Y5F A;  1IOU A;  1ZTU A;  1IFQ A;  1TD5 A;  3C2W A;  2RNG A;  4Y2F A;  2VJW A;  5AJG A;  4WLA A;  2VGL M;  5HPF A;  5K5B A;  3H7W B;  3S7N A;  3RTY A;  1NRJ A;  2PDR A;  4UQI M;  4ETX A;  2EWW A;  3MQ0 A;  3TW8 A;  5A8B A;  4NXG A;  4QPR A;  2MN3 A;  2IA2 A;  4EER A;  4HP4 A;  3ICY A;  1ZLH B;  2J3T D;  1YSP A;  4CLC E;  1W63 Q;  3CUE A;  4FOF A;  4CQH A;  1XFQ A;  2VGL S;  4Q0I A;  2O9B A;  1WA9 A;  2W3E A;  2HF6 A;  3MXQ A;  1Z99 A;  2J80 A;  4WF0 A;  4UQI S;  5HD3 A;  4EU0 A;  5IT5 A;  4B93 A;  5HL6 A;  2MJ6 A;  3T4S A;  4HI4 A;  3RFB A;  4WEK A;  2PR6 A;  1SHI A;  3C38 A;  4MN6 A;  1OTB A;  3CWF A;  1APF A;  1DP9 A;  5HWW A;  2Z6D A;  5DFX A;  4JGR A;  1SH1 A;  3UB6 A;  5HPI A;  1YSQ A;  3D4U B;  1S1Y A;  2DMW A;  1H5O A;  2B18 A;  1G28 A;  4PAU A;  4I3J A;  5AVF A;  3H82 A;  3NOU C;  2XA7 M;  1OJ5 A;  3HJK A;  4WEL A;  5FL3 A;  3CI6 A;  3E4P A;  3FG8 A;  2W3D A;  5DKL A;  5HDC A;  4I3A A;  3HJI A;  4E04 A;  4HOI A;  2VLG A;  1P0Z A;  3BWL A;  1F9I A;  4O01 A;  4ZRR A;  2VV8 A;  4XT2 A;  2XA7 S;  3LIA A;  3KSH A;  3D72 A;  4LRY C;  3NHQ A;  3VV4 A;  4JGP A;  4P6Z M;  4R38 A;  2HGV A;  5HWV A;  1KOU A;  4O0P A;  2WKQ A;  1GSV A;  1ZLI B;  1UWN X;  3PBQ A;  5F6A A;  2M1C A;  4HJ3 A;  4L9G A;  1OJG A;  3EQU A;  1DP6 A;  2A24 B;  3R4K A;  5TBM B;  4B9O A;  2HV1 A;  1ZUF A;  3IBR A;  2QSH A;  2JR3 A;  4P6Z S;  3KSG A;  4NXF A;  2W1R A;  2YKH A;  2INW A;  4GV5 A;  4BJP A;  3NJA A;  1XJ6 A;  2OAP 1;  3VOL A;  2PD8 A;  2B9K A;  2JN7 A;  3DBA A;  4YOF A;  1ZUE A;  1S1Z A;  3T50 A;  2VA0 A;  1BYW A;  1MZU A;  3K2N A;  3LIE A;  3O5Y A;  5DFY A;  2W1T A;  2QSF A;  2PYP A;  1WXN A;  3ULF A;  1TS8 A;  2OWH A;  3CAX A;  2W3F A;  3PBN A;  3C8C A;  4GS9 A;  4OOM A;  2ZOI A;  5DKK A;  3F1N A;  1D06 A;  4GCZ A;  4LRZ E;  4EW7 A;  3E4O A;  5EFW A;  2GJ3 A;  4WL9 A;  3IS2 B;  4R6L A;  2EWV A;  5DJU A;  3B47 A;  4H6J B;  3MQO A;  3LR0 A;  3G6O A;  1TF1 A;  4I38 A;  3F1O A;  1OPX A;  2KX6 A;  1N9O A;  3PHY A;  2V1A A;  2K31 A;  3LIF A;  1ODV A;  2A24 A;  2JKT M;  1S67 L;  3V67 A;  5MC7 A;  1LL8 A;  1ZHH B;  2PR5 A;  1OTI A;  1NLZ A;  1OT6 A;  1WQK A;  2QYB A;  2ZOH A;  1S4S A;  1G6O A;  2O99 A;  3PXP A;  5I5L A;  5HWT A;  4MDZ A;  3U2A A;  3VE3 A;  5J4E A;  4PKY A;  2K7S A;  1JNU A;  2VV6 A;  1BDS A;  2PD7 A;  2HJ9 C;  3KEZ A;  1NWZ A;  3RH8 B;  3ZYT A;  2ZBB A;  3MCX A;  1T19 A;  1TS6 A;  4HQA A;  3E0Y A;  2XSS A;  2O0Y A;  3KX0 X;  2MUB A;  4KUO A;  4YNR A;  3UMD A;  1MC0 A;  1P9W A;  2J3W A;  3HCY A;  1F5M A;  3EGX C;  3R7W A;  4BMW A;  4I39 A;  4CLC C;  3LR5 A;  3FPV A;  1P97 A;  2QHK A;  3EEA A;  3OBF A;  3A0V A;  3PBO A;  4GHI A;  4RQ9 A;  3FPW A;  3T4L A;  5HD5 A;  4EEU A;  5F5Y A;  3LID A;  4LLO B;  3JVU A;  5L8M A;  3UB9 A;  2QKP A;  1XJ2 A;  1D6B A;  3EGD C;  2D02 A;  4NEE D;  4GLQ A;  4YWZ A;  2QSG A;  4F3L A;  1B8W A;  4HH2 A;  1STZ A;  1XFN A;  4G3W A;  2D01 A;  1N9L A;  2M7V A;  3MQQ A;  4LPZ A;  3VE4 A;  4H6J A;  1T18 A;  1OTA A;  2M7U A;  2IKD A;  2I9V A;  3SW1 A;  2BAS A;  4DN0 A;  3MFX A;  3OOV A;  3H7W A;  2H9X A;  2J3T C;  3MF0 A;  4EES A;  1X0O A;  1V9Z A;  4IUH A;  4KQO A;  3LI8 A;  5TJJ A;  5IS1 A;  3ZQ5 A;  5DF9 A;  3A0S A;  3BQA A;  4MMN A;  3OLO A;  1EW0 A;  1TS7 A;  1ATX A;  4G3K A;  4GJ4 A;  4Q0H A;  2QWS A;  2Z6C A;  4Z1W A;  4BBU A;  4OOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...