1ZHHB

Crystal structure of the apo form of vibrio harveyi luxp complexed with the periplasmic domain of luxq
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
221
structure length
208
Chain Sequence
RTKQQTSALIHNIFDSHFAAIQIHHDSNSKSEVIRDFYTDRDTDVLNFFFLSIDQSDPSHTPEFRFLTDHKGIIWDDGNAHFYGVNDLILDSLANRVSFSNNWYYINVMTSIGSRHMLVRRVPILDPSTGEVLGFSFNAVVLDNNFALMEKLKSESNVDNVVLVANSVPLANSLIGDEPYNVADVLVIETPIVVNAVTTELCLLTVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autoinducer 2-binding periplasmic protein luxP
publication title Regulation of LuxPQ Receptor Activity by the Quorum-Sensing Signal Autoinducer-2.
pubmed doi rcsb
source organism Vibrio harveyi
molecule tags Signaling protein
total genus 64
structure length 208
sequence length 221
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09308 LuxQ-periplasm LuxQ, periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.20.100 Mainly Beta Single Sheet Anthopleurin-A Anthopleurin-A 1zhhB02
3.30.450.220 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1zhhB01
2HJEA 3C30A 1ZHHB 3C38A 2HJ9C
chains in the Genus database with same CATH superfamily
5HW3A 3QNBA 3T4JA 3ZVTA 3CWFA 4OKPA 3UB7A 4ZRRA 4QPRA 4LLOB 1K38A 1K25A 3UMEA 2VGJA 1H5XA 3S22A 3QHYA 5GLCA 5FEGA 1XX2A 3A3JA 4HY8A 5DJUA 1ESUA 3T4KA 3C2WA 3QP4A 4UEYA 3T4QA 5DVAA 1SKOA 1UWPX 3TG9A 3WWXA 3HCYA 4CLCA 2XFTA 1TS7A 5GHZA 3ITBA 3JPUA 2JCHA 3S7PA 2P74A 2PYPA 2ZD8A 2P9VB 4IJGA 5EUAA 2PU4A 1XGIA 3OZHA 3DAVA 1K54C 4QY5A 4DE2A 1PW8A 2Y2JA 1ES5A 3TE8A 2KX6A 3P7NA 3GSGA 3LEZA 4WL9A 1S1YA 2V0UA 3MFDA 4FD8A 3ZCZA 3WS2A 1EROA 1ACFA 4GKUA 3LR4A 5FL3A 3ZG8B 1LSVA 5HZHA 4E3NA 4I39A 4LRXC 1VHMA 3A0VA 2GX5A 4Q0HA 4EV4A 4L9EA 1DJBA 3HJIA 1KDWA 2JBFA 3PAGA 2WGWA 1RGZA 4OLDA 2R9XA 3IX4A 3MJQA 4GW9A 4MN6A 3MKEA 5L8MA 1LL5A 4ZJ3A 3FWLA 4Z9QA 5CEBA 5AVFA 5CGXA 3V5MA 1BYWA 1W63M 3LFVA 1TD5A 3C30A 3HUNA 2KDKA 1P9RA 4H8RA 4GLQA 1K56D 5DJTA 3LEQA 3LR3A 2PHYA 5F68A 5GHXA 3T1SA 3MQQA 4WLAA 5HWVA 3Q82A 4DJ2A 1ZG6A 1BTLA 2V1BA 2OV5A 5EV0A 3VE4A 4ARZB 2Z2LB 1BLHA 4N1XA 3DW0A 2SH1A 1YSQA 3BLMA 1LHYA 2D02A 4ZDXA 1GHMA 1I2WA 3R7WA 3K3CA 4LRYC 4E6WA 4UA6A 4KG2A 5GL9A 3C8CA 3KX0X 4N9KA 2WGIA 3TRCA 4UA7A 4LV1A 2JKTI 4DXCA 4JXGA 1YMSA 5FAQA 3C5AA 5TBMB 4OOLA 1DP9A 1FSWA 2WUQA 2FFFB 5J3WA 1BLSA 3T4SA 2EXBA 1TS6A 2UV0E 2V0WA 2ZM2A 3NC8A 2OAP1 5K5BA 2Z2MB 2P08A 2XSSA 3CUEC 5EVIB 5CTNA 3H7WB 2ZMAA 1QMFA 3QP5A 1NLYA 2X71A 1OMEA 3V67A 1EL6A 2BASA 1S4RA 3BWLA 3SZTA 2Y55A 3KSHA 1HD8A 1NZUA 4ZAMA 4EW7A 4LENA 2A24B 1H0MA 4R4SA 1CEFA 1EI5A 4R70A 5D3OA 3GMWA 3D4UB 5F1GA 1UGUA 1MWTA 3T12B 2XGNA 1NWZA 5CRFA 3N4IA 2V8FA 2Y2IA 3CZDA 3WS1A 4KZ6A 2X02A 5AQ9A 5HSQA 1PI5A 2ZOHA 1G6OA 5FI6A 4OOMA 3LR5A 3QP2A 3G6OA 3M2JA 3A3FA 3IXDA 1LSXA 5M1AA 2FZ0A 4ZJ2A 3QP8A 1NRJA 3S7QA 4FOFA 2VV7A 4N92A 5FQMA 3UNWA 2ZM8A 3JVUA 4P85A 5FQ9A 4MN5A 2EX9A 4PM9A 5DFYA 3LMSB 4QB8A 2VGLS 2Y79A 4I3IA 1ODVA 4MDZA 3KO6A 5HDDA 1K54A 2ZC6B 3EEAA 5E2FA 2HV1A 4GDNA 1LSWA 5FSRA 1VEUA 5HDCA 1GA9A 3DBAA 4OP8A 1M6KA 4OLGA 2PR6A 2EWVA 1YM1A 4IEDA 4LCMA 3MZDA 1TS0A 4X1LA 3S1YA 5FASA 1RCJA 3FKVA 5F69A 5G4YA 1LI9A 3CLOA 2PBDP 3GQZA 4QU3A 4BWIA 1IYQA 3VSKA 4C3QA 5M19A 3UMDA 2A2LA 4DJ3A 1GSVA 3T4TA 3W2ZA 4JGPA 2OOLA 3IBRA 4JF6A 2WKRA 5AQ7A 3HLWA 1MPLA 3G35A 4P87A 3GV9A 3IXBA 3VE3A 4WMCA 4X1MA 4G3VA 1QMEA 3DTKA 4DE3A 1JVJA 3IXHA 4NK3A 1B8WA 5KSCA 4BL3A 3OC2A 4EEPA 5J4EA 2M7VA 3N7WA 4YIRA 2WGWB 5L10A 5CTMA 2Z6DA 3HLGA 2VGLM 2QSFA 5EFWA 4X25A 5I5LA 4R3JA 4BENA 3OPPA 4ME4A 3MXQA 2WKQA 1W8QA 2Q0OA 3Q81A 4CLCC 1KE3A 1T18A 2RCXA 1G28A 3HREA 2EWWA 2P04A 3IX8A 3VOZA 1XA7A 3E0YA 4MBFA 3F1PB 2PT7A 4FUWA 4FCFA 5EVEA 5EM1A 3HL9A 2Z6CA 4NXFA 2QZ6A 4OPYA 3UB5P 5CHMA 1ERMA 2DLAA 4PKYG 3LICA 1BZAA 3UN7A 2VX8A 2MN3A 4MBHA 1G5UA 3CUEA 1BUEA 5CEDA 1J3WA 3BLSA 3ISGA 1PFLA 5FQJA 1GL9B 2HDSA 4QJGA 4UAAA 1GSXA 2HPBA 3IHBA 3WRTA 2OSUA 3FPWA 4CLCD 4X69A 5DTSA 2JHEA 1PNEA 3KYQA 4K0WA 2HP9A 2J8YA 1G68A 4K91A 4RQ9A 5TGFA 1OTIA 3T1XA 3IF6C 2DMWA 5M18A 2W3HA 5HPFA 5JYOA 3IQAA 3P09A 3CG5A 5GLDA 2VV6A 1ES3A 3MZFA 4JGOA 4JF5A 3ZQ5A 3A0RA 4YFMA 4GNUA 2ZC7A 2IWCA 4U0TA 4FH2A 1KOUA 4GDBA 3PBSA 2K2XA 4UHUA 3PHYA 2ZQ8A 1E4DA 1O7EA 5EOEA 1KVLA 2GJ3A 5HX9A 2ZL1B 4D2OA 4HI4A 4II7A 1IYOA 3CJMA 4DDSA 1N9OA 2J7VA 2JR3A 5CGWA 2WAFA 4MN7A 2R78A 1F5MA 3G2YA 3MS6A 4JKTA 2OLVA 3EQVA 1Q2PA 4EQIA 4X6TA 1E3UA 5DF8A 1T1AA 1W5DA 3GTCA 2ZC3B 3OOVA 1FR1A 5CERA 4B4XA 2PAVP 3PYPA 2HDQA 4MLLA 3EGDC 1ALQA 4GV5A 1MXOA 3G31A 3E4OA 2O9BA 3HLDA 4M4XA 5EE8A 3NY4A 4HESA 4S2MA 4JXSA 2ACGA 1H8MA 4N9LA 2ZQDA 3FZCA 4XUZA 4XT2A 4HNBA 3RFBA 1D06A 1VEUB 3A0SA 1ONHA 4OPRA 2J9OA 2WAEA 4R3BA 3RTYA 4U0XA 1Y28A 2VZWA 1MWUA 3VSLA 1NY0A 2PBYA 4HIAA 2MJ6A 2G7UA 1SCWA 3GRJA 3AGFA 1FOFA 5IU1A 4KUKA 3PBRA 2QWSA 1OTBA 2IKEA 2Y2QA 3B3XA 4MMNA 4O7DA 4JBFA 1MBLA 4GZBA 3C7VA 3FKWA 2ZMVA 1SH1A 4GS9A 3CMZA 4OONA 2VEAA 4OQHA 4KZ9A 1BLCA 4KG6A 2L4RA 4MBKA 2R9WA 2V2FF 3FYZA 3F1NB 3G34A 1OTEA 4D60A 2JKRI 4GHIA 4FTXA 1A0KA 5A91A 4BBTA 3C4PA 5L2FA 5DF7A 4E04A 2B02A 2PRFA 3LGOA 3ULFA 4L0LA 3HLEA 2XFSA 4G3KA 1ZLIB 3IX3A 1XJ4A 3DWZA 4IVKA 2H9XA 3NCKA 2RL3A 1DP6A 3A3DA 2OLUA 3V3SA 3MYVA 2V9AA 5CXWA 1KVMA 1ZHHB 4EBNA 2Y4AA 3Q07A 2Y2NA 2NUTC 4R38A 1YLWA 2M7UA 4EXOA 2XDMA 2ZM0A 1HLUP 3NDEA 4HP9A 3LIBA 2EFXA 4WF0A 5AVEA 5HL6A 4BJPA 1IOUA 2BLSA 3H82A 4BLMA 3V39A 5EOOA 2QSHA 1L2SA 3TJZC 1FR6A 3IF6A 2WKIA 3LUQA 4I38A 3UPOA 1GHPA 1LL9A 2HP5A 3CITA 1NYYA 3IWOA 3FV7A 3DTIA 4E3OA 1XGJA 5A8BA 2WZXA 3GECA 3D4FA 1NLZA 4WBGA 5FDSA 3HBRA 1IFQA 2Y2MA 4E3MA 3Q7ZA 2ZQCA 4YWZA 3SS3A 3NJAA 5HPIA 1YLZA 1H3QA 4B88A 3NOTC 2PR5A 3LI9A 3GR2A 4F3LA 2B5RA 4Y7PA 2VLGA 3QP6A 4S2OA 3HJKA 4LFUA 4DRTA 5C5KA 4KZ3A 4HBTA 4WMCD 3TOIA 3E2KA 2EFUA 3UE1A 5F5YA 4K0XA 1BT5A 3CPTB 1FSYA 2YKHA 4Y0TA 1XKZA 4MNRA 2QPNA 2KOIA 3T50A 3D9YA 4JLFA 5FQQA 1D6BA 4HHDA 3UE6A 3Q7VB 4PM6A 2W1TA 1XJ6A 3BY9A 4OP5A 2PD8A 1PI4A 5FDHA 5AJGA 4HJ3A 4PM8A 5FATA 1DP8A 1CK3A 3BEBA 3ZFZA 2L0WA 4YINA 4LRZE 3UB6A 1S4SA 3O87A 4DE1A 3ICYA 4K08A 1WE4A 1IYPA 4KZAA 3NULA 3FPVA 5EPHA 3G32A 4KG5A 1K0KA 5E2HA 1IKGA 3UE0A 2O0YA 3U2AA 2QSGA 1SHIA 1WYBA 3ZDJA 4OQ0A 4ETZA 3KSIA 2PU2A 3RH8B 2BDSA 3PBOA 4DE0A 1VQQA 2H28A 4PHTA 3HVFA 5DTTA 1KDSA 5HAQA 4WZ4A 5HARA 4O01A 4NXEA 4XT2B 5JYPA 3MKFA 3ITAA 4WELA 3I7JA 4DMZA 3BY8A 2XA7S 1XPBA 5HAIA 4WM9A 3IS2A 4DN0A 2PYRA 1FILA 4R23A 3FC7A 1YMXA 1U60A 1O07A 1BLPA 2JKRM 4E3IA 2JKGA 1YKDA 4NEED 3F1OA 4BQMA 1XFNA 1GCEA 4QWOA 3S7OA 2O9AA 5G18A 3OPRA 3WS5A 1SKOB 4JPMA 4JGRA 4WYYA 2HZ5A 2W1RA 2ZQ9A 2K7SA 3LYXA 2PD7A 1L0DA 4KQRA 2M1CA 1W63Q 3T4LA 2ZBBA 4CLCB 2VGKA 4IHQA 3HUOA 1ZLHB 5J7EA 2YKFA 3SS4A 2QHKA 1K6RA 2V20A 1I2SA 2I9VA 4LV2A 1FCOA 1YLPA 2W3GA 1ERQA 3O3VA 3MMHA 4I3AA 1Z99A 2PDRA 4I3JA 2W0NA 5EM0A 4WEKA 1WXNA 2ZMFA 3E4QA 5FI7A 1E3UD 4KQQA 3W4OA 4EBLA 4LGWA 2J80A 3IBJA 3ZG7B 2XA7M 4PM5A 3QNCA 2V1AA 1ZC2A 1HZOA 2OWHA 4P6ZS 2XRNA 4GCZA 5IS1A 4S2NC 2WADA 5KSHA 3VFFA 1CQAA 1GSWA 3PAEA 1BULA 4HH2A 2C6WB 3UPPA 3H82B 1MKMA 5L09A 3V3RA 2Y2KA 2J3TC 3W4PA 1PWDA 3LY4A 3IF6B 1JTDA 5EVLA 5BOHA 1XA1A 1S66L 1FCMA 1Y54A 4Y2FA 1FCNA 3WRZA 1CJFA 2HP6A 1PRQA 1OT9A 1WQKA 4OQIA 4R6LA 4IUKA 3SH7A 4RVAA 2Y2OA 4IBXA 4NXGA 4EEUA 5F1FA 4F3LB 3PBTA 3R7WB 4OPZA 2DNSA 3BYDA 3P01A 5KIZA 2MUBA 4EESA 3MQOA 2QKPA 4WZ5C 3ZHHA 1MC0A 1DY6A 2XD1A 4KZ8A 5FAOA 3OCLA 1ES2A 2J3WA 3PTEA 1YT4A 4FH4A 2H5SA 2QMIA 3VFHA 3BQ8A 4OVDA 4P6BA 1S1ZA 3E4PA 2OWJA 1TDLA 3DWKA 3K2NA 2W3DA 5FA7A 2ZQAA 2VA0A 3BFDA 2E8IA 1L3LA 1V9ZA 3QP1A 3VP0A 4OOYA 4KUOA 3NDGA 2EA9A 3L7HA 2E8JA 4HEFA 3BFGA 4HOIA 2QJ7A 3O86A 3MBZA 1CI8A 4I5SA 4KENB 3HUMA 1JWVA 3PR6A 1RGYA 1TDGA 1G6AA 4DDYA 1V9YA 5F6AA 4Q8IA 1H5OA 2IKDA 5TBMA 1N9BA 4KZ5A 3VMAA 3G2ZA 5KMWA 2XEPA 2ZJ9A 1MZUA 2BTFP 2D01A 4R1GA 3G30A 5I94A 2WZZA 1WA9A 3BM6A 5EVIA 5KZHA 1YPRA 1JWZA 4Y0UA 2XD5A 1MY8A 3IS2B 2WKHA 1W8YA 3N8LA 1LL8A 2A24A 2A49A 3A3IA 3S7NA 2WK0A 3F1OB 4ZTKA 3VP1A 4JXWA 4JGQA 3UO9A 4UA9A 3NBLA 1ZUFA 3GVBA 3N8SA 1FQGA 2C5WB 2VKSA 3SOIA 1K55C 4NETA 1PIOA 4WN5A 1NRFA 1TF1A 4X55A 3IH9A 1NYMA 1YLYA 5HL1A 1L0FA 3EOIA 5L07A 3HLFA 4EUZA 5TFQA 1PWGA 4JXVA 2VJWA 5U47A 1PYYA 4KZBA 5CX7A 3E98A 1F2KA 3H9WA 4S2NA 4L9GA 4Y5FA 3P98A 4XXRA 2DRWA 1XFQA 3VP2A 4LPZA 4YOFA 4XUXA 2IA2A 2RNGA 3W4QA 2EX2A 4EU0A 1YLJA 4Q0IA 1DJAA 5CHJA 3ZG9B 5HDSA 3IF5A 3M6BA 3AGDA 5EECA 3NOUC 3E2LA 5HAPA 4EWFA 4KQDA 3C4OA 4ZBEA 3K3DA 3NHQA 4OPQA 3IWQA 5FQIA 4GD6A 4M3KA 3NECA 1YQSA 4BL2A 1CI9A 3NOPC 2WKEA 3UB8A 4F94A 1MKIA 4RA7A 1OJ5A 1HVBA 4A5RA 1PWCA 1P97A 4Y17A 1Z09A 1YSPA 5J8XA 4WZ5A 4E3KA 1SZVA 2BG1A 2UWXA 1KE0A 2AVXA 3ZNTA 3LR0A 2XK1A 2XQZA 1N9NA 3KYZA 3O88A 5HWTA 1K6SA 1EW0A 2JN7A 3BJNA 1K57C 5E43A 1JWPA 3B33A 1S6RA 1XJ2A 2ZQ7A 3M2KA 4HJ4A 2JC7A 3UDXA 2Y2GA 4X68A 3MFXA 4HH3A 1ES4A 1LT0A 3MSHA 1JTGA 3SW1A 1AWIA 3G4PA 1PZPA 4ZJ1A 1Q2QA 2HJ9C 4R0QA 1APFA 1KGFA 3T1RA 4IBRA 4RX3A 1H8ZA 1F9IA 3F1PA 5GLBA 3IF4A 1FIKA 4S2JA 1K4FA 4G3WA 4CPKA 3UY6A 4EERA 5TR7A 3LI8A 4HQAA 1BSGA 2LB5A 5DFXA 3RXXA 4Z1WA 3IT9A 3MF0A 5AQAA 2WKPA 5AQBA 3LIAA 2XROA 4E3LA 3CHWP 4AFIA 3DTMA 2J9PA 3C38A 3S4XA 4GD8A 2CMNA 1C3BA 1GHIA 5A92A 2K31A 1M40A 3O5YA 1NJ4A 4S2IA 3W8KA 4Q0JA 3VOYA 3OPLA 2B9KA 1MWSA 4P0MA 2NUPC 3LIFA 1ONGA 1E25A 2WGVA 4CJNA 3PBNA 1OTAA 3UDIA 3ZVWA 2ZLYA 2G2UA 2Y2HA 2H0TA 2ZC4B 4KQOA 3UDFA 2A3UA 4EQ1A 5G4ZA 4JF4A 1K55A 1T1BA 3KSGA 1WYCA 5HWWA 2W27A 1TS8A 3IWIA 3OLOA 4H6JA 5DF9A 2G2WA 4LV0A 3MR0A 3TSGA 1BDSA 4S2KA 1TVFA 3OCNA 3MXSA 3EEHA 3EQUA 4B93A 5FQKA 4DF6A 3SH8A 3BECA 4R3AA 1N4OA 5GHYA 4IVIA 2ZL1A 3UPNA 4MCWA 3VP4A 4QY6A 1GKUB 3LIDA 2KLIA 1ZTUA 3EWKA 1UWNX 2GDNA 4N1HA 1ATXA 1VM1A 4FSFA 4GB7A 2VV8A 2O9CA 5HFOA 1IYSA 1OT6A 5CHUA 2WYXA 4HJ6A 3R4KA 2Y2PA 3LO7A 4BD1A 1X0OA 2EX8A 3MZEA 2O99A 4GJ4A 3UB9A 4GS9B 1P0ZA 4ID4A 1ZG4A 2QYBA 3B47A 1PW1A 1XJ3A 4Y0OA 1ZUEA 1CF0A 2ZC5B 5EVIC 5GLAA 1H8YA 1RP5A 3IHAA 3KEZA 1PZOA 2W3FA 5E2EA 2Y91A 4GHIB 1VETA 4X53A 3MXRA 5CECA 4L9FA 3N8RA 1K56A 3LCEA 3N6IA 2X01A 3PBQA 4RYEA 4GN2A 4EBPA 1SHVA 3VOLA 2K2NA 4QHCA 3VP3A 1KE4A 3JYIA 1K57A 5FI2A 1IKIA 3M6HA 4X56A 4DXBA 1LI0A 1S67L 4WUJA 4PMAA 4PAUA 4BD0A 1TEMA 4Y15A 3SH9A 3D72A 5EVID 3JVVA 4PKYA 5DTKA 2HJEA 5DKKA 2Y8HA 4YNRA 2Q9NA 1P9WA 2QJ5A 4C6YA 3WS0A 4CLCE 5A90A 3AGEA 1D7EA 1HTZA 3F1NA 2XXLA 2HDRA 4Y13A 1Y4OA 4S2PA 3V50A 4HBUA 4B9OA 1DRMA 2P9VA 2H10A 3BRMA 3LY3A 1F98A 4UQIS 3U4LP 2I72A 2L1MA 1D1JA 1XP4A 1W79A 1L0EA 1W7FA 3MQ0A 2HGVA 1IELA 3OPHA 2OAQ1 3NIAA 1OTDA 4EUVA 3HLBA 1GA0A 1XXMA 3ZNYA 1JNUA 1YAXA 4PPRA 5A93A 3RJUA 3PXPA 2B18A 2XR0A 3WS4A 3BFFA 2VK3A 1YLTA 2JTOA 1I5QA 4NKPA 2CC1A 1T19A 4NG2A 3ZYTA 1KGGA 3GDIA 2INWA 3B42A 3BW6A 5TJJA 2JKTM 2J3TD 4MEZA 4E6XA 2EXAA 2P7JA 4Y3IA 3T4OA 2B95A 3RXWA 4EETB 2DCFA 1CEGA 3L9KA 1AHLA 3TW8A 4B4ZA 1EWZA 4E3JA 2V1ZA 1L0GA 3BFEA 4HP4A 4CQHA 2IWBA 1DJCA 3MCXA 1STZA 2H0YA 2W1TB 2Y2LA 2Q9MA 3D3OA 3C7UA 4P6ZM 1J9MA 1NXYA 4ARZA 3BQAA 1MWRA 3ZGAB 3CI6A 4U3TA 5HD3A 5DKLA 1SKFA 3UE3A 3A3EA 3LIEA 4RX2A 2JKFA 4UQIM 5E2GA 4BBVA 2XF3A 3FG8A 4C75A 3KYEA 4OH0A 4OQGA 4DKIA 3ZG0A 2GNXA 3IXGA 2FH5A 2GZAA 5IT5A 5FEFA 1SDEA 1OJGA 2Y59A 3SS5A 3CPTA 1Z6FA 1NZOA 4R4RA 4H6JB 3HLCA 4O8GA 3EGXC 4LCLA 1K4EA 4ETXA 1KGEA 2HF6A 3Q7VA 2JE5A 2EX6A 2V8CA 5F82A 2W3EA 4S2LA 3NI9A 3H7WA 4KZ4A 4QD4A 1LLBA 4KZ7A 4LV3A 3VV4A 4NXBA 3BFCA 1T1CA 5F83A 5HD5A 2XLNA 3Q1FA 3KSFA 2IWDA 1VB6A 5FAPA 5IHVA 4ESPA 4GOGA 4BBUA 1ESIA 1OPXA 1IEMA 1SDNA 5LBRA 2ZOIA 3ZG5A 4WEJA 3OBFA 4BMWA 1ZKJA 5CGSA 1AXBA 2HDUA 4IUHA 2XH9A 3CAXA 5MC7A 4PM7A 3T1QB 3IH8A 1N9LA 2LB9A 1VETB 2FFYA 1S0WA 3DTEA 4O0PA
chains in the Genus database with same CATH topology
3S7OA 2O9AA 3T4JA 4G3WA 3CWFA 3UB7A 4EERA 1GSXA 3LI8A 4HQAA 4ZRRA 4QPRA 3FPWA 4JGRA 4LLOB 4CLCD 2W1RA 3UMEA 2K7SA 3LYXA 2LB5A 2PD7A 5DFXA 2M1CA 1W63Q 4Z1WA 3T4LA 2ZBBA 4CLCB 3MF0A 4IHQA 2WKPA 3LIAA 2JHEA 2XROA 4HY8A 5DJUA 1ZLHB 4AFIA 3KYQA 5J7EA 2YKFA 3C38A 3T4KA 3C2WA 2CMNA 2QHKA 2K31A 4RQ9A 4UEYA 3T4QA 1OTIA 2I9VA 3O5YA 2DMWA 1UWPX 2W3HA 4Q0JA 5HPFA 2W3GA 3HCYA 2B9KA 2NUPC 4CLCA 3MMHA 4I3AA 1TS7A 1Z99A 3LIFA 2VV6A 2PDRA 3PBNA 4I3JA 3S7PA 4JGOA 1OTAA 2W0NA 3ZQ5A 3A0RA 2PYPA 4IJGA 4WEKA 1WXNA 2ZMFA 3E4QA 1KOUA 3PBSA 2K2XA 4KQOA 3PHYA 2J80A 3IBJA 4EQ1A 5G4ZA 3TE8A 1T1BA 2XA7M 2GJ3A 2V1AA 2KX6A 4HI4A 2OWHA 4II7A 3KSGA 3P7NA 4P6ZS 2XRNA 4GCZA 4WL9A 1S1YA 2V0UA 5HWWA 5IS1A 2W27A 5KSHA 1TS8A 1N9OA 2JR3A 1GSWA 3OLOA 4HH2A 4H6JA 5DF9A 3MR0A 3LR4A 4MN7A 2R78A 3H82B 1F5MA 1MKMA 5FL3A 1BDSA 1LSVA 5HZHA 2J3TC 3EQVA 3OCNA 4I39A 4LRXC 1VHMA 3A0VA 2GX5A 3EEHA 3EQUA 4B93A 4Q0HA 4R3AA 4L9EA 1S66L 3HJIA 4Y2FA 4MCWA 3LIDA 2KLIA 1ZTUA 3MJQA 3EWKA 4GW9A 1UWNX 4MN6A 1T1AA 5L8MA 1ATXA 1OT9A 4FSFA 3OOVA 2VV8A 1WQKA 3PYPA 5AVFA 2O9CA 1OT6A 3EGDC 4R6LA 1BYWA 1W63M 3LFVA 4HJ6A 4IUKA 1TD5A 4GV5A 3R4KA 3E4OA 3C30A 2KDKA 2O9BA 4M4XA 4NXGA 1P9RA 4EEUA 4GLQA 4F3LB 1X0OA 3PBTA 5DJTA 1H8MA 2O99A 3LR3A 4GJ4A 2PHYA 5F68A 3R7WB 4XT2A 3MQQA 4HNBA 4WLAA 5HWVA 3UB9A 3RFBA 4DJ2A 1D06A 3A0SA 4GS9B 1P0ZA 2V1BA 2QYBA 3B47A 3RTYA 3VE4A 1XJ3A 3P01A 1Y28A 2VZWA 2MUBA 4ARZB 5KIZA 1ZUEA 4EESA 3MQOA 4HIAA 2MJ6A 3KEZA 2G7UA 2QKPA 1MC0A 5IU1A 2SH1A 1YSQA 4KUKA 2W3FA 3PBRA 2D02A 2QWSA 1OTBA 3OCLA 2IKEA 4GHIB 4MMNA 2J3WA 4L9FA 3R7WA 3K3CA 2ZMVA 4LRYC 1SH1A 3BQ8A 4GS9A 1S1ZA 3E4PA 3PBQA 2OWJA 3C8CA 2VEAA 3KX0X 3K2NA 2W3DA 2K2NA 3TRCA 3VOLA 2VA0A 2JKTI 1V9ZA 2L4RA 3F1NB 4KUOA 1OTEA 1S67L 2EA9A 4WUJA 5TBMB 2JKRI 1DP9A 4GHIA 4OOLA 5J3WA 4HOIA 4BBTA 2QJ7A 3T4SA 4PAUA 4I5SA 1TS6A 2V0WA 4E04A 3PR6A 2B02A 2OAP1 5K5BA 3D72A 3JVVA 4PKYA 3ULFA 2P08A 2HJEA 2XSSA 3CUEC 4L0LA 5DKKA 4G3KA 2Y8HA 4YNRA 1ZLIB 1V9YA 3H7WB 1P9WA 1XJ4A 2QJ5A 5F6AA 2H9XA 1NLYA 4CLCE 1H5OA 1D7EA 3V67A 1DP6A 3F1NA 2IKDA 2BASA 1S4RA 2XXLA 3BWLA 5TBMA 3KSHA 4B9OA 1DRMA 3MYVA 2V9AA 1MZUA 4EW7A 1ZHHB 2A24B 2D01A 1F98A 4UQIS 2L1MA 4R70A 1WA9A 3MQ0A 2NUTC 2HGVA 4R38A 3D4UB 1UGUA 2M7UA 4EXOA 1NWZA 2OAQ1 4HP9A 3LIBA 3IS2B 1OTDA 5HL6A 4WF0A 5AVEA 4EUVA 1JNUA 1YAXA 5HSQA 4BJPA 1IOUA 2ZOHA 1G6OA 4OOMA 1LL8A 3LR5A 2B18A 3PXPA 2A24A 3H82A 3G6OA 3S7NA 2QSHA 1LSXA 3TJZC 3F1OB 2JTOA 2FZ0A 3S7QA 1NRJA 3LUQA 4I38A 4FOFA 4JGQA 2VV7A 4NKPA 1ZUFA 3CITA 1T19A 3JVUA 4MN5A 3ZYTA 2VKSA 3GDIA 5DFYA 3LMSB 2INWA 5A8BA 2VGLS 2Y79A 3B42A 3GECA 4I3IA 3BW6A 4WN5A 5TJJA 2JKTM 2J3TD 1ODVA 4MDZA 1TF1A 1NLZA 1IFQA 2P7JA 4Y3IA 3T4OA 4EETB 4YWZA 3KO6A 5HDDA 3EOIA 3NJAA 5HPIA 1AHLA 1H3QA 3NOTC 3TW8A 2PR5A 3LI9A 4F3LA 3EEAA 4HP4A 4CQHA 2VJWA 2HV1A 2VLGA 3MCXA 1STZA 1LSWA 2W1TB 3HJKA 3E98A 5CX7A 5C5KA 5HDCA 3DBAA 3H9WA 4L9GA 4Y5FA 1XFQA 4LPZA 3D3OA 4YOFA 4P6ZM 2PR6A 4ARZA 3BQAA 2EWVA 3CI6A 5F5YA 5HD3A 1TS0A 2IA2A 5DKLA 2YKHA 2RNGA 3UE3A 3LIEA 5F69A 2KOIA 4UQIM 4BBVA 3T50A 5G4YA 3CLOA 3FG8A 1D6BA 4EU0A 4HHDA 4Q0IA 3UE6A 4BWIA 2W1TA 5HDSA 1XJ6A 2GNXA 3BY9A 3UMDA 2A2LA 2PD8A 4DJ3A 5AJGA 1GSVA 3T4TA 4HJ3A 3W2ZA 4JGPA 3NOUC 2OOLA 3IBRA 2FH5A 2WKRA 2GZAA 1DP8A 5IT5A 2L0WA 3VE3A 1OJGA 4KQDA 4H6JB 4G3VA 4LRZE 4O8GA 3EGXC 3K3DA 3NHQA 3UB6A 1S4SA 3ICYA 1B8WA 4K08A 4ETXA 2HF6A 3OC2A 3NOPC 4EEPA 5J4EA 2M7VA 3FPVA 4YIRA 3UB8A 1OJ5A 2W3EA 2Z6DA 3H7WA 1P97A 2VGLM 2QSFA 1YSPA 2O0YA 3U2AA 5EFWA 2QSGA 1SHIA 4ETZA 3LR0A 1N9NA 3KSIA 3KYZA 5I5LA 3RH8B 4ME4A 3VV4A 4NXBA 2BDSA 3MXQA 3PBOA 5HWTA 2WKQA 1EW0A 1T1CA 5HD5A 2JN7A 2H28A 3BJNA 4PHTA 4CLCC 3KSFA 1T18A 3B33A 1G28A 1XJ2A 4O01A 4NXEA 2EWWA 4HJ4A 2P04A 1VB6A 4XT2B 3E0YA 3MFXA 4HH3A 3F1PB 4BBUA 1LT0A 1OPXA 5LBRA 2PT7A 2ZOIA 4WELA 4WEJA 3OBFA 4DMZA 3BY8A 3SW1A 2XA7S 4BMWA 2Z6CA 3IS2A 4NXFA 4DN0A 2PYRA 4IUHA 3FC7A 2HJ9C 2DLAA 1APFA 3CAXA 5MC7A 4PKYG 3LICA 1N9LA 2VX8A 2LB9A 2MN3A 2JKRM 3CUEA 1YKDA 4NEED 3F1OA 1F9IA 1XFNA 4O0PA 3F1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJE A;  3C30 A;  1ZHH B;  3C38 A;  2HJ9 C; 
#chains in the Genus database with same CATH topology
 5HW3 A;  3QNB A;  3T4J A;  3ZVT A;  3CWF A;  4OKP A;  3UB7 A;  4ZRR A;  4QPR A;  4LLO B;  1K38 A;  1K25 A;  3UME A;  2VGJ A;  1H5X A;  3S22 A;  3QHY A;  5GLC A;  5FEG A;  1XX2 A;  3A3J A;  4HY8 A;  5DJU A;  1ESU A;  3T4K A;  3C2W A;  3QP4 A;  4UEY A;  3T4Q A;  5DVA A;  1SKO A;  1UWP X;  3TG9 A;  3WWX A;  3HCY A;  4CLC A;  2XFT A;  1TS7 A;  5GHZ A;  3ITB A;  3JPU A;  2JCH A;  3S7P A;  2P74 A;  2PYP A;  2ZD8 A;  2P9V B;  4IJG A;  5EUA A;  2PU4 A;  1XGI A;  3OZH A;  3DAV A;  1K54 C;  4QY5 A;  4DE2 A;  1PW8 A;  2Y2J A;  1ES5 A;  3TE8 A;  2KX6 A;  3P7N A;  3GSG A;  3LEZ A;  4WL9 A;  1S1Y A;  2V0U A;  3MFD A;  4FD8 A;  3ZCZ A;  3WS2 A;  1ERO A;  1ACF A;  4GKU A;  3LR4 A;  5FL3 A;  3ZG8 B;  1LSV A;  5HZH A;  4E3N A;  4I39 A;  4LRX C;  1VHM A;  3A0V A;  2GX5 A;  4Q0H A;  4EV4 A;  4L9E A;  1DJB A;  3HJI A;  1KDW A;  2JBF A;  3PAG A;  2WGW A;  1RGZ A;  4OLD A;  2R9X A;  3IX4 A;  3MJQ A;  4GW9 A;  4MN6 A;  3MKE A;  5L8M A;  1LL5 A;  4ZJ3 A;  3FWL A;  4Z9Q A;  5CEB A;  5AVF A;  5CGX A;  3V5M A;  1BYW A;  1W63 M;  3LFV A;  1TD5 A;  3C30 A;  3HUN A;  2KDK A;  1P9R A;  4H8R A;  4GLQ A;  1K56 D;  5DJT A;  3LEQ A;  3LR3 A;  2PHY A;  5F68 A;  5GHX A;  3T1S A;  3MQQ A;  4WLA A;  5HWV A;  3Q82 A;  4DJ2 A;  1ZG6 A;  1BTL A;  2V1B A;  2OV5 A;  5EV0 A;  3VE4 A;  4ARZ B;  2Z2L B;  1BLH A;  4N1X A;  3DW0 A;  2SH1 A;  1YSQ A;  3BLM A;  1LHY A;  2D02 A;  4ZDX A;  1GHM A;  1I2W A;  3R7W A;  3K3C A;  4LRY C;  4E6W A;  4UA6 A;  4KG2 A;  5GL9 A;  3C8C A;  3KX0 X;  4N9K A;  2WGI A;  3TRC A;  4UA7 A;  4LV1 A;  2JKT I;  4DXC A;  4JXG A;  1YMS A;  5FAQ A;  3C5A A;  5TBM B;  4OOL A;  1DP9 A;  1FSW A;  2WUQ A;  2FFF B;  5J3W A;  1BLS A;  3T4S A;  2EXB A;  1TS6 A;  2UV0 E;  2V0W A;  2ZM2 A;  3NC8 A;  2OAP 1;  5K5B A;  2Z2M B;  2P08 A;  2XSS A;  3CUE C;  5EVI B;  5CTN A;  3H7W B;  2ZMA A;  1QMF A;  3QP5 A;  1NLY A;  2X71 A;  1OME A;  3V67 A;  1EL6 A;  2BAS A;  1S4R A;  3BWL A;  3SZT A;  2Y55 A;  3KSH A;  1HD8 A;  1NZU A;  4ZAM A;  4EW7 A;  4LEN A;  2A24 B;  1H0M A;  4R4S A;  1CEF A;  1EI5 A;  4R70 A;  5D3O A;  3GMW A;  3D4U B;  5F1G A;  1UGU A;  1MWT A;  3T12 B;  2XGN A;  1NWZ A;  5CRF A;  3N4I A;  2V8F A;  2Y2I A;  3CZD A;  3WS1 A;  4KZ6 A;  2X02 A;  5AQ9 A;  5HSQ A;  1PI5 A;  2ZOH A;  1G6O A;  5FI6 A;  4OOM A;  3LR5 A;  3QP2 A;  3G6O A;  3M2J A;  3A3F A;  3IXD A;  1LSX A;  5M1A A;  2FZ0 A;  4ZJ2 A;  3QP8 A;  1NRJ A;  3S7Q A;  4FOF A;  2VV7 A;  4N92 A;  5FQM A;  3UNW A;  2ZM8 A;  3JVU A;  4P85 A;  5FQ9 A;  4MN5 A;  2EX9 A;  4PM9 A;  5DFY A;  3LMS B;  4QB8 A;  2VGL S;  2Y79 A;  4I3I A;  1ODV A;  4MDZ A;  3KO6 A;  5HDD A;  1K54 A;  2ZC6 B;  3EEA A;  5E2F A;  2HV1 A;  4GDN A;  1LSW A;  5FSR A;  1VEU A;  5HDC A;  1GA9 A;  3DBA A;  4OP8 A;  1M6K A;  4OLG A;  2PR6 A;  2EWV A;  1YM1 A;  4IED A;  4LCM A;  3MZD A;  1TS0 A;  4X1L A;  3S1Y A;  5FAS A;  1RCJ A;  3FKV A;  5F69 A;  5G4Y A;  1LI9 A;  3CLO A;  2PBD P;  3GQZ A;  4QU3 A;  4BWI A;  1IYQ A;  3VSK A;  4C3Q A;  5M19 A;  3UMD A;  2A2L A;  4DJ3 A;  1GSV A;  3T4T A;  3W2Z A;  4JGP A;  2OOL A;  3IBR A;  4JF6 A;  2WKR A;  5AQ7 A;  3HLW A;  1MPL A;  3G35 A;  4P87 A;  3GV9 A;  3IXB A;  3VE3 A;  4WMC A;  4X1M A;  4G3V A;  1QME A;  3DTK A;  4DE3 A;  1JVJ A;  3IXH A;  4NK3 A;  1B8W A;  5KSC A;  4BL3 A;  3OC2 A;  4EEP A;  5J4E A;  2M7V A;  3N7W A;  4YIR A;  2WGW B;  5L10 A;  5CTM A;  2Z6D A;  3HLG A;  2VGL M;  2QSF A;  5EFW A;  4X25 A;  5I5L A;  4R3J A;  4BEN A;  3OPP A;  4ME4 A;  3MXQ A;  2WKQ A;  1W8Q A;  2Q0O A;  3Q81 A;  4CLC C;  1KE3 A;  1T18 A;  2RCX A;  1G28 A;  3HRE A;  2EWW A;  2P04 A;  3IX8 A;  3VOZ A;  1XA7 A;  3E0Y A;  4MBF A;  3F1P B;  2PT7 A;  4FUW A;  4FCF A;  5EVE A;  5EM1 A;  3HL9 A;  2Z6C A;  4NXF A;  2QZ6 A;  4OPY A;  3UB5 P;  5CHM A;  1ERM A;  2DLA A;  4PKY G;  3LIC A;  1BZA A;  3UN7 A;  2VX8 A;  2MN3 A;  4MBH A;  1G5U A;  3CUE A;  1BUE A;  5CED A;  1J3W A;  3BLS A;  3ISG A;  1PFL A;  5FQJ A;  1GL9 B;  2HDS A;  4QJG A;  4UAA A;  1GSX A;  2HPB A;  3IHB A;  3WRT A;  2OSU A;  3FPW A;  4CLC D;  4X69 A;  5DTS A;  2JHE A;  1PNE A;  3KYQ A;  4K0W A;  2HP9 A;  2J8Y A;  1G68 A;  4K91 A;  4RQ9 A;  5TGF A;  1OTI A;  3T1X A;  3IF6 C;  2DMW A;  5M18 A;  2W3H A;  5HPF A;  5JYO A;  3IQA A;  3P09 A;  3CG5 A;  5GLD A;  2VV6 A;  1ES3 A;  3MZF A;  4JGO A;  4JF5 A;  3ZQ5 A;  3A0R A;  4YFM A;  4GNU A;  2ZC7 A;  2IWC A;  4U0T A;  4FH2 A;  1KOU A;  4GDB A;  3PBS A;  2K2X A;  4UHU A;  3PHY A;  2ZQ8 A;  1E4D A;  1O7E A;  5EOE A;  1KVL A;  2GJ3 A;  5HX9 A;  2ZL1 B;  4D2O A;  4HI4 A;  4II7 A;  1IYO A;  3CJM A;  4DDS A;  1N9O A;  2J7V A;  2JR3 A;  5CGW A;  2WAF A;  4MN7 A;  2R78 A;  1F5M A;  3G2Y A;  3MS6 A;  4JKT A;  2OLV A;  3EQV A;  1Q2P A;  4EQI A;  4X6T A;  1E3U A;  5DF8 A;  1T1A A;  1W5D A;  3GTC A;  2ZC3 B;  3OOV A;  1FR1 A;  5CER A;  4B4X A;  2PAV P;  3PYP A;  2HDQ A;  4MLL A;  3EGD C;  1ALQ A;  4GV5 A;  1MXO A;  3G31 A;  3E4O A;  2O9B A;  3HLD A;  4M4X A;  5EE8 A;  3NY4 A;  4HES A;  4S2M A;  4JXS A;  2ACG A;  1H8M A;  4N9L A;  2ZQD A;  3FZC A;  4XUZ A;  4XT2 A;  4HNB A;  3RFB A;  1D06 A;  1VEU B;  3A0S A;  1ONH A;  4OPR A;  2J9O A;  2WAE A;  4R3B A;  3RTY A;  4U0X A;  1Y28 A;  2VZW A;  1MWU A;  3VSL A;  1NY0 A;  2PBY A;  4HIA A;  2MJ6 A;  2G7U A;  1SCW A;  3GRJ A;  3AGF A;  1FOF A;  5IU1 A;  4KUK A;  3PBR A;  2QWS A;  1OTB A;  2IKE A;  2Y2Q A;  3B3X A;  4MMN A;  4O7D A;  4JBF A;  1MBL A;  4GZB A;  3C7V A;  3FKW A;  2ZMV A;  1SH1 A;  4GS9 A;  3CMZ A;  4OON A;  2VEA A;  4OQH A;  4KZ9 A;  1BLC A;  4KG6 A;  2L4R A;  4MBK A;  2R9W A;  2V2F F;  3FYZ A;  3F1N B;  3G34 A;  1OTE A;  4D60 A;  2JKR I;  4GHI A;  4FTX A;  1A0K A;  5A91 A;  4BBT A;  3C4P A;  5L2F A;  5DF7 A;  4E04 A;  2B02 A;  2PRF A;  3LGO A;  3ULF A;  4L0L A;  3HLE A;  2XFS A;  4G3K A;  1ZLI B;  3IX3 A;  1XJ4 A;  3DWZ A;  4IVK A;  2H9X A;  3NCK A;  2RL3 A;  1DP6 A;  3A3D A;  2OLU A;  3V3S A;  3MYV A;  2V9A A;  5CXW A;  1KVM A;  1ZHH B;  4EBN A;  2Y4A A;  3Q07 A;  2Y2N A;  2NUT C;  4R38 A;  1YLW A;  2M7U A;  4EXO A;  2XDM A;  2ZM0 A;  1HLU P;  3NDE A;  4HP9 A;  3LIB A;  2EFX A;  4WF0 A;  5AVE A;  5HL6 A;  4BJP A;  1IOU A;  2BLS A;  3H82 A;  4BLM A;  3V39 A;  5EOO A;  2QSH A;  1L2S A;  3TJZ C;  1FR6 A;  3IF6 A;  2WKI A;  3LUQ A;  4I38 A;  3UPO A;  1GHP A;  1LL9 A;  2HP5 A;  3CIT A;  1NYY A;  3IWO A;  3FV7 A;  3DTI A;  4E3O A;  1XGJ A;  5A8B A;  2WZX A;  3GEC A;  3D4F A;  1NLZ A;  4WBG A;  5FDS A;  3HBR A;  1IFQ A;  2Y2M A;  4E3M A;  3Q7Z A;  2ZQC A;  4YWZ A;  3SS3 A;  3NJA A;  5HPI A;  1YLZ A;  1H3Q A;  4B88 A;  3NOT C;  2PR5 A;  3LI9 A;  3GR2 A;  4F3L A;  2B5R A;  4Y7P A;  2VLG A;  3QP6 A;  4S2O A;  3HJK A;  4LFU A;  4DRT A;  5C5K A;  4KZ3 A;  4HBT A;  4WMC D;  3TOI A;  3E2K A;  2EFU A;  3UE1 A;  5F5Y A;  4K0X A;  1BT5 A;  3CPT B;  1FSY A;  2YKH A;  4Y0T A;  1XKZ A;  4MNR A;  2QPN A;  2KOI A;  3T50 A;  3D9Y A;  4JLF A;  5FQQ A;  1D6B A;  4HHD A;  3UE6 A;  3Q7V B;  4PM6 A;  2W1T A;  1XJ6 A;  3BY9 A;  4OP5 A;  2PD8 A;  1PI4 A;  5FDH A;  5AJG A;  4HJ3 A;  4PM8 A;  5FAT A;  1DP8 A;  1CK3 A;  3BEB A;  3ZFZ A;  2L0W A;  4YIN A;  4LRZ E;  3UB6 A;  1S4S A;  3O87 A;  4DE1 A;  3ICY A;  4K08 A;  1WE4 A;  1IYP A;  4KZA A;  3NUL A;  3FPV A;  5EPH A;  3G32 A;  4KG5 A;  1K0K A;  5E2H A;  1IKG A;  3UE0 A;  2O0Y A;  3U2A A;  2QSG A;  1SHI A;  1WYB A;  3ZDJ A;  4OQ0 A;  4ETZ A;  3KSI A;  2PU2 A;  3RH8 B;  2BDS A;  3PBO A;  4DE0 A;  1VQQ A;  2H28 A;  4PHT A;  3HVF A;  5DTT A;  1KDS A;  5HAQ A;  4WZ4 A;  5HAR A;  4O01 A;  4NXE A;  4XT2 B;  5JYP A;  3MKF A;  3ITA A;  4WEL A;  3I7J A;  4DMZ A;  3BY8 A;  2XA7 S;  1XPB A;  5HAI A;  4WM9 A;  3IS2 A;  4DN0 A;  2PYR A;  1FIL A;  4R23 A;  3FC7 A;  1YMX A;  1U60 A;  1O07 A;  1BLP A;  2JKR M;  4E3I A;  2JKG A;  1YKD A;  4NEE D;  3F1O A;  4BQM A;  1XFN A;  1GCE A;  4QWO A;  3S7O A;  2O9A A;  5G18 A;  3OPR A;  3WS5 A;  1SKO B;  4JPM A;  4JGR A;  4WYY A;  2HZ5 A;  2W1R A;  2ZQ9 A;  2K7S A;  3LYX A;  2PD7 A;  1L0D A;  4KQR A;  2M1C A;  1W63 Q;  3T4L A;  2ZBB A;  4CLC B;  2VGK A;  4IHQ A;  3HUO A;  1ZLH B;  5J7E A;  2YKF A;  3SS4 A;  2QHK A;  1K6R A;  2V20 A;  1I2S A;  2I9V A;  4LV2 A;  1FCO A;  1YLP A;  2W3G A;  1ERQ A;  3O3V A;  3MMH A;  4I3A A;  1Z99 A;  2PDR A;  4I3J A;  2W0N A;  5EM0 A;  4WEK A;  1WXN A;  2ZMF A;  3E4Q A;  5FI7 A;  1E3U D;  4KQQ A;  3W4O A;  4EBL A;  4LGW A;  2J80 A;  3IBJ A;  3ZG7 B;  2XA7 M;  4PM5 A;  3QNC A;  2V1A A;  1ZC2 A;  1HZO A;  2OWH A;  4P6Z S;  2XRN A;  4GCZ A;  5IS1 A;  4S2N C;  2WAD A;  5KSH A;  3VFF A;  1CQA A;  1GSW A;  3PAE A;  1BUL A;  4HH2 A;  2C6W B;  3UPP A;  3H82 B;  1MKM A;  5L09 A;  3V3R A;  2Y2K A;  2J3T C;  3W4P A;  1PWD A;  3LY4 A;  3IF6 B;  1JTD A;  5EVL A;  5BOH A;  1XA1 A;  1S66 L;  1FCM A;  1Y54 A;  4Y2F A;  1FCN A;  3WRZ A;  1CJF A;  2HP6 A;  1PRQ A;  1OT9 A;  1WQK A;  4OQI A;  4R6L A;  4IUK A;  3SH7 A;  4RVA A;  2Y2O A;  4IBX A;  4NXG A;  4EEU A;  5F1F A;  4F3L B;  3PBT A;  3R7W B;  4OPZ A;  2DNS A;  3BYD A;  3P01 A;  5KIZ A;  2MUB A;  4EES A;  3MQO A;  2QKP A;  4WZ5 C;  3ZHH A;  1MC0 A;  1DY6 A;  2XD1 A;  4KZ8 A;  5FAO A;  3OCL A;  1ES2 A;  2J3W A;  3PTE A;  1YT4 A;  4FH4 A;  2H5S A;  2QMI A;  3VFH A;  3BQ8 A;  4OVD A;  4P6B A;  1S1Z A;  3E4P A;  2OWJ A;  1TDL A;  3DWK A;  3K2N A;  2W3D A;  5FA7 A;  2ZQA A;  2VA0 A;  3BFD A;  2E8I A;  1L3L A;  1V9Z A;  3QP1 A;  3VP0 A;  4OOY A;  4KUO A;  3NDG A;  2EA9 A;  3L7H A;  2E8J A;  4HEF A;  3BFG A;  4HOI A;  2QJ7 A;  3O86 A;  3MBZ A;  1CI8 A;  4I5S A;  4KEN B;  3HUM A;  1JWV A;  3PR6 A;  1RGY A;  1TDG A;  1G6A A;  4DDY A;  1V9Y A;  5F6A A;  4Q8I A;  1H5O A;  2IKD A;  5TBM A;  1N9B A;  4KZ5 A;  3VMA A;  3G2Z A;  5KMW A;  2XEP A;  2ZJ9 A;  1MZU A;  2BTF P;  2D01 A;  4R1G A;  3G30 A;  5I94 A;  2WZZ A;  1WA9 A;  3BM6 A;  5EVI A;  5KZH A;  1YPR A;  1JWZ A;  4Y0U A;  2XD5 A;  1MY8 A;  3IS2 B;  2WKH A;  1W8Y A;  3N8L A;  1LL8 A;  2A24 A;  2A49 A;  3A3I A;  3S7N A;  2WK0 A;  3F1O B;  4ZTK A;  3VP1 A;  4JXW A;  4JGQ A;  3UO9 A;  4UA9 A;  3NBL A;  1ZUF A;  3GVB A;  3N8S A;  1FQG A;  2C5W B;  2VKS A;  3SOI A;  1K55 C;  4NET A;  1PIO A;  4WN5 A;  1NRF A;  1TF1 A;  4X55 A;  3IH9 A;  1NYM A;  1YLY A;  5HL1 A;  1L0F A;  3EOI A;  5L07 A;  3HLF A;  4EUZ A;  5TFQ A;  1PWG A;  4JXV A;  2VJW A;  5U47 A;  1PYY A;  4KZB A;  5CX7 A;  3E98 A;  1F2K A;  3H9W A;  4S2N A;  4L9G A;  4Y5F A;  3P98 A;  4XXR A;  2DRW A;  1XFQ A;  3VP2 A;  4LPZ A;  4YOF A;  4XUX A;  2IA2 A;  2RNG A;  3W4Q A;  2EX2 A;  4EU0 A;  1YLJ A;  4Q0I A;  1DJA A;  5CHJ A;  3ZG9 B;  5HDS A;  3IF5 A;  3M6B A;  3AGD A;  5EEC A;  3NOU C;  3E2L A;  5HAP A;  4EWF A;  4KQD A;  3C4O A;  4ZBE A;  3K3D A;  3NHQ A;  4OPQ A;  3IWQ A;  5FQI A;  4GD6 A;  4M3K A;  3NEC A;  1YQS A;  4BL2 A;  1CI9 A;  3NOP C;  2WKE A;  3UB8 A;  4F94 A;  1MKI A;  4RA7 A;  1OJ5 A;  1HVB A;  4A5R A;  1PWC A;  1P97 A;  4Y17 A;  1Z09 A;  1YSP A;  5J8X A;  4WZ5 A;  4E3K A;  1SZV A;  2BG1 A;  2UWX A;  1KE0 A;  2AVX A;  3ZNT A;  3LR0 A;  2XK1 A;  2XQZ A;  1N9N A;  3KYZ A;  3O88 A;  5HWT A;  1K6S A;  1EW0 A;  2JN7 A;  3BJN A;  1K57 C;  5E43 A;  1JWP A;  3B33 A;  1S6R A;  1XJ2 A;  2ZQ7 A;  3M2K A;  4HJ4 A;  2JC7 A;  3UDX A;  2Y2G A;  4X68 A;  3MFX A;  4HH3 A;  1ES4 A;  1LT0 A;  3MSH A;  1JTG A;  3SW1 A;  1AWI A;  3G4P A;  1PZP A;  4ZJ1 A;  1Q2Q A;  2HJ9 C;  4R0Q A;  1APF A;  1KGF A;  3T1R A;  4IBR A;  4RX3 A;  1H8Z A;  1F9I A;  3F1P A;  5GLB A;  3IF4 A;  1FIK A;  4S2J A;  1K4F A;  4G3W A;  4CPK A;  3UY6 A;  4EER A;  5TR7 A;  3LI8 A;  4HQA A;  1BSG A;  2LB5 A;  5DFX A;  3RXX A;  4Z1W A;  3IT9 A;  3MF0 A;  5AQA A;  2WKP A;  5AQB A;  3LIA A;  2XRO A;  4E3L A;  3CHW P;  4AFI A;  3DTM A;  2J9P A;  3C38 A;  3S4X A;  4GD8 A;  2CMN A;  1C3B A;  1GHI A;  5A92 A;  2K31 A;  1M40 A;  3O5Y A;  1NJ4 A;  4S2I A;  3W8K A;  4Q0J A;  3VOY A;  3OPL A;  2B9K A;  1MWS A;  4P0M A;  2NUP C;  3LIF A;  1ONG A;  1E25 A;  2WGV A;  4CJN A;  3PBN A;  1OTA A;  3UDI A;  3ZVW A;  2ZLY A;  2G2U A;  2Y2H A;  2H0T A;  2ZC4 B;  4KQO A;  3UDF A;  2A3U A;  4EQ1 A;  5G4Z A;  4JF4 A;  1K55 A;  1T1B A;  3KSG A;  1WYC A;  5HWW A;  2W27 A;  1TS8 A;  3IWI A;  3OLO A;  4H6J A;  5DF9 A;  2G2W A;  4LV0 A;  3MR0 A;  3TSG A;  1BDS A;  4S2K A;  1TVF A;  3OCN A;  3MXS A;  3EEH A;  3EQU A;  4B93 A;  5FQK A;  4DF6 A;  3SH8 A;  3BEC A;  4R3A A;  1N4O A;  5GHY A;  4IVI A;  2ZL1 A;  3UPN A;  4MCW A;  3VP4 A;  4QY6 A;  1GKU B;  3LID A;  2KLI A;  1ZTU A;  3EWK A;  1UWN X;  2GDN A;  4N1H A;  1ATX A;  1VM1 A;  4FSF A;  4GB7 A;  2VV8 A;  2O9C A;  5HFO A;  1IYS A;  1OT6 A;  5CHU A;  2WYX A;  4HJ6 A;  3R4K A;  2Y2P A;  3LO7 A;  4BD1 A;  1X0O A;  2EX8 A;  3MZE A;  2O99 A;  4GJ4 A;  3UB9 A;  4GS9 B;  1P0Z A;  4ID4 A;  1ZG4 A;  2QYB A;  3B47 A;  1PW1 A;  1XJ3 A;  4Y0O A;  1ZUE A;  1CF0 A;  2ZC5 B;  5EVI C;  5GLA A;  1H8Y A;  1RP5 A;  3IHA A;  3KEZ A;  1PZO A;  2W3F A;  5E2E A;  2Y91 A;  4GHI B;  1VET A;  4X53 A;  3MXR A;  5CEC A;  4L9F A;  3N8R A;  1K56 A;  3LCE A;  3N6I A;  2X01 A;  3PBQ A;  4RYE A;  4GN2 A;  4EBP A;  1SHV A;  3VOL A;  2K2N A;  4QHC A;  3VP3 A;  1KE4 A;  3JYI A;  1K57 A;  5FI2 A;  1IKI A;  3M6H A;  4X56 A;  4DXB A;  1LI0 A;  1S67 L;  4WUJ A;  4PMA A;  4PAU A;  4BD0 A;  1TEM A;  4Y15 A;  3SH9 A;  3D72 A;  5EVI D;  3JVV A;  4PKY A;  5DTK A;  2HJE A;  5DKK A;  2Y8H A;  4YNR A;  2Q9N A;  1P9W A;  2QJ5 A;  4C6Y A;  3WS0 A;  4CLC E;  5A90 A;  3AGE A;  1D7E A;  1HTZ A;  3F1N A;  2XXL A;  2HDR A;  4Y13 A;  1Y4O A;  4S2P A;  3V50 A;  4HBU A;  4B9O A;  1DRM A;  2P9V A;  2H10 A;  3BRM A;  3LY3 A;  1F98 A;  4UQI S;  3U4L P;  2I72 A;  2L1M A;  1D1J A;  1XP4 A;  1W79 A;  1L0E A;  1W7F A;  3MQ0 A;  2HGV A;  1IEL A;  3OPH A;  2OAQ 1;  3NIA A;  1OTD A;  4EUV A;  3HLB A;  1GA0 A;  1XXM A;  3ZNY A;  1JNU A;  1YAX A;  4PPR A;  5A93 A;  3RJU A;  3PXP A;  2B18 A;  2XR0 A;  3WS4 A;  3BFF A;  2VK3 A;  1YLT A;  2JTO A;  1I5Q A;  4NKP A;  2CC1 A;  1T19 A;  4NG2 A;  3ZYT A;  1KGG A;  3GDI A;  2INW A;  3B42 A;  3BW6 A;  5TJJ A;  2JKT M;  2J3T D;  4MEZ A;  4E6X A;  2EXA A;  2P7J A;  4Y3I A;  3T4O A;  2B95 A;  3RXW A;  4EET B;  2DCF A;  1CEG A;  3L9K A;  1AHL A;  3TW8 A;  4B4Z A;  1EWZ A;  4E3J A;  2V1Z A;  1L0G A;  3BFE A;  4HP4 A;  4CQH A;  2IWB A;  1DJC A;  3MCX A;  1STZ A;  2H0Y A;  2W1T B;  2Y2L A;  2Q9M A;  3D3O A;  3C7U A;  4P6Z M;  1J9M A;  1NXY A;  4ARZ A;  3BQA A;  1MWR A;  3ZGA B;  3CI6 A;  4U3T A;  5HD3 A;  5DKL A;  1SKF A;  3UE3 A;  3A3E A;  3LIE A;  4RX2 A;  2JKF A;  4UQI M;  5E2G A;  4BBV A;  2XF3 A;  3FG8 A;  4C75 A;  3KYE A;  4OH0 A;  4OQG A;  4DKI A;  3ZG0 A;  2GNX A;  3IXG A;  2FH5 A;  2GZA A;  5IT5 A;  5FEF A;  1SDE A;  1OJG A;  2Y59 A;  3SS5 A;  3CPT A;  1Z6F A;  1NZO A;  4R4R A;  4H6J B;  3HLC A;  4O8G A;  3EGX C;  4LCL A;  1K4E A;  4ETX A;  1KGE A;  2HF6 A;  3Q7V A;  2JE5 A;  2EX6 A;  2V8C A;  5F82 A;  2W3E A;  4S2L A;  3NI9 A;  3H7W A;  4KZ4 A;  4QD4 A;  1LLB A;  4KZ7 A;  4LV3 A;  3VV4 A;  4NXB A;  3BFC A;  1T1C A;  5F83 A;  5HD5 A;  2XLN A;  3Q1F A;  3KSF A;  2IWD A;  1VB6 A;  5FAP A;  5IHV A;  4ESP A;  4GOG A;  4BBU A;  1ESI A;  1OPX A;  1IEM A;  1SDN A;  5LBR A;  2ZOI A;  3ZG5 A;  4WEJ A;  3OBF A;  4BMW A;  1ZKJ A;  5CGS A;  1AXB A;  2HDU A;  4IUH A;  2XH9 A;  3CAX A;  5MC7 A;  4PM7 A;  3T1Q B;  3IH8 A;  1N9L A;  2LB9 A;  1VET B;  2FFY A;  1S0W A;  3DTE A;  4O0P A; 
#chains in the Genus database with same CATH homology
 3S7O A;  2O9A A;  3T4J A;  4G3W A;  3CWF A;  3UB7 A;  4EER A;  1GSX A;  3LI8 A;  4HQA A;  4ZRR A;  4QPR A;  3FPW A;  4JGR A;  4LLO B;  4CLC D;  2W1R A;  3UME A;  2K7S A;  3LYX A;  2LB5 A;  2PD7 A;  5DFX A;  2M1C A;  1W63 Q;  4Z1W A;  3T4L A;  2ZBB A;  4CLC B;  3MF0 A;  4IHQ A;  2WKP A;  3LIA A;  2JHE A;  2XRO A;  4HY8 A;  5DJU A;  1ZLH B;  4AFI A;  3KYQ A;  5J7E A;  2YKF A;  3C38 A;  3T4K A;  3C2W A;  2CMN A;  2QHK A;  2K31 A;  4RQ9 A;  4UEY A;  3T4Q A;  1OTI A;  2I9V A;  3O5Y A;  2DMW A;  1UWP X;  2W3H A;  4Q0J A;  5HPF A;  2W3G A;  3HCY A;  2B9K A;  2NUP C;  4CLC A;  3MMH A;  4I3A A;  1TS7 A;  1Z99 A;  3LIF A;  2VV6 A;  2PDR A;  3PBN A;  4I3J A;  3S7P A;  4JGO A;  1OTA A;  2W0N A;  3ZQ5 A;  3A0R A;  2PYP A;  4IJG A;  4WEK A;  1WXN A;  2ZMF A;  3E4Q A;  1KOU A;  3PBS A;  2K2X A;  4KQO A;  3PHY A;  2J80 A;  3IBJ A;  4EQ1 A;  5G4Z A;  3TE8 A;  1T1B A;  2XA7 M;  2GJ3 A;  2V1A A;  2KX6 A;  4HI4 A;  2OWH A;  4II7 A;  3KSG A;  3P7N A;  4P6Z S;  2XRN A;  4GCZ A;  4WL9 A;  1S1Y A;  2V0U A;  5HWW A;  5IS1 A;  2W27 A;  5KSH A;  1TS8 A;  1N9O A;  2JR3 A;  1GSW A;  3OLO A;  4HH2 A;  4H6J A;  5DF9 A;  3MR0 A;  3LR4 A;  4MN7 A;  2R78 A;  3H82 B;  1F5M A;  1MKM A;  5FL3 A;  1BDS A;  1LSV A;  5HZH A;  2J3T C;  3EQV A;  3OCN A;  4I39 A;  4LRX C;  1VHM A;  3A0V A;  2GX5 A;  3EEH A;  3EQU A;  4B93 A;  4Q0H A;  4R3A A;  4L9E A;  1S66 L;  3HJI A;  4Y2F A;  4MCW A;  3LID A;  2KLI A;  1ZTU A;  3MJQ A;  3EWK A;  4GW9 A;  1UWN X;  4MN6 A;  1T1A A;  5L8M A;  1ATX A;  1OT9 A;  4FSF A;  3OOV A;  2VV8 A;  1WQK A;  3PYP A;  5AVF A;  2O9C A;  1OT6 A;  3EGD C;  4R6L A;  1BYW A;  1W63 M;  3LFV A;  4HJ6 A;  4IUK A;  1TD5 A;  4GV5 A;  3R4K A;  3E4O A;  3C30 A;  2KDK A;  2O9B A;  4M4X A;  4NXG A;  1P9R A;  4EEU A;  4GLQ A;  4F3L B;  1X0O A;  3PBT A;  5DJT A;  1H8M A;  2O99 A;  3LR3 A;  4GJ4 A;  2PHY A;  5F68 A;  3R7W B;  4XT2 A;  3MQQ A;  4HNB A;  4WLA A;  5HWV A;  3UB9 A;  3RFB A;  4DJ2 A;  1D06 A;  3A0S A;  4GS9 B;  1P0Z A;  2V1B A;  2QYB A;  3B47 A;  3RTY A;  3VE4 A;  1XJ3 A;  3P01 A;  1Y28 A;  2VZW A;  2MUB A;  4ARZ B;  5KIZ A;  1ZUE A;  4EES A;  3MQO A;  4HIA A;  2MJ6 A;  3KEZ A;  2G7U A;  2QKP A;  1MC0 A;  5IU1 A;  2SH1 A;  1YSQ A;  4KUK A;  2W3F A;  3PBR A;  2D02 A;  2QWS A;  1OTB A;  3OCL A;  2IKE A;  4GHI B;  4MMN A;  2J3W A;  4L9F A;  3R7W A;  3K3C A;  2ZMV A;  4LRY C;  1SH1 A;  3BQ8 A;  4GS9 A;  1S1Z A;  3E4P A;  3PBQ A;  2OWJ A;  3C8C A;  2VEA A;  3KX0 X;  3K2N A;  2W3D A;  2K2N A;  3TRC A;  3VOL A;  2VA0 A;  2JKT I;  1V9Z A;  2L4R A;  3F1N B;  4KUO A;  1OTE A;  1S67 L;  2EA9 A;  4WUJ A;  5TBM B;  2JKR I;  1DP9 A;  4GHI A;  4OOL A;  5J3W A;  4HOI A;  4BBT A;  2QJ7 A;  3T4S A;  4PAU A;  4I5S A;  1TS6 A;  2V0W A;  4E04 A;  3PR6 A;  2B02 A;  2OAP 1;  5K5B A;  3D72 A;  3JVV A;  4PKY A;  3ULF A;  2P08 A;  2HJE A;  2XSS A;  3CUE C;  4L0L A;  5DKK A;  4G3K A;  2Y8H A;  4YNR A;  1ZLI B;  1V9Y A;  3H7W B;  1P9W A;  1XJ4 A;  2QJ5 A;  5F6A A;  2H9X A;  1NLY A;  4CLC E;  1H5O A;  1D7E A;  3V67 A;  1DP6 A;  3F1N A;  2IKD A;  2BAS A;  1S4R A;  2XXL A;  3BWL A;  5TBM A;  3KSH A;  4B9O A;  1DRM A;  3MYV A;  2V9A A;  1MZU A;  4EW7 A;  1ZHH B;  2A24 B;  2D01 A;  1F98 A;  4UQI S;  2L1M A;  4R70 A;  1WA9 A;  3MQ0 A;  2NUT C;  2HGV A;  4R38 A;  3D4U B;  1UGU A;  2M7U A;  4EXO A;  1NWZ A;  2OAQ 1;  4HP9 A;  3LIB A;  3IS2 B;  1OTD A;  5HL6 A;  4WF0 A;  5AVE A;  4EUV A;  1JNU A;  1YAX A;  5HSQ A;  4BJP A;  1IOU A;  2ZOH A;  1G6O A;  4OOM A;  1LL8 A;  3LR5 A;  2B18 A;  3PXP A;  2A24 A;  3H82 A;  3G6O A;  3S7N A;  2QSH A;  1LSX A;  3TJZ C;  3F1O B;  2JTO A;  2FZ0 A;  3S7Q A;  1NRJ A;  3LUQ A;  4I38 A;  4FOF A;  4JGQ A;  2VV7 A;  4NKP A;  1ZUF A;  3CIT A;  1T19 A;  3JVU A;  4MN5 A;  3ZYT A;  2VKS A;  3GDI A;  5DFY A;  3LMS B;  2INW A;  5A8B A;  2VGL S;  2Y79 A;  3B42 A;  3GEC A;  4I3I A;  3BW6 A;  4WN5 A;  5TJJ A;  2JKT M;  2J3T D;  1ODV A;  4MDZ A;  1TF1 A;  1NLZ A;  1IFQ A;  2P7J A;  4Y3I A;  3T4O A;  4EET B;  4YWZ A;  3KO6 A;  5HDD A;  3EOI A;  3NJA A;  5HPI A;  1AHL A;  1H3Q A;  3NOT C;  3TW8 A;  2PR5 A;  3LI9 A;  4F3L A;  3EEA A;  4HP4 A;  4CQH A;  2VJW A;  2HV1 A;  2VLG A;  3MCX A;  1STZ A;  1LSW A;  2W1T B;  3HJK A;  3E98 A;  5CX7 A;  5C5K A;  5HDC A;  3DBA A;  3H9W A;  4L9G A;  4Y5F A;  1XFQ A;  4LPZ A;  3D3O A;  4YOF A;  4P6Z M;  2PR6 A;  4ARZ A;  3BQA A;  2EWV A;  3CI6 A;  5F5Y A;  5HD3 A;  1TS0 A;  2IA2 A;  5DKL A;  2YKH A;  2RNG A;  3UE3 A;  3LIE A;  5F69 A;  2KOI A;  4UQI M;  4BBV A;  3T50 A;  5G4Y A;  3CLO A;  3FG8 A;  1D6B A;  4EU0 A;  4HHD A;  4Q0I A;  3UE6 A;  4BWI A;  2W1T A;  5HDS A;  1XJ6 A;  2GNX A;  3BY9 A;  3UMD A;  2A2L A;  2PD8 A;  4DJ3 A;  5AJG A;  1GSV A;  3T4T A;  4HJ3 A;  3W2Z A;  4JGP A;  3NOU C;  2OOL A;  3IBR A;  2FH5 A;  2WKR A;  2GZA A;  1DP8 A;  5IT5 A;  2L0W A;  3VE3 A;  1OJG A;  4KQD A;  4H6J B;  4G3V A;  4LRZ E;  4O8G A;  3EGX C;  3K3D A;  3NHQ A;  3UB6 A;  1S4S A;  3ICY A;  1B8W A;  4K08 A;  4ETX A;  2HF6 A;  3OC2 A;  3NOP C;  4EEP A;  5J4E A;  2M7V A;  3FPV A;  4YIR A;  3UB8 A;  1OJ5 A;  2W3E A;  2Z6D A;  3H7W A;  1P97 A;  2VGL M;  2QSF A;  1YSP A;  2O0Y A;  3U2A A;  5EFW A;  2QSG A;  1SHI A;  4ETZ A;  3LR0 A;  1N9N A;  3KSI A;  3KYZ A;  5I5L A;  3RH8 B;  4ME4 A;  3VV4 A;  4NXB A;  2BDS A;  3MXQ A;  3PBO A;  5HWT A;  2WKQ A;  1EW0 A;  1T1C A;  5HD5 A;  2JN7 A;  2H28 A;  3BJN A;  4PHT A;  4CLC C;  3KSF A;  1T18 A;  3B33 A;  1G28 A;  1XJ2 A;  4O01 A;  4NXE A;  2EWW A;  4HJ4 A;  2P04 A;  1VB6 A;  4XT2 B;  3E0Y A;  3MFX A;  4HH3 A;  3F1P B;  4BBU A;  1LT0 A;  1OPX A;  5LBR A;  2PT7 A;  2ZOI A;  4WEL A;  4WEJ A;  3OBF A;  4DMZ A;  3BY8 A;  3SW1 A;  2XA7 S;  4BMW A;  2Z6C A;  3IS2 A;  4NXF A;  4DN0 A;  2PYR A;  4IUH A;  3FC7 A;  2HJ9 C;  2DLA A;  1APF A;  3CAX A;  5MC7 A;  4PKY G;  3LIC A;  1N9L A;  2VX8 A;  2LB9 A;  2MN3 A;  2JKR M;  3CUE A;  1YKD A;  4NEE D;  3F1O A;  1F9I A;  1XFN A;  4O0P A;  3F1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...