1ZHHB

Crystal structure of the apo form of vibrio harveyi luxp complexed with the periplasmic domain of luxq
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
221
structure length
208
Chain Sequence
RTKQQTSALIHNIFDSHFAAIQIHHDSNSKSEVIRDFYTDRDTDVLNFFFLSIDQSDPSHTPEFRFLTDHKGIIWDDGNAHFYGVNDLILDSLANRVSFSNNWYYINVMTSIGSRHMLVRRVPILDPSTGEVLGFSFNAVVLDNNFALMEKLKSESNVDNVVLVANSVPLANSLIGDEPYNVADVLVIETPIVVNAVTTELCLLTVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Autoinducer 2-binding periplasmic protein luxP
publication title Regulation of LuxPQ Receptor Activity by the Quorum-Sensing Signal Autoinducer-2.
pubmed doi rcsb
source organism Vibrio harveyi
total genus 64
structure length 208
sequence length 221
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09308 LuxQ-periplasm LuxQ, periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.20.100 Mainly Beta Single Sheet Anthopleurin-A Anthopleurin-A 1zhhB02
3.30.450.220 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1zhhB01
2HJ9C 2HJEA 3C38A 3C30A 1ZHHB
chains in the Genus database with same CATH superfamily
1H0MA 2OAQ1 4YIRA 1PYYA 1TEMA 1Y4OA 1LSXA 3MQ0A 4I38A 4PAUA 5DFXA 4E3IA 2HDQA 4N9KA 3PAEA 1ZKJA 4BLMA 4EUZA 2Y8HA 4K0WA 3NC8A 4IBXA 5HWWA 4ESPA 3AGDA 2QHKA 1D06A 2B9KA 4F3LA 1L0DA 5CXWA 4C6YA 1KE0A 2QWSA 1M40A 5G4YA 4UA7A 4OQGA 1E25A 1H8ZA 1VEUB 3Q1FA 3AGFA 1ACFA 3BJNA 3E4QA 2OWJA 4OQHA 2W27A 3W8KA 4HP9A 1ZC2A 1LSVA 3BQ8A 5FI7A 3IF6A 1V9YA 4ZJ1A 4P6BA 1EI5A 3CI6A 3QNBA 3OPHA 2RNGA 3EGXC 2WADA 1H3QA 3O86A 3H9WA 2WGIA 1U60A 3EGDC 4OOLA 3LI9A 5FATA 3VP4A 1GA9A 1IKIA 5L2FA 4YFMA 4X53A 3C7UA 4G3KA 2V0UA 4DE3A 3LIDA 4UHUA 2WGWB 5EV0A 5L09A 3V3SA 3O88A 1OTEA 2WZXA 3HJKA 4PMAA 4OOMA 1KVLA 1RP5A 2WAEA 1SZVA 3C4PA 4X25A 1BLPA 4EU0A 2H0TA 1G5UA 4OP8A 3TW8A 4S2MA 2IKEA 1YAXA 3HVFA 3O5YA 4Y0TA 3B33A 5FEFA 1EW0A 3IQAA 3ZFZA 1NYMA 4NXEA 2Q0OA 4QPRA 1VM1A 3G2YA 3EEAA 1GA0A 3JPUA 5HPIA 5FAPA 4ZAMA 1GSWA 5GLBA 4WMCA 2HDSA 1K6RA 3GSGA 4IBRA 2WYXA 4ZJ2A 2HP9A 4KQDA 4DMZA 5TJJA 1P0ZA 4X68A 2IA2A 1MWRA 1PW1A 5CHUA 1LL9A 4RYEA 2ZM0A 3HBRA 3VFFA 1Z6FA 4R0QA 4UAAA 2JTOA 2XLNA 4MNRA 3HUOA 4BWIA 4NXGA 3D4FA 3IXBA 4EEUA 1P9RA 4S2LA 1DY6A 4WUJA 3PR6A 1TDGA 3VOZA 2Y2QA 2BLSA 2XFTA 1ES2A 1BUEA 4JF5A 2HGVA 2X02A 4NEED 4Z9QA 5LBRA 4PM9A 1MKMA 2PR6A 1VETA 5DF8A 2V0WA 3PBTA 3MBZA 1DP8A 3SS3A 1L0EA 4JBFA 2PRFA 4NG2A 4CLCE 1K57C 2XH9A 3A3FA 2L4RA 3G6OA 3HLCA 1Z09A 4CQHA 1OTBA 4E3NA 3UE3A 2MJ6A 1Z99A 5KIZA 1IELA 4HBUA 3A3DA 1UWPX 1L2SA 2K7SA 4JXWA 5DKLA 1YLWA 1MWSA 1ONHA 3U2AA 3A0VA 4KG6A 1S4SA 2NUPC 2XSSA 3VOYA 2JCHA 3A0RA 2PU4A 2VV6A 4BENA 3RXXA 5I5LA 1BLCA 4S2JA 4FUWA 4BL2A 4WEKA 4XUXA 5FAQA 4H8RA 5FL3A 5A93A 1WE4A 4OLDA 4L9GA 2FH5A 4FCFA 2R9WA 2W3HA 1Q2PA 1K57A 3ZNYA 2V1BA 5A92A 5HD3A 3UE6A 5FQ9A 1SDNA 4Y15A 4OH0A 5CGSA 4E3JA 2VLGA 4QHCA 2ZC4B 5HWTA 4EBPA 3G32A 3EWKA 3GMWA 3VOLA 2PR5A 1P97A 3ITBA 4X56A 3ZYTA 1EWZA 3F1PA 4XXRA 1SKOA 4S2KA 4N92A 3T4QA 2BG1A 4GNUA 3T4SA 1BT5A 3MZDA 2ZMAA 5HL1A 1N9LA 3NHQA 4LRXC 3FPVA 3NIAA 2RL3A 1HVBA 3UPOA 2FFYA 2VKSA 1YPRA 3NOPC 4I5SA 3ZG7B 3UNWA 5HW3A 2P9VB 2QSFA 2LB9A 4MN7A 1PI4A 3D3OA 4WM9A 4Q0HA 2ZQ9A 2K31A 3B47A 4R3AA 3BLMA 3GR2A 4OQIA 4WBGA 3ZVTA 3ISGA 2HZ5A 4X1MA 3SS5A 4MN6A 2JBFA 5HDSA 5CERA 3CHWP 3VV4A 1T18A 3T1XA 4LV0A 4E3LA 2ZMVA 4XT2B 4R70A 5JYOA 4OOYA 3S4XA 1BSGA 1W5DA 3BM6A 3ZNTA 1T1BA 5FI6A 2VJWA 3BFFA 2O9BA 3UY6A 4B9OA 1QMFA 1YLTA 4XUZA 3NDGA 1D6BA 2VGLS 2B18A 3NJAA 3BEBA 2QSGA 1NZOA 4MN5A 2Y4AA 1QMEA 1W7FA 1TVFA 5CGWA 3IS2A 5CHJA 4HP4A 3E98A 1GHMA 3MXRA 1XJ3A 1PIOA 4BJPA 2EX8A 4KZ4A 1L3LA 5L10A 3BLSA 4OP5A 5DF9A 1ONGA 5L8MA 3UDIA 4EETB 5HPFA 2OSUA 4KG2A 4B4ZA 3MXQA 1M6KA 1TS8A 4WZ4A 3AGEA 4CLCA 1PWCA 1NLZA 4HY8A 2HDUA 2C5WB 1RCJA 1AXBA 2DLAA 4QWOA 3UPPA 3K2NA 1IFQA 4L9FA 4UQIS 3G34A 3LR4A 2I72A 1MKIA 4LCLA 3IWOA 3LY3A 3RXWA 4KZ9A 3MSHA 3ZCZA 2QJ7A 4QJGA 1WYBA 5F69A 4M4XA 2HP6A 2PBDP 3DWZA 5HWVA 3JVVA 4HEFA 3KSFA 3GV9A 3QP2A 5M1AA 3PBRA 1DJCA 4LV1A 2Y2LA 3BY8A 2VGLM 5AQ7A 3TJZC 5TBMA 2A24A 4KZ8A 1YLZA 3OBFA 2V8FA 2XQZA 3Q81A 2NUTC 3MFDA 5J7EA 1STZA 2UV0E 5J8XA 2B02A 5TR7A 3H7WA 3DWKA 2X71A 3CPTB 3NBLA 2Z6CA 5AQBA 4E3OA 1YSQA 3SS4A 2JE5A 1MWTA 1BDSA 1YMXA 4UQIM 4GHIB 1XXMA 3KSIA 4O01A 4ZTKA 2JN7A 1G68A 1H8MA 4LFUA 5FI2A 1EL6A 4C3QA 3KYEA 1DJBA 3D4UB 3HLDA 4BD0A 3V50A 1AWIA 2H0YA 1LLBA 2M1CA 2W3EA 3SOIA 5FQKA 3BY9A 2V2FF 3KYQA 4Y7PA 3IBJA 4X55A 3HLWA 1T1CA 4I39A 4P87A 2ZBBA 4JGOA 3FG8A 4LPZA 3MZEA 4B93A 3WRTA 3P09A 4FH4A 2OAP1 2V20A 3EQVA 4BMWA 4NKPA 4OVDA 4LLOB 4OLGA 4IVIA 4WZ5C 4DF6A 4GN2A 2QKPA 4Y5FA 1FQGA 3T4JA 1JWVA 3W4QA 2SH1A 3KYZA 1ZG6A 1VEUA 2JKFA 2PU2A 2G7UA 4X1LA 2MN3A 2XXLA 2Y2PA 4JGQA 3MCXA 4EEPA 3S7OA 4JLFA 4BQMA 3MZFA 4MBHA 1V9ZA 1KE4A 3IF5A 1DP9A 5KSHA 2PD8A 3QP5A 1XA7A 5HFOA 2XD1A 1F98A 1YKDA 3LIFA 3FPWA 2ZQCA 2GDNA 1SHVA 3SH7A 2KX6A 3CG5A 2ACGA 1W63M 1E3UD 3T1SA 2EA9A 1H5OA 5J4EA 2BTFP 3KSHA 1E3UA 3NOTC 4IUHA 2WGWA 2HP5A 2I9VA 3PBNA 4E6WA 3UDXA 4EXOA 5CEBA 1ESUA 4GCZA 4I3AA 3ZG8B 2WKPA 2ZM2A 3IBRA 5HZHA 1IKGA 4GS9B 3B3XA 3MS6A 3WWXA 3WS2A 2J3WA 5HAPA 1Y28A 5E43A 5EVLA 3LEQA 3LUQA 4GJ4A 3IX4A 4B4XA 3HLBA 1ZUFA 4HJ3A 1N9OA 1IEMA 4EUVA 5HL6A 2K2NA 3F1OB 1S1ZA 2W1RA 4P85A 3IXDA 1W8QA 3C2WA 3TOIA 4QB8A 5HX9A 1H5XA 4IVKA 5CRFA 3B42A 2DCFA 3FKVA 1W63Q 1BLSA 1IYOA 2OWHA 3ICYA 2BDSA 2P74A 2VEAA 4IUKA 2VV7A 3QP8A 2P08A 4O0PA 4FOFA 2L1MA 3QNCA 1TS6A 3NDEA 2XROA 1BULA 3MQQA 4Y0OA 4DKIA 4FSFA 1NYYA 2OOLA 4O8GA 1XJ2A 1JVJA 3OOVA 5F1FA 2O9CA 4KZ6A 3LFVA 4LENA 1LSWA 2ZC5B 3G4PA 1HLUP 2XGNA 4BBUA 3UN7A 1KGGA 2WK0A 3MYVA 3OCNA 2OLUA 2JC7A 2LB5A 4GV5A 1FSYA 4S2NC 2JR3A 4UA9A 4U3TA 4GZBA 1VQQA 2IWDA 3CJMA 2J3TD 2ZC6B 4KZ5A 1FCNA 4WN5A 5EVID 3SH9A 5EM0A 2CC1A 1XA1A 4FTXA 4JKTA 1Q2QA 5GLCA 3KEZA 2PAVP 2HF6A 3PHYA 4GB7A 3MR0A 5EVIB 3C8CA 3BYDA 2O9AA 1ZTUA 3UB6A 3DW0A 4QY5A 3Q7VB 4BBVA 4D2OA 3N6IA 2Z2LB 2W1TA 2PBYA 3FWLA 1S0WA 4HHDA 1W8YA 4CJNA 4KZAA 1OJGA 2ZLYA 4ETZA 4UA6A 2W1TB 4BL3A 5F1GA 1NWZA 3IWQA 4S2NA 3W4PA 3LY4A 4EV4A 1OPXA 3NY4A 4NXBA 2QPNA 1ZG4A 4DXCA 3T1RA 3PBSA 1J9MA 5HAQA 1CK3A 2IWCA 2CMNA 3LYXA 4QU3A 1KVMA 3EQUA 1GSXA 3HUMA 2KDKA 2J9OA 1L0GA 3BQAA 2Y79A 2GJ3A 2PYPA 3NI9A 4WEJA 3ZGAB 1ERQA 5HAIA 4ZRRA 3R7WB 3JVUA 1ZLIB 4PM8A 4K0XA 1TS0A 2W3DA 1I2SA 2ZC7A 2HV1A 2ZL1B 4ZDXA 3UDFA 3E4OA 1XFQA 3LR0A 2Y2JA 5CHMA 3MKEA 4II7A 4R38A 1CEGA 5DJUA 4KZBA 2E8JA 1S66L 4U0TA 3UO9A 5TGFA 2A49A 2PD7A 4JGPA 5EOOA 4HH2A 1WXNA 5IT5A 3EEHA 5FQJA 1D7EA 5IS1A 4ID4A 2P9VA 3DAVA 4YOFA 2BASA 4X6TA 2H9XA 3M6BA 5FQIA 2EFUA 4PHTA 4I3JA 1PRQA 5D3OA 1GKUB 4PM5A 3P01A 1ESIA 2IKDA 2WUQA 1W79A 1PW8A 3BRMA 5EFWA 3RTYA 3G35A 2H10A 4MBFA 5J3WA 1CJFA 1NLYA 4Y0UA 4N1HA 2ZC3B 5DVAA 3BW6A 3S22A 2Q9NA 2EWWA 2V9AA 4XT2A 2WAFA 1NZUA 1TF1A 2ZQ8A 3V3RA 4ARZB 4JXGA 3LI8A 1GL9B 4KG5A 4M3KA 5FAOA 3D72A 2WGVA 1FSWA 2XFSA 5E2EA 5HARA 3ZG9B 2ZJ9A 4JGRA 1BZAA 2O99A 1F5MA 1DJAA 2Q9MA 4N1XA 5F83A 5G4ZA 5M19A 1PZOA 3IHAA 2VX8A 3VP1A 4EW7A 5GHYA 3GTCA 2UWXA 2WZZA 4BD1A 5DF7A 2DMWA 3W4OA 3FC7A 1FR1A 4DN0A 4C75A 3D9YA 4DE2A 3QP6A 1CI8A 1K6SA 2Y59A 4KUOA 5HD5A 3C7VA 5FDSA 4S2IA 1HD8A 5C5KA 3KX0X 4P0MA 2O0YA 4R3BA 3GDIA 1O07A 2Y55A 3TSGA 4PKYG 3IX8A 1S6RA 4GD6A 1MPLA 4MDZA 1D1JA 1XGIA 4AFIA 1K4EA 2EX9A 3WS5A 5EECA 3KO6A 3CZDA 4WF0A 5E2FA 1GCEA 1JTDA 3IHBA 1NXYA 4EERA 1S1YA 4WELA 3NECA 3A3IA 4HIAA 1LHYA 3TRCA 1YSPA 3L7HA 1I5QA 4H6JB 3H82A 3UB9A 3KSGA 4LGWA 3G31A 3CUEC 3H82B 1SH1A 3HL9A 3TG9A 4F94A 3RH8B 1LT0A 3RJUA 4ZJ3A 5E2GA 3VP3A 1F2KA 3CPTA 1RGYA 4NETA 3ITAA 1O7EA 1PWGA 4KQQA 4GOGA 2GNXA 4HJ4A 4N9LA 3OC2A 3DTEA 3UMDA 1ES3A 2ZOIA 4GHIA 1G28A 1PWDA 1YM1A 4HOIA 5FQMA 3IH9A 1OJ5A 2A2LA 5FEGA 1NY0A 3OPLA 3LICA 3N8LA 2JKTI 3F1NB 1OTIA 3S7NA 2R9XA 3BFCA 4IJGA 4QY6A 1TDLA 2OLVA 1FCMA 1E4DA 4MEZA 2WKRA 4EESA 1Y54A 2WKHA 1K4FA 4DE1A 3V5MA 3BFGA 4O7DA 3IWIA 4DRTA 3E2LA 1T19A 1SHIA 5DTSA 3VSKA 3T1QB 1LL5A 3UMEA 3DBAA 1RGZA 3IF6C 4GDNA 4LV3A 2WKQA 3T12B 2G2WA 2QMIA 5CGXA 2XD5A 1OTAA 1S67L 5EOEA 1KGEA 3QP4A 3V67A 4FH2A 2ZQ7A 5HDCA 4WYYA 4E6XA 3N8SA 5A91A 2WKEA 3SZTA 2PT7A 2X01A 1YQSA 3W2ZA 3LMSB 3K3CA 2JKTM 3VE4A 3MXSA 4LRYC 3C38A 1X0OA 4ZBEA 2W3FA 4JF6A 2YKFA 5A90A 3Q82A 1S4RA 2EFXA 2ZM8A 3PBQA 2A3UA 3G30A 5G18A 3HUNA 3IXHA 3ZQ5A 1PNEA 4GDBA 4F3LB 5DJTA 2HDRA 2PYRA 3L9KA 1H8YA 1WQKA 3HREA 3TE8A 5DKKA 3S1YA 1HTZA 1YT4A 3ZG0A 4GS9A 5AQAA 5GLDA 1ERMA 2GZAA 3A3EA 2VV8A 4R4RA 2QZ6A 4KENB 4LRZE 5F82A 3MF0A 3IF6B 1MC0A 4WZ5A 4G3VA 3HLFA 3G2ZA 3WRZA 3P7NA 2YKHA 2JKRI 3F1OA 1ZHHB 5GHZA 2P04A 4P6ZS 3OPRA 4R23A 5FDHA 5AVEA 5IU1A 3A0SA 4Q0JA 5GHXA 1VB6A 2EX2A 3OLOA 1K38A 3IT9A 5KMWA 1GSVA 3FYZA 5CTMA 3UE0A 2R78A 1SKFA 1YLYA 4JXVA 3A3JA 2XA7S 4KZ7A 3Q7ZA 4L0LA 4KZ3A 2J3TC 2XK1A 3PTEA 2W3GA 3M6HA 2Y2KA 2EXBA 5EUAA 4E04A 2B95A 4DDSA 5BOHA 2AVXA 1JWPA 3QHYA 2E8IA 5EVIC 2XR0A 3N7WA 2VA0A 2QYBA 4PM6A 4PKYA 1B8WA 3BFEA 3DTKA 3LEZA 4PM7A 3CITA 2JKGA 4WMCD 3Q07A 1ODVA 3MQOA 4L9EA 1WA9A 1FIKA 1VHMA 3OZHA 4RA7A 4R1GA 5CX7A 2JKRM 5A8BA 4WL9A 1K0KA 3WS1A 1FCOA 1IYSA 3ZHHA 5FQQA 4K08A 3PYPA 2P7JA 4D60A 3LCEA 2QSHA 4P6ZM 5AVFA 3ZG5A 3QP1A 1CI9A 1JWZA 1BLHA 5MC7A 2VGJA 1DP6A 2VK3A 2PDRA 3UPNA 3ULFA 4R6LA 2Y2GA 3GVBA 2ZMFA 2XA7M 1EROA 1OMEA 1CQAA 1MBLA 5EVIA 4CPKA 1DRMA 1F9IA 3M2KA 4WLAA 2XDMA 4PPRA 2RCXA 4S2OA 3Q7VA 2MUBA 5EM1A 2H5SA 3U4LP 4MLLA 2Y2HA 5FASA 4Y17A 4HBTA 2FZ0A 1IYPA 3NCKA 3CAXA 1J3WA 4OPZA 1K56D 5F6AA 4OPRA 1K56A 3VP0A 3HCYA 4GD8A 4EQIA 1C3BA 1MWUA 1YLJA 1NRJA 5FSRA 1VETB 2XEPA 3LGOA 3P98A 4MMNA 4IHQA 3PAGA 3OCLA 3UB8A 1KDSA 2IWBA 4FD8A 1OT6A 3O3VA 4E3MA 1CEFA 1MXOA 2J8YA 3BFDA 3UB5P 4YWZA 2PHYA 3MFXA 4OKPA 1FR6A 5CTNA 3IXGA 2FFFB 3LIBA 4Y13A 2Y2NA 3C5AA 1N9BA 4G3WA 5E2HA 1IYQA 3C4OA 4Y3IA 1MZUA 3PXPA 4UEYA 3R7WA 5CEDA 2Z2MB 4RX3A 2W0NA 2V1ZA 1ALQA 3E0YA 2VGKA 2ZOHA 1OTDA 3T4LA 1CF0A 3VP2A 2ZL1A 2DNSA 3V39A 3LR3A 3NOUC 3O87A 4HJ6A 2M7UA 2V8CA 1YLPA 4K91A 5F5YA 4JPMA 4Y2FA 3UB7A 2DRWA 1XKZA 2Y91A 4A5RA 5HSQA 3EOIA 3T50A 3GQZA 3CMZA 4JF4A 4NK3A 2EWVA 1XP4A 4OQ0A 3ZVWA 4Q0IA 4LV2A 4OPYA 5KZHA 2Y2IA 4DJ2A 1HZOA 4I3IA 2KLIA 4YINA 1LI0A 1SDEA 4OONA 2H28A 5GL9A 2ZD8A 3WS0A 3IF4A 4MBKA 1ZUEA 4QD4A 1YMSA 5GLAA 4DDYA 3NULA 2HJEA 3LO7A 3T4TA 2GX5A 4LCMA 2J9PA 3F1PB 1SKOB 1N4OA 4HH3A 4EWFA 2EXAA 1K25A 1NJ4A 3N8RA 1P9WA 1LI9A 3MMHA 1FILA 4ARZA 3LR5A 4BBTA 3IX3A 5EVEA 3T4OA 4GW9A 3PBOA 1ES4A 4R4SA 3JYIA 4RQ9A 3R4KA 3ZDJA 1BTLA 1AHLA 4MCWA 5F68A 3WS4A 4HESA 3VFHA 1FOFA 5FA7A 1XJ6A 3DTMA 3CWFA 2XRNA 3MKFA 4HQAA 1KDWA 4CLCC 3IH8A 3M2JA 1KGFA 3N4IA 5TFQA 4EBLA 1I2WA 3HJIA 5CECA 2G2UA 5AQ9A 1KOUA 1ATXA 4RX2A 3I7JA 1XGJA 2Y2MA 4EBNA 5U47A 1PI5A 1T1AA 4ETXA 2Y2OA 3E2KA 1IOUA 4R3JA 3RFBA 1UGUA 1UWNX 2OV5A 1LL8A 3FKWA 4Z1WA 1K55C 1XX2A 4DXBA 4RVAA 2VZWA 5DTKA 1G6OA 4JXSA 4X69A 2Z6DA 4EQ1A 2EX6A 1ES5A 3IS2B 1N9NA 4ME4A 2HJ9C 1XJ4A 3S7QA 5K5BA 2ZQAA 2INWA 4KUKA 3BECA 5HDDA 4CLCD 2M7VA 5KSCA 1PFLA 2D01A 4E3KA 4H6JA 3HLGA 3GECA 1BYWA 1ZLHB 3GRJA 3SW1A 4CLCB 1K54C 3T4KA 4NXFA 2ZQDA 1G6AA 1MY8A 2JHEA 3UE1A 1GHIA 5EPHA 4DJ3A 2QJ5A 4KQRA 4IEDA 3DTIA 3HLEA 5DFYA 4YNRA 1K55A 1TD5A 2D02A 3E4PA 1A0KA 3LIAA 2J80A 1WYCA 2XF3A 2C6WB 2K2XA 2J7VA 2B5RA 1JTGA 5TBMB 2A24B 5AJGA 3C30A 1XFNA 1SCWA 2KOIA 3F1NA 1KE3A 5M18A 5DTTA 1PZPA 1TS7A 4B88A 5IHVA 1JNUA 3H7WB 3SH8A 5I94A 5EE8A 1L0FA 3K3DA 3CLOA 4GKUA 4GLQA 4KQOA 4DE0A 1K54A 4HI4A 1APFA 3VSLA 5JYPA 1NRFA 3LIEA 3FV7A 3CUEA 1XPBA 3MJQA 3VMAA 4U0XA 2L0WA 2HPBA 4Q8IA 5L07A 1OT9A 3S7PA 3BWLA 1GHPA 2WKIA 3FZCA 4S2PA 3OPPA 4OPQA 3VE3A 4HNBA 2V1AA
chains in the Genus database with same CATH topology
2OAQ1 3MQOA 4L9EA 1WA9A 4YIRA 3E98A 1VHMA 1XJ3A 1TS0A 5CX7A 2JKRM 2W3DA 4BJPA 5A8BA 1LSXA 2HV1A 3MQ0A 4I38A 4WL9A 4PAUA 5DFXA 3E4OA 1XFQA 3LR0A 5DF9A 5L8MA 4K08A 4EETB 3PYPA 5HPFA 2P7JA 4II7A 2Y8HA 4R38A 3MXQA 1TS8A 2QSHA 4P6ZM 5HWWA 5DJUA 5AVFA 2QHKA 4CLCA 1NLZA 4HY8A 1S66L 2DLAA 2PD7A 5MC7A 4JGPA 3K2NA 4HH2A 1IFQA 1D06A 4L9FA 4UQIS 1WXNA 2B9KA 4F3LA 3LR4A 5IT5A 3EEHA 1DP6A 1D7EA 2PDRA 5IS1A 3ULFA 2QWSA 4R6LA 5G4YA 4YOFA 2QJ7A 2ZMFA 2XA7M 2BASA 5F69A 1DRMA 4M4XA 2H9XA 3BJNA 1F9IA 3E4QA 2OWJA 4WLAA 5HWVA 3JVVA 2W27A 3KSFA 4PHTA 4HP9A 2MUBA 1LSVA 3BQ8A 4I3JA 3PBRA 1V9YA 3BY8A 2VGLM 2FZ0A 3P01A 3CAXA 3CI6A 3TJZC 2IKDA 2RNGA 2A24A 5TBMA 3EGXC 5F6AA 3OBFA 5EFWA 1H3QA 3RTYA 3H9WA 3EGDC 4OOLA 3HCYA 3LI9A 2NUTC 5J3WA 1NLYA 1STZA 5J7EA 2B02A 3BW6A 1NRJA 3H7WA 4G3KA 4MMNA 4IHQA 2EWWA 2V9AA 4XT2A 2V0UA 3OCLA 3LIDA 3UB8A 1TF1A 4ARZB 3LI8A 1OT6A 2Z6CA 1OTEA 3HJKA 4YWZA 2PHYA 3D72A 3MFXA 4OOMA 1YSQA 1BDSA 4EU0A 3LIBA 4UQIM 4GHIB 3TW8A 4G3WA 2IKEA 3KSIA 4O01A 1YAXA 4JGRA 4Y3IA 2JN7A 1H8MA 2O99A 1F5MA 1MZUA 3O5YA 3PXPA 4UEYA 3B33A 3R7WA 1EW0A 5G4ZA 3D4UB 2VX8A 4NXEA 4EW7A 2W0NA 4QPRA 3EEAA 3E0YA 2M1CA 2W3EA 2DMWA 3FC7A 2ZOHA 4DN0A 5HPIA 1OTDA 3BY9A 3T4LA 3KYQA 1GSWA 3IBJA 4KUOA 5HD5A 1T1CA 3LR3A 3NOUC 4I39A 4HJ6A 2ZBBA 4JGOA 3FG8A 2M7UA 4LPZA 4B93A 5C5KA 3KX0X 4KQDA 2O0YA 2OAP1 5F5YA 3EQVA 4DMZA 4BMWA 4Y2FA 3GDIA 4NKPA 3UB7A 5TJJA 1P0ZA 3EOIA 5HSQA 3T50A 4PKYG 4LLOB 2IA2A 2EWVA 4Q0IA 2QKPA 4MDZA 4Y5FA 3T4JA 4AFIA 4DJ2A 2SH1A 3KYZA 4I3IA 2KLIA 2G7UA 2H28A 3KO6A 2MN3A 2XXLA 4WF0A 2JTOA 4JGQA 3MCXA 4EEPA 3S7OA 4BWIA 4NXGA 1ZUEA 4EERA 1S1YA 4WELA 4EEUA 1V9ZA 1P9RA 4HIAA 4WUJA 3PR6A 3TRCA 1YSPA 2HJEA 1DP9A 3T4TA 2GX5A 3F1PB 4H6JB 5KSHA 2PD8A 1F98A 1YKDA 3LIFA 3H82A 3UB9A 3FPWA 3KSGA 2HGVA 4NEED 4HH3A 5LBRA 2KX6A 3CUEC 1W63M 1MKMA 1H5OA 2EA9A 3H82B 1SH1A 1P9WA 5J4EA 2PR6A 3KSHA 3NOTC 2V0WA 3RH8B 3PBTA 1DP8A 1LT0A 4IUHA 2I9VA 3MMHA 4ARZA 3PBNA 3LR5A 4CLCE 4BBTA 4EXOA 3T4OA 4GCZA 4GW9A 4I3AA 2WKPA 3PBOA 3IBRA 5HZHA 2L4RA 4GS9B 3G6OA 4CQHA 1OTBA 2GNXA 4HJ4A 4RQ9A 2J3WA 1Y28A 3OC2A 3UE3A 3UMDA 3LUQA 2MJ6A 2ZOIA 1Z99A 4GHIA 4GJ4A 1G28A 5KIZA 3R4KA 4HOIA 1UWPX 1AHLA 1OJ5A 2K7SA 4MCWA 5F68A 1ZUFA 2A2LA 5DKLA 4HJ3A 1N9OA 4EUVA 3U2AA 5HL6A 3A0VA 2K2NA 1S4SA 1S1ZA 2W1RA 1XJ6A 3F1OB 3LICA 2NUPC 2XSSA 2XRNA 3CWFA 2JKTI 3F1NB 1OTIA 4HQAA 3S7NA 3A0RA 3C2WA 4IJGA 4CLCC 2VV6A 5I5LA 3HJIA 1KOUA 3B42A 4WEKA 1ATXA 2WKRA 4EESA 1W63Q 2OWHA 5FL3A 3ICYA 2BDSA 1T1AA 2VEAA 4IUKA 4L9GA 2VV7A 4O0PA 2P08A 4ETXA 4FOFA 2L1MA 1T19A 1IOUA 2FH5A 1SHIA 3RFBA 1TS6A 2XROA 1UGUA 1UWNX 2W3HA 1LL8A 3UMEA 3DBAA 4Z1WA 2V1BA 2WKQA 3MQQA 2VZWA 5HD3A 4FSFA 1OTAA 1S67L 1G6OA 3UE6A 2OOLA 2Z6DA 3V67A 4EQ1A 4O8GA 3IS2B 1N9NA 1XJ2A 4ME4A 5HDCA 2VLGA 3OOVA 2HJ9C 1XJ4A 2O9CA 3S7QA 3LFVA 5HWTA 5K5BA 2PT7A 1LSWA 2INWA 4BBUA 3EWKA 4KUKA 3VOLA 2PR5A 1P97A 3LMSB 5HDDA 3W2ZA 3K3CA 2JKTM 3VE4A 4CLCD 3MYVA 3OCNA 3ZYTA 4LRYC 2M7VA 2LB5A 3C38A 2D01A 1X0OA 3F1PA 4GV5A 4H6JA 2JR3A 3GECA 1BYWA 1ZLHB 2W3FA 3T4QA 2YKFA 1S4RA 3T4SA 2J3TD 3SW1A 1N9LA 3NHQA 3PBQA 4CLCB 4LRXC 3FPVA 3T4KA 4NXFA 4WN5A 3ZQ5A 4F3LB 2VKSA 2JHEA 3NOPC 4I5SA 5DJTA 4DJ3A 2PYRA 2QJ5A 1WQKA 3TE8A 3KEZA 5DKKA 2QSFA 2HF6A 2LB9A 3PHYA 4GS9A 3MR0A 5DFYA 3C8CA 4MN7A 4YNRA 2O9AA 2GZAA 2VV8A 1TD5A 2D02A 1ZTUA 3E4PA 3UB6A 3D3OA 3LIAA 4LRZE 4Q0HA 4BBVA 2J80A 2K31A 3MF0A 3B47A 4R3AA 1MC0A 4G3VA 2K2XA 2W1TA 3P7NA 4HHDA 4MN6A 2YKHA 5TBMB 2A24B 3F1OA 2JKRI 3C30A 1XFNA 5AJGA 5HDSA 1ZHHB 2P04A 2KOIA 1OJGA 3F1NA 4ETZA 4P6ZS 2W1TB 5AVEA 5IU1A 3A0SA 1TS7A 4Q0JA 3VV4A 1NWZA 1T18A 1VB6A 1JNUA 3OLOA 3H7WB 2ZMVA 4XT2B 4R70A 1OPXA 4NXBA 3K3DA 1GSVA 3CLOA 3PBSA 2R78A 4GLQA 4KQOA 1T1BA 1ZLIB 2XA7S 4HI4A 2VJWA 4L0LA 1APFA 2CMNA 3LYXA 2J3TC 2W3GA 3LIEA 3EQUA 1GSXA 2O9BA 4B9OA 3CUEA 2KDKA 3MJQA 4E04A 2L0WA 3BQAA 1OT9A 3S7PA 3BWLA 2Y79A 2GJ3A 2PYPA 2VA0A 1D6BA 2VGLS 2B18A 2QYBA 3NJAA 4WEJA 2QSGA 4HNBA 4MN5A 4PKYA 1B8WA 4ZRRA 3R7WB 3IS2A 3JVUA 3VE3A 3CITA 1ODVA 4HP4A 2V1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJ9 C;  2HJE A;  3C38 A;  3C30 A;  1ZHH B; 
#chains in the Genus database with same CATH topology
 1H0M A;  2OAQ 1;  4YIR A;  1PYY A;  1TEM A;  1Y4O A;  1LSX A;  3MQ0 A;  4I38 A;  4PAU A;  5DFX A;  4E3I A;  2HDQ A;  4N9K A;  3PAE A;  1ZKJ A;  4BLM A;  4EUZ A;  2Y8H A;  4K0W A;  3NC8 A;  4IBX A;  5HWW A;  4ESP A;  3AGD A;  2QHK A;  1D06 A;  2B9K A;  4F3L A;  1L0D A;  5CXW A;  4C6Y A;  1KE0 A;  2QWS A;  1M40 A;  5G4Y A;  4UA7 A;  4OQG A;  1E25 A;  1H8Z A;  1VEU B;  3Q1F A;  3AGF A;  1ACF A;  3BJN A;  3E4Q A;  2OWJ A;  4OQH A;  2W27 A;  3W8K A;  4HP9 A;  1ZC2 A;  1LSV A;  3BQ8 A;  5FI7 A;  3IF6 A;  1V9Y A;  4ZJ1 A;  4P6B A;  1EI5 A;  3CI6 A;  3QNB A;  3OPH A;  2RNG A;  3EGX C;  2WAD A;  1H3Q A;  3O86 A;  3H9W A;  2WGI A;  1U60 A;  3EGD C;  4OOL A;  3LI9 A;  5FAT A;  3VP4 A;  1GA9 A;  1IKI A;  5L2F A;  4YFM A;  4X53 A;  3C7U A;  4G3K A;  2V0U A;  4DE3 A;  3LID A;  4UHU A;  2WGW B;  5EV0 A;  5L09 A;  3V3S A;  3O88 A;  1OTE A;  2WZX A;  3HJK A;  4PMA A;  4OOM A;  1KVL A;  1RP5 A;  2WAE A;  1SZV A;  3C4P A;  4X25 A;  1BLP A;  4EU0 A;  2H0T A;  1G5U A;  4OP8 A;  3TW8 A;  4S2M A;  2IKE A;  1YAX A;  3HVF A;  3O5Y A;  4Y0T A;  3B33 A;  5FEF A;  1EW0 A;  3IQA A;  3ZFZ A;  1NYM A;  4NXE A;  2Q0O A;  4QPR A;  1VM1 A;  3G2Y A;  3EEA A;  1GA0 A;  3JPU A;  5HPI A;  5FAP A;  4ZAM A;  1GSW A;  5GLB A;  4WMC A;  2HDS A;  1K6R A;  3GSG A;  4IBR A;  2WYX A;  4ZJ2 A;  2HP9 A;  4KQD A;  4DMZ A;  5TJJ A;  1P0Z A;  4X68 A;  2IA2 A;  1MWR A;  1PW1 A;  5CHU A;  1LL9 A;  4RYE A;  2ZM0 A;  3HBR A;  3VFF A;  1Z6F A;  4R0Q A;  4UAA A;  2JTO A;  2XLN A;  4MNR A;  3HUO A;  4BWI A;  4NXG A;  3D4F A;  3IXB A;  4EEU A;  1P9R A;  4S2L A;  1DY6 A;  4WUJ A;  3PR6 A;  1TDG A;  3VOZ A;  2Y2Q A;  2BLS A;  2XFT A;  1ES2 A;  1BUE A;  4JF5 A;  2HGV A;  2X02 A;  4NEE D;  4Z9Q A;  5LBR A;  4PM9 A;  1MKM A;  2PR6 A;  1VET A;  5DF8 A;  2V0W A;  3PBT A;  3MBZ A;  1DP8 A;  3SS3 A;  1L0E A;  4JBF A;  2PRF A;  4NG2 A;  4CLC E;  1K57 C;  2XH9 A;  3A3F A;  2L4R A;  3G6O A;  3HLC A;  1Z09 A;  4CQH A;  1OTB A;  4E3N A;  3UE3 A;  2MJ6 A;  1Z99 A;  5KIZ A;  1IEL A;  4HBU A;  3A3D A;  1UWP X;  1L2S A;  2K7S A;  4JXW A;  5DKL A;  1YLW A;  1MWS A;  1ONH A;  3U2A A;  3A0V A;  4KG6 A;  1S4S A;  2NUP C;  2XSS A;  3VOY A;  2JCH A;  3A0R A;  2PU4 A;  2VV6 A;  4BEN A;  3RXX A;  5I5L A;  1BLC A;  4S2J A;  4FUW A;  4BL2 A;  4WEK A;  4XUX A;  5FAQ A;  4H8R A;  5FL3 A;  5A93 A;  1WE4 A;  4OLD A;  4L9G A;  2FH5 A;  4FCF A;  2R9W A;  2W3H A;  1Q2P A;  1K57 A;  3ZNY A;  2V1B A;  5A92 A;  5HD3 A;  3UE6 A;  5FQ9 A;  1SDN A;  4Y15 A;  4OH0 A;  5CGS A;  4E3J A;  2VLG A;  4QHC A;  2ZC4 B;  5HWT A;  4EBP A;  3G32 A;  3EWK A;  3GMW A;  3VOL A;  2PR5 A;  1P97 A;  3ITB A;  4X56 A;  3ZYT A;  1EWZ A;  3F1P A;  4XXR A;  1SKO A;  4S2K A;  4N92 A;  3T4Q A;  2BG1 A;  4GNU A;  3T4S A;  1BT5 A;  3MZD A;  2ZMA A;  5HL1 A;  1N9L A;  3NHQ A;  4LRX C;  3FPV A;  3NIA A;  2RL3 A;  1HVB A;  3UPO A;  2FFY A;  2VKS A;  1YPR A;  3NOP C;  4I5S A;  3ZG7 B;  3UNW A;  5HW3 A;  2P9V B;  2QSF A;  2LB9 A;  4MN7 A;  1PI4 A;  3D3O A;  4WM9 A;  4Q0H A;  2ZQ9 A;  2K31 A;  3B47 A;  4R3A A;  3BLM A;  3GR2 A;  4OQI A;  4WBG A;  3ZVT A;  3ISG A;  2HZ5 A;  4X1M A;  3SS5 A;  4MN6 A;  2JBF A;  5HDS A;  5CER A;  3CHW P;  3VV4 A;  1T18 A;  3T1X A;  4LV0 A;  4E3L A;  2ZMV A;  4XT2 B;  4R70 A;  5JYO A;  4OOY A;  3S4X A;  1BSG A;  1W5D A;  3BM6 A;  3ZNT A;  1T1B A;  5FI6 A;  2VJW A;  3BFF A;  2O9B A;  3UY6 A;  4B9O A;  1QMF A;  1YLT A;  4XUZ A;  3NDG A;  1D6B A;  2VGL S;  2B18 A;  3NJA A;  3BEB A;  2QSG A;  1NZO A;  4MN5 A;  2Y4A A;  1QME A;  1W7F A;  1TVF A;  5CGW A;  3IS2 A;  5CHJ A;  4HP4 A;  3E98 A;  1GHM A;  3MXR A;  1XJ3 A;  1PIO A;  4BJP A;  2EX8 A;  4KZ4 A;  1L3L A;  5L10 A;  3BLS A;  4OP5 A;  5DF9 A;  1ONG A;  5L8M A;  3UDI A;  4EET B;  5HPF A;  2OSU A;  4KG2 A;  4B4Z A;  3MXQ A;  1M6K A;  1TS8 A;  4WZ4 A;  3AGE A;  4CLC A;  1PWC A;  1NLZ A;  4HY8 A;  2HDU A;  2C5W B;  1RCJ A;  1AXB A;  2DLA A;  4QWO A;  3UPP A;  3K2N A;  1IFQ A;  4L9F A;  4UQI S;  3G34 A;  3LR4 A;  2I72 A;  1MKI A;  4LCL A;  3IWO A;  3LY3 A;  3RXW A;  4KZ9 A;  3MSH A;  3ZCZ A;  2QJ7 A;  4QJG A;  1WYB A;  5F69 A;  4M4X A;  2HP6 A;  2PBD P;  3DWZ A;  5HWV A;  3JVV A;  4HEF A;  3KSF A;  3GV9 A;  3QP2 A;  5M1A A;  3PBR A;  1DJC A;  4LV1 A;  2Y2L A;  3BY8 A;  2VGL M;  5AQ7 A;  3TJZ C;  5TBM A;  2A24 A;  4KZ8 A;  1YLZ A;  3OBF A;  2V8F A;  2XQZ A;  3Q81 A;  2NUT C;  3MFD A;  5J7E A;  1STZ A;  2UV0 E;  5J8X A;  2B02 A;  5TR7 A;  3H7W A;  3DWK A;  2X71 A;  3CPT B;  3NBL A;  2Z6C A;  5AQB A;  4E3O A;  1YSQ A;  3SS4 A;  2JE5 A;  1MWT A;  1BDS A;  1YMX A;  4UQI M;  4GHI B;  1XXM A;  3KSI A;  4O01 A;  4ZTK A;  2JN7 A;  1G68 A;  1H8M A;  4LFU A;  5FI2 A;  1EL6 A;  4C3Q A;  3KYE A;  1DJB A;  3D4U B;  3HLD A;  4BD0 A;  3V50 A;  1AWI A;  2H0Y A;  1LLB A;  2M1C A;  2W3E A;  3SOI A;  5FQK A;  3BY9 A;  2V2F F;  3KYQ A;  4Y7P A;  3IBJ A;  4X55 A;  3HLW A;  1T1C A;  4I39 A;  4P87 A;  2ZBB A;  4JGO A;  3FG8 A;  4LPZ A;  3MZE A;  4B93 A;  3WRT A;  3P09 A;  4FH4 A;  2OAP 1;  2V20 A;  3EQV A;  4BMW A;  4NKP A;  4OVD A;  4LLO B;  4OLG A;  4IVI A;  4WZ5 C;  4DF6 A;  4GN2 A;  2QKP A;  4Y5F A;  1FQG A;  3T4J A;  1JWV A;  3W4Q A;  2SH1 A;  3KYZ A;  1ZG6 A;  1VEU A;  2JKF A;  2PU2 A;  2G7U A;  4X1L A;  2MN3 A;  2XXL A;  2Y2P A;  4JGQ A;  3MCX A;  4EEP A;  3S7O A;  4JLF A;  4BQM A;  3MZF A;  4MBH A;  1V9Z A;  1KE4 A;  3IF5 A;  1DP9 A;  5KSH A;  2PD8 A;  3QP5 A;  1XA7 A;  5HFO A;  2XD1 A;  1F98 A;  1YKD A;  3LIF A;  3FPW A;  2ZQC A;  2GDN A;  1SHV A;  3SH7 A;  2KX6 A;  3CG5 A;  2ACG A;  1W63 M;  1E3U D;  3T1S A;  2EA9 A;  1H5O A;  5J4E A;  2BTF P;  3KSH A;  1E3U A;  3NOT C;  4IUH A;  2WGW A;  2HP5 A;  2I9V A;  3PBN A;  4E6W A;  3UDX A;  4EXO A;  5CEB A;  1ESU A;  4GCZ A;  4I3A A;  3ZG8 B;  2WKP A;  2ZM2 A;  3IBR A;  5HZH A;  1IKG A;  4GS9 B;  3B3X A;  3MS6 A;  3WWX A;  3WS2 A;  2J3W A;  5HAP A;  1Y28 A;  5E43 A;  5EVL A;  3LEQ A;  3LUQ A;  4GJ4 A;  3IX4 A;  4B4X A;  3HLB A;  1ZUF A;  4HJ3 A;  1N9O A;  1IEM A;  4EUV A;  5HL6 A;  2K2N A;  3F1O B;  1S1Z A;  2W1R A;  4P85 A;  3IXD A;  1W8Q A;  3C2W A;  3TOI A;  4QB8 A;  5HX9 A;  1H5X A;  4IVK A;  5CRF A;  3B42 A;  2DCF A;  3FKV A;  1W63 Q;  1BLS A;  1IYO A;  2OWH A;  3ICY A;  2BDS A;  2P74 A;  2VEA A;  4IUK A;  2VV7 A;  3QP8 A;  2P08 A;  4O0P A;  4FOF A;  2L1M A;  3QNC A;  1TS6 A;  3NDE A;  2XRO A;  1BUL A;  3MQQ A;  4Y0O A;  4DKI A;  4FSF A;  1NYY A;  2OOL A;  4O8G A;  1XJ2 A;  1JVJ A;  3OOV A;  5F1F A;  2O9C A;  4KZ6 A;  3LFV A;  4LEN A;  1LSW A;  2ZC5 B;  3G4P A;  1HLU P;  2XGN A;  4BBU A;  3UN7 A;  1KGG A;  2WK0 A;  3MYV A;  3OCN A;  2OLU A;  2JC7 A;  2LB5 A;  4GV5 A;  1FSY A;  4S2N C;  2JR3 A;  4UA9 A;  4U3T A;  4GZB A;  1VQQ A;  2IWD A;  3CJM A;  2J3T D;  2ZC6 B;  4KZ5 A;  1FCN A;  4WN5 A;  5EVI D;  3SH9 A;  5EM0 A;  2CC1 A;  1XA1 A;  4FTX A;  4JKT A;  1Q2Q A;  5GLC A;  3KEZ A;  2PAV P;  2HF6 A;  3PHY A;  4GB7 A;  3MR0 A;  5EVI B;  3C8C A;  3BYD A;  2O9A A;  1ZTU A;  3UB6 A;  3DW0 A;  4QY5 A;  3Q7V B;  4BBV A;  4D2O A;  3N6I A;  2Z2L B;  2W1T A;  2PBY A;  3FWL A;  1S0W A;  4HHD A;  1W8Y A;  4CJN A;  4KZA A;  1OJG A;  2ZLY A;  4ETZ A;  4UA6 A;  2W1T B;  4BL3 A;  5F1G A;  1NWZ A;  3IWQ A;  4S2N A;  3W4P A;  3LY4 A;  4EV4 A;  1OPX A;  3NY4 A;  4NXB A;  2QPN A;  1ZG4 A;  4DXC A;  3T1R A;  3PBS A;  1J9M A;  5HAQ A;  1CK3 A;  2IWC A;  2CMN A;  3LYX A;  4QU3 A;  1KVM A;  3EQU A;  1GSX A;  3HUM A;  2KDK A;  2J9O A;  1L0G A;  3BQA A;  2Y79 A;  2GJ3 A;  2PYP A;  3NI9 A;  4WEJ A;  3ZGA B;  1ERQ A;  5HAI A;  4ZRR A;  3R7W B;  3JVU A;  1ZLI B;  4PM8 A;  4K0X A;  1TS0 A;  2W3D A;  1I2S A;  2ZC7 A;  2HV1 A;  2ZL1 B;  4ZDX A;  3UDF A;  3E4O A;  1XFQ A;  3LR0 A;  2Y2J A;  5CHM A;  3MKE A;  4II7 A;  4R38 A;  1CEG A;  5DJU A;  4KZB A;  2E8J A;  1S66 L;  4U0T A;  3UO9 A;  5TGF A;  2A49 A;  2PD7 A;  4JGP A;  5EOO A;  4HH2 A;  1WXN A;  5IT5 A;  3EEH A;  5FQJ A;  1D7E A;  5IS1 A;  4ID4 A;  2P9V A;  3DAV A;  4YOF A;  2BAS A;  4X6T A;  2H9X A;  3M6B A;  5FQI A;  2EFU A;  4PHT A;  4I3J A;  1PRQ A;  5D3O A;  1GKU B;  4PM5 A;  3P01 A;  1ESI A;  2IKD A;  2WUQ A;  1W79 A;  1PW8 A;  3BRM A;  5EFW A;  3RTY A;  3G35 A;  2H10 A;  4MBF A;  5J3W A;  1CJF A;  1NLY A;  4Y0U A;  4N1H A;  2ZC3 B;  5DVA A;  3BW6 A;  3S22 A;  2Q9N A;  2EWW A;  2V9A A;  4XT2 A;  2WAF A;  1NZU A;  1TF1 A;  2ZQ8 A;  3V3R A;  4ARZ B;  4JXG A;  3LI8 A;  1GL9 B;  4KG5 A;  4M3K A;  5FAO A;  3D72 A;  2WGV A;  1FSW A;  2XFS A;  5E2E A;  5HAR A;  3ZG9 B;  2ZJ9 A;  4JGR A;  1BZA A;  2O99 A;  1F5M A;  1DJA A;  2Q9M A;  4N1X A;  5F83 A;  5G4Z A;  5M19 A;  1PZO A;  3IHA A;  2VX8 A;  3VP1 A;  4EW7 A;  5GHY A;  3GTC A;  2UWX A;  2WZZ A;  4BD1 A;  5DF7 A;  2DMW A;  3W4O A;  3FC7 A;  1FR1 A;  4DN0 A;  4C75 A;  3D9Y A;  4DE2 A;  3QP6 A;  1CI8 A;  1K6S A;  2Y59 A;  4KUO A;  5HD5 A;  3C7V A;  5FDS A;  4S2I A;  1HD8 A;  5C5K A;  3KX0 X;  4P0M A;  2O0Y A;  4R3B A;  3GDI A;  1O07 A;  2Y55 A;  3TSG A;  4PKY G;  3IX8 A;  1S6R A;  4GD6 A;  1MPL A;  4MDZ A;  1D1J A;  1XGI A;  4AFI A;  1K4E A;  2EX9 A;  3WS5 A;  5EEC A;  3KO6 A;  3CZD A;  4WF0 A;  5E2F A;  1GCE A;  1JTD A;  3IHB A;  1NXY A;  4EER A;  1S1Y A;  4WEL A;  3NEC A;  3A3I A;  4HIA A;  1LHY A;  3TRC A;  1YSP A;  3L7H A;  1I5Q A;  4H6J B;  3H82 A;  3UB9 A;  3KSG A;  4LGW A;  3G31 A;  3CUE C;  3H82 B;  1SH1 A;  3HL9 A;  3TG9 A;  4F94 A;  3RH8 B;  1LT0 A;  3RJU A;  4ZJ3 A;  5E2G A;  3VP3 A;  1F2K A;  3CPT A;  1RGY A;  4NET A;  3ITA A;  1O7E A;  1PWG A;  4KQQ A;  4GOG A;  2GNX A;  4HJ4 A;  4N9L A;  3OC2 A;  3DTE A;  3UMD A;  1ES3 A;  2ZOI A;  4GHI A;  1G28 A;  1PWD A;  1YM1 A;  4HOI A;  5FQM A;  3IH9 A;  1OJ5 A;  2A2L A;  5FEG A;  1NY0 A;  3OPL A;  3LIC A;  3N8L A;  2JKT I;  3F1N B;  1OTI A;  3S7N A;  2R9X A;  3BFC A;  4IJG A;  4QY6 A;  1TDL A;  2OLV A;  1FCM A;  1E4D A;  4MEZ A;  2WKR A;  4EES A;  1Y54 A;  2WKH A;  1K4F A;  4DE1 A;  3V5M A;  3BFG A;  4O7D A;  3IWI A;  4DRT A;  3E2L A;  1T19 A;  1SHI A;  5DTS A;  3VSK A;  3T1Q B;  1LL5 A;  3UME A;  3DBA A;  1RGZ A;  3IF6 C;  4GDN A;  4LV3 A;  2WKQ A;  3T12 B;  2G2W A;  2QMI A;  5CGX A;  2XD5 A;  1OTA A;  1S67 L;  5EOE A;  1KGE A;  3QP4 A;  3V67 A;  4FH2 A;  2ZQ7 A;  5HDC A;  4WYY A;  4E6X A;  3N8S A;  5A91 A;  2WKE A;  3SZT A;  2PT7 A;  2X01 A;  1YQS A;  3W2Z A;  3LMS B;  3K3C A;  2JKT M;  3VE4 A;  3MXS A;  4LRY C;  3C38 A;  1X0O A;  4ZBE A;  2W3F A;  4JF6 A;  2YKF A;  5A90 A;  3Q82 A;  1S4R A;  2EFX A;  2ZM8 A;  3PBQ A;  2A3U A;  3G30 A;  5G18 A;  3HUN A;  3IXH A;  3ZQ5 A;  1PNE A;  4GDB A;  4F3L B;  5DJT A;  2HDR A;  2PYR A;  3L9K A;  1H8Y A;  1WQK A;  3HRE A;  3TE8 A;  5DKK A;  3S1Y A;  1HTZ A;  1YT4 A;  3ZG0 A;  4GS9 A;  5AQA A;  5GLD A;  1ERM A;  2GZA A;  3A3E A;  2VV8 A;  4R4R A;  2QZ6 A;  4KEN B;  4LRZ E;  5F82 A;  3MF0 A;  3IF6 B;  1MC0 A;  4WZ5 A;  4G3V A;  3HLF A;  3G2Z A;  3WRZ A;  3P7N A;  2YKH A;  2JKR I;  3F1O A;  1ZHH B;  5GHZ A;  2P04 A;  4P6Z S;  3OPR A;  4R23 A;  5FDH A;  5AVE A;  5IU1 A;  3A0S A;  4Q0J A;  5GHX A;  1VB6 A;  2EX2 A;  3OLO A;  1K38 A;  3IT9 A;  5KMW A;  1GSV A;  3FYZ A;  5CTM A;  3UE0 A;  2R78 A;  1SKF A;  1YLY A;  4JXV A;  3A3J A;  2XA7 S;  4KZ7 A;  3Q7Z A;  4L0L A;  4KZ3 A;  2J3T C;  2XK1 A;  3PTE A;  2W3G A;  3M6H A;  2Y2K A;  2EXB A;  5EUA A;  4E04 A;  2B95 A;  4DDS A;  5BOH A;  2AVX A;  1JWP A;  3QHY A;  2E8I A;  5EVI C;  2XR0 A;  3N7W A;  2VA0 A;  2QYB A;  4PM6 A;  4PKY A;  1B8W A;  3BFE A;  3DTK A;  3LEZ A;  4PM7 A;  3CIT A;  2JKG A;  4WMC D;  3Q07 A;  1ODV A;  3MQO A;  4L9E A;  1WA9 A;  1FIK A;  1VHM A;  3OZH A;  4RA7 A;  4R1G A;  5CX7 A;  2JKR M;  5A8B A;  4WL9 A;  1K0K A;  3WS1 A;  1FCO A;  1IYS A;  3ZHH A;  5FQQ A;  4K08 A;  3PYP A;  2P7J A;  4D60 A;  3LCE A;  2QSH A;  4P6Z M;  5AVF A;  3ZG5 A;  3QP1 A;  1CI9 A;  1JWZ A;  1BLH A;  5MC7 A;  2VGJ A;  1DP6 A;  2VK3 A;  2PDR A;  3UPN A;  3ULF A;  4R6L A;  2Y2G A;  3GVB A;  2ZMF A;  2XA7 M;  1ERO A;  1OME A;  1CQA A;  1MBL A;  5EVI A;  4CPK A;  1DRM A;  1F9I A;  3M2K A;  4WLA A;  2XDM A;  4PPR A;  2RCX A;  4S2O A;  3Q7V A;  2MUB A;  5EM1 A;  2H5S A;  3U4L P;  4MLL A;  2Y2H A;  5FAS A;  4Y17 A;  4HBT A;  2FZ0 A;  1IYP A;  3NCK A;  3CAX A;  1J3W A;  4OPZ A;  1K56 D;  5F6A A;  4OPR A;  1K56 A;  3VP0 A;  3HCY A;  4GD8 A;  4EQI A;  1C3B A;  1MWU A;  1YLJ A;  1NRJ A;  5FSR A;  1VET B;  2XEP A;  3LGO A;  3P98 A;  4MMN A;  4IHQ A;  3PAG A;  3OCL A;  3UB8 A;  1KDS A;  2IWB A;  4FD8 A;  1OT6 A;  3O3V A;  4E3M A;  1CEF A;  1MXO A;  2J8Y A;  3BFD A;  3UB5 P;  4YWZ A;  2PHY A;  3MFX A;  4OKP A;  1FR6 A;  5CTN A;  3IXG A;  2FFF B;  3LIB A;  4Y13 A;  2Y2N A;  3C5A A;  1N9B A;  4G3W A;  5E2H A;  1IYQ A;  3C4O A;  4Y3I A;  1MZU A;  3PXP A;  4UEY A;  3R7W A;  5CED A;  2Z2M B;  4RX3 A;  2W0N A;  2V1Z A;  1ALQ A;  3E0Y A;  2VGK A;  2ZOH A;  1OTD A;  3T4L A;  1CF0 A;  3VP2 A;  2ZL1 A;  2DNS A;  3V39 A;  3LR3 A;  3NOU C;  3O87 A;  4HJ6 A;  2M7U A;  2V8C A;  1YLP A;  4K91 A;  5F5Y A;  4JPM A;  4Y2F A;  3UB7 A;  2DRW A;  1XKZ A;  2Y91 A;  4A5R A;  5HSQ A;  3EOI A;  3T50 A;  3GQZ A;  3CMZ A;  4JF4 A;  4NK3 A;  2EWV A;  1XP4 A;  4OQ0 A;  3ZVW A;  4Q0I A;  4LV2 A;  4OPY A;  5KZH A;  2Y2I A;  4DJ2 A;  1HZO A;  4I3I A;  2KLI A;  4YIN A;  1LI0 A;  1SDE A;  4OON A;  2H28 A;  5GL9 A;  2ZD8 A;  3WS0 A;  3IF4 A;  4MBK A;  1ZUE A;  4QD4 A;  1YMS A;  5GLA A;  4DDY A;  3NUL A;  2HJE A;  3LO7 A;  3T4T A;  2GX5 A;  4LCM A;  2J9P A;  3F1P B;  1SKO B;  1N4O A;  4HH3 A;  4EWF A;  2EXA A;  1K25 A;  1NJ4 A;  3N8R A;  1P9W A;  1LI9 A;  3MMH A;  1FIL A;  4ARZ A;  3LR5 A;  4BBT A;  3IX3 A;  5EVE A;  3T4O A;  4GW9 A;  3PBO A;  1ES4 A;  4R4S A;  3JYI A;  4RQ9 A;  3R4K A;  3ZDJ A;  1BTL A;  1AHL A;  4MCW A;  5F68 A;  3WS4 A;  4HES A;  3VFH A;  1FOF A;  5FA7 A;  1XJ6 A;  3DTM A;  3CWF A;  2XRN A;  3MKF A;  4HQA A;  1KDW A;  4CLC C;  3IH8 A;  3M2J A;  1KGF A;  3N4I A;  5TFQ A;  4EBL A;  1I2W A;  3HJI A;  5CEC A;  2G2U A;  5AQ9 A;  1KOU A;  1ATX A;  4RX2 A;  3I7J A;  1XGJ A;  2Y2M A;  4EBN A;  5U47 A;  1PI5 A;  1T1A A;  4ETX A;  2Y2O A;  3E2K A;  1IOU A;  4R3J A;  3RFB A;  1UGU A;  1UWN X;  2OV5 A;  1LL8 A;  3FKW A;  4Z1W A;  1K55 C;  1XX2 A;  4DXB A;  4RVA A;  2VZW A;  5DTK A;  1G6O A;  4JXS A;  4X69 A;  2Z6D A;  4EQ1 A;  2EX6 A;  1ES5 A;  3IS2 B;  1N9N A;  4ME4 A;  2HJ9 C;  1XJ4 A;  3S7Q A;  5K5B A;  2ZQA A;  2INW A;  4KUK A;  3BEC A;  5HDD A;  4CLC D;  2M7V A;  5KSC A;  1PFL A;  2D01 A;  4E3K A;  4H6J A;  3HLG A;  3GEC A;  1BYW A;  1ZLH B;  3GRJ A;  3SW1 A;  4CLC B;  1K54 C;  3T4K A;  4NXF A;  2ZQD A;  1G6A A;  1MY8 A;  2JHE A;  3UE1 A;  1GHI A;  5EPH A;  4DJ3 A;  2QJ5 A;  4KQR A;  4IED A;  3DTI A;  3HLE A;  5DFY A;  4YNR A;  1K55 A;  1TD5 A;  2D02 A;  3E4P A;  1A0K A;  3LIA A;  2J80 A;  1WYC A;  2XF3 A;  2C6W B;  2K2X A;  2J7V A;  2B5R A;  1JTG A;  5TBM B;  2A24 B;  5AJG A;  3C30 A;  1XFN A;  1SCW A;  2KOI A;  3F1N A;  1KE3 A;  5M18 A;  5DTT A;  1PZP A;  1TS7 A;  4B88 A;  5IHV A;  1JNU A;  3H7W B;  3SH8 A;  5I94 A;  5EE8 A;  1L0F A;  3K3D A;  3CLO A;  4GKU A;  4GLQ A;  4KQO A;  4DE0 A;  1K54 A;  4HI4 A;  1APF A;  3VSL A;  5JYP A;  1NRF A;  3LIE A;  3FV7 A;  3CUE A;  1XPB A;  3MJQ A;  3VMA A;  4U0X A;  2L0W A;  2HPB A;  4Q8I A;  5L07 A;  1OT9 A;  3S7P A;  3BWL A;  1GHP A;  2WKI A;  3FZC A;  4S2P A;  3OPP A;  4OPQ A;  3VE3 A;  4HNB A;  2V1A A; 
#chains in the Genus database with same CATH homology
 2OAQ 1;  3MQO A;  4L9E A;  1WA9 A;  4YIR A;  3E98 A;  1VHM A;  1XJ3 A;  1TS0 A;  5CX7 A;  2JKR M;  2W3D A;  4BJP A;  5A8B A;  1LSX A;  2HV1 A;  3MQ0 A;  4I38 A;  4WL9 A;  4PAU A;  5DFX A;  3E4O A;  1XFQ A;  3LR0 A;  5DF9 A;  5L8M A;  4K08 A;  4EET B;  3PYP A;  5HPF A;  2P7J A;  4II7 A;  2Y8H A;  4R38 A;  3MXQ A;  1TS8 A;  2QSH A;  4P6Z M;  5HWW A;  5DJU A;  5AVF A;  2QHK A;  4CLC A;  1NLZ A;  4HY8 A;  1S66 L;  2DLA A;  2PD7 A;  5MC7 A;  4JGP A;  3K2N A;  4HH2 A;  1IFQ A;  1D06 A;  4L9F A;  4UQI S;  1WXN A;  2B9K A;  4F3L A;  3LR4 A;  5IT5 A;  3EEH A;  1DP6 A;  1D7E A;  2PDR A;  5IS1 A;  3ULF A;  2QWS A;  4R6L A;  5G4Y A;  4YOF A;  2QJ7 A;  2ZMF A;  2XA7 M;  2BAS A;  5F69 A;  1DRM A;  4M4X A;  2H9X A;  3BJN A;  1F9I A;  3E4Q A;  2OWJ A;  4WLA A;  5HWV A;  3JVV A;  2W27 A;  3KSF A;  4PHT A;  4HP9 A;  2MUB A;  1LSV A;  3BQ8 A;  4I3J A;  3PBR A;  1V9Y A;  3BY8 A;  2VGL M;  2FZ0 A;  3P01 A;  3CAX A;  3CI6 A;  3TJZ C;  2IKD A;  2RNG A;  2A24 A;  5TBM A;  3EGX C;  5F6A A;  3OBF A;  5EFW A;  1H3Q A;  3RTY A;  3H9W A;  3EGD C;  4OOL A;  3HCY A;  3LI9 A;  2NUT C;  5J3W A;  1NLY A;  1STZ A;  5J7E A;  2B02 A;  3BW6 A;  1NRJ A;  3H7W A;  4G3K A;  4MMN A;  4IHQ A;  2EWW A;  2V9A A;  4XT2 A;  2V0U A;  3OCL A;  3LID A;  3UB8 A;  1TF1 A;  4ARZ B;  3LI8 A;  1OT6 A;  2Z6C A;  1OTE A;  3HJK A;  4YWZ A;  2PHY A;  3D72 A;  3MFX A;  4OOM A;  1YSQ A;  1BDS A;  4EU0 A;  3LIB A;  4UQI M;  4GHI B;  3TW8 A;  4G3W A;  2IKE A;  3KSI A;  4O01 A;  1YAX A;  4JGR A;  4Y3I A;  2JN7 A;  1H8M A;  2O99 A;  1F5M A;  1MZU A;  3O5Y A;  3PXP A;  4UEY A;  3B33 A;  3R7W A;  1EW0 A;  5G4Z A;  3D4U B;  2VX8 A;  4NXE A;  4EW7 A;  2W0N A;  4QPR A;  3EEA A;  3E0Y A;  2M1C A;  2W3E A;  2DMW A;  3FC7 A;  2ZOH A;  4DN0 A;  5HPI A;  1OTD A;  3BY9 A;  3T4L A;  3KYQ A;  1GSW A;  3IBJ A;  4KUO A;  5HD5 A;  1T1C A;  3LR3 A;  3NOU C;  4I39 A;  4HJ6 A;  2ZBB A;  4JGO A;  3FG8 A;  2M7U A;  4LPZ A;  4B93 A;  5C5K A;  3KX0 X;  4KQD A;  2O0Y A;  2OAP 1;  5F5Y A;  3EQV A;  4DMZ A;  4BMW A;  4Y2F A;  3GDI A;  4NKP A;  3UB7 A;  5TJJ A;  1P0Z A;  3EOI A;  5HSQ A;  3T50 A;  4PKY G;  4LLO B;  2IA2 A;  2EWV A;  4Q0I A;  2QKP A;  4MDZ A;  4Y5F A;  3T4J A;  4AFI A;  4DJ2 A;  2SH1 A;  3KYZ A;  4I3I A;  2KLI A;  2G7U A;  2H28 A;  3KO6 A;  2MN3 A;  2XXL A;  4WF0 A;  2JTO A;  4JGQ A;  3MCX A;  4EEP A;  3S7O A;  4BWI A;  4NXG A;  1ZUE A;  4EER A;  1S1Y A;  4WEL A;  4EEU A;  1V9Z A;  1P9R A;  4HIA A;  4WUJ A;  3PR6 A;  3TRC A;  1YSP A;  2HJE A;  1DP9 A;  3T4T A;  2GX5 A;  3F1P B;  4H6J B;  5KSH A;  2PD8 A;  1F98 A;  1YKD A;  3LIF A;  3H82 A;  3UB9 A;  3FPW A;  3KSG A;  2HGV A;  4NEE D;  4HH3 A;  5LBR A;  2KX6 A;  3CUE C;  1W63 M;  1MKM A;  1H5O A;  2EA9 A;  3H82 B;  1SH1 A;  1P9W A;  5J4E A;  2PR6 A;  3KSH A;  3NOT C;  2V0W A;  3RH8 B;  3PBT A;  1DP8 A;  1LT0 A;  4IUH A;  2I9V A;  3MMH A;  4ARZ A;  3PBN A;  3LR5 A;  4CLC E;  4BBT A;  4EXO A;  3T4O A;  4GCZ A;  4GW9 A;  4I3A A;  2WKP A;  3PBO A;  3IBR A;  5HZH A;  2L4R A;  4GS9 B;  3G6O A;  4CQH A;  1OTB A;  2GNX A;  4HJ4 A;  4RQ9 A;  2J3W A;  1Y28 A;  3OC2 A;  3UE3 A;  3UMD A;  3LUQ A;  2MJ6 A;  2ZOI A;  1Z99 A;  4GHI A;  4GJ4 A;  1G28 A;  5KIZ A;  3R4K A;  4HOI A;  1UWP X;  1AHL A;  1OJ5 A;  2K7S A;  4MCW A;  5F68 A;  1ZUF A;  2A2L A;  5DKL A;  4HJ3 A;  1N9O A;  4EUV A;  3U2A A;  5HL6 A;  3A0V A;  2K2N A;  1S4S A;  1S1Z A;  2W1R A;  1XJ6 A;  3F1O B;  3LIC A;  2NUP C;  2XSS A;  2XRN A;  3CWF A;  2JKT I;  3F1N B;  1OTI A;  4HQA A;  3S7N A;  3A0R A;  3C2W A;  4IJG A;  4CLC C;  2VV6 A;  5I5L A;  3HJI A;  1KOU A;  3B42 A;  4WEK A;  1ATX A;  2WKR A;  4EES A;  1W63 Q;  2OWH A;  5FL3 A;  3ICY A;  2BDS A;  1T1A A;  2VEA A;  4IUK A;  4L9G A;  2VV7 A;  4O0P A;  2P08 A;  4ETX A;  4FOF A;  2L1M A;  1T19 A;  1IOU A;  2FH5 A;  1SHI A;  3RFB A;  1TS6 A;  2XRO A;  1UGU A;  1UWN X;  2W3H A;  1LL8 A;  3UME A;  3DBA A;  4Z1W A;  2V1B A;  2WKQ A;  3MQQ A;  2VZW A;  5HD3 A;  4FSF A;  1OTA A;  1S67 L;  1G6O A;  3UE6 A;  2OOL A;  2Z6D A;  3V67 A;  4EQ1 A;  4O8G A;  3IS2 B;  1N9N A;  1XJ2 A;  4ME4 A;  5HDC A;  2VLG A;  3OOV A;  2HJ9 C;  1XJ4 A;  2O9C A;  3S7Q A;  3LFV A;  5HWT A;  5K5B A;  2PT7 A;  1LSW A;  2INW A;  4BBU A;  3EWK A;  4KUK A;  3VOL A;  2PR5 A;  1P97 A;  3LMS B;  5HDD A;  3W2Z A;  3K3C A;  2JKT M;  3VE4 A;  4CLC D;  3MYV A;  3OCN A;  3ZYT A;  4LRY C;  2M7V A;  2LB5 A;  3C38 A;  2D01 A;  1X0O A;  3F1P A;  4GV5 A;  4H6J A;  2JR3 A;  3GEC A;  1BYW A;  1ZLH B;  2W3F A;  3T4Q A;  2YKF A;  1S4R A;  3T4S A;  2J3T D;  3SW1 A;  1N9L A;  3NHQ A;  3PBQ A;  4CLC B;  4LRX C;  3FPV A;  3T4K A;  4NXF A;  4WN5 A;  3ZQ5 A;  4F3L B;  2VKS A;  2JHE A;  3NOP C;  4I5S A;  5DJT A;  4DJ3 A;  2PYR A;  2QJ5 A;  1WQK A;  3TE8 A;  3KEZ A;  5DKK A;  2QSF A;  2HF6 A;  2LB9 A;  3PHY A;  4GS9 A;  3MR0 A;  5DFY A;  3C8C A;  4MN7 A;  4YNR A;  2O9A A;  2GZA A;  2VV8 A;  1TD5 A;  2D02 A;  1ZTU A;  3E4P A;  3UB6 A;  3D3O A;  3LIA A;  4LRZ E;  4Q0H A;  4BBV A;  2J80 A;  2K31 A;  3MF0 A;  3B47 A;  4R3A A;  1MC0 A;  4G3V A;  2K2X A;  2W1T A;  3P7N A;  4HHD A;  4MN6 A;  2YKH A;  5TBM B;  2A24 B;  3F1O A;  2JKR I;  3C30 A;  1XFN A;  5AJG A;  5HDS A;  1ZHH B;  2P04 A;  2KOI A;  1OJG A;  3F1N A;  4ETZ A;  4P6Z S;  2W1T B;  5AVE A;  5IU1 A;  3A0S A;  1TS7 A;  4Q0J A;  3VV4 A;  1NWZ A;  1T18 A;  1VB6 A;  1JNU A;  3OLO A;  3H7W B;  2ZMV A;  4XT2 B;  4R70 A;  1OPX A;  4NXB A;  3K3D A;  1GSV A;  3CLO A;  3PBS A;  2R78 A;  4GLQ A;  4KQO A;  1T1B A;  1ZLI B;  2XA7 S;  4HI4 A;  2VJW A;  4L0L A;  1APF A;  2CMN A;  3LYX A;  2J3T C;  2W3G A;  3LIE A;  3EQU A;  1GSX A;  2O9B A;  4B9O A;  3CUE A;  2KDK A;  3MJQ A;  4E04 A;  2L0W A;  3BQA A;  1OT9 A;  3S7P A;  3BWL A;  2Y79 A;  2GJ3 A;  2PYP A;  2VA0 A;  1D6B A;  2VGL S;  2B18 A;  2QYB A;  3NJA A;  4WEJ A;  2QSG A;  4HNB A;  4MN5 A;  4PKY A;  1B8W A;  4ZRR A;  3R7W B;  3IS2 A;  3JVU A;  3VE3 A;  3CIT A;  1ODV A;  4HP4 A;  2V1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...