1ZHHB

Crystal structure of the apo form of vibrio harveyi luxp complexed with the periplasmic domain of luxq
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
221
structure length
208
Chain Sequence
RTKQQTSALIHNIFDSHFAAIQIHHDSNSKSEVIRDFYTDRDTDVLNFFFLSIDQSDPSHTPEFRFLTDHKGIIWDDGNAHFYGVNDLILDSLANRVSFSNNWYYINVMTSIGSRHMLVRRVPILDPSTGEVLGFSFNAVVLDNNFALMEKLKSESNVDNVVLVANSVPLANSLIGDEPYNVADVLVIETPIVVNAVTTELCLLTVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autoinducer 2-binding periplasmic protein luxP
publication title Regulation of LuxPQ Receptor Activity by the Quorum-Sensing Signal Autoinducer-2.
pubmed doi rcsb
source organism Vibrio harveyi
molecule tags Signaling protein
total genus 64
structure length 208
sequence length 221
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09308 LuxQ-periplasm LuxQ, periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.20.100 Mainly Beta Single Sheet Anthopleurin-A Anthopleurin-A 1zhhB02
3.30.450.220 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1zhhB01
3C38A 3C30A 2HJ9C 1ZHHB 2HJEA
chains in the Genus database with same CATH superfamily
5TBMB 4P6ZM 2PU4A 3NC8A 2HF6A 4GOGA 3TG9A 1W7FA 4E6XA 4GN2A 3CG5A 5GL9A 3DAVA 3VP1A 4R4RA 1OPXA 3CZDA 5L09A 1BLCA 5DF9A 2Y2HA 3HLDA 2XFSA 3BLMA 1FR6A 3MXQA 1XFQA 4BENA 1ALQA 3IXHA 3TJZC 1LLBA 2D02A 4I38A 1AHLA 3L9KA 3Q1FA 4G3WA 4KUKA 4R6LA 2Y2IA 2BG1A 4LRXC 3C30A 2J8YA 5M18A 4KQQA 3LEQA 2FZ0A 4DE1A 4ARZB 4ZAMA 4HEFA 1NXYA 3M6BA 3LMSB 1KOUA 3E2LA 5D3OA 3DWKA 2ZC4B 2I72A 3SH8A 5EM0A 5FI2A 3N8SA 1TS7A 4P85A 2X02A 2K31A 4YINA 5HWVA 3V3SA 2MUBA 1SKOA 4GLQA 1L3LA 4Q0IA 3BY8A 3T4QA 4E3IA 3CPTB 5FAPA 4DE3A 4ME4A 1KVLA 4LV0A 1YLPA 4C75A 4RYEA 1B8WA 3PR6A 3OZHA 4EEUA 2V1AA 5L10A 2VA0A 4OQIA 5TBMA 4X69A 3T1QB 4BD0A 5CXWA 3V50A 4GDBA 2WGWB 2ZM8A 4IBXA 1V9ZA 3V3RA 5K5BA 5LBRA 4R38A 1GA0A 3LICA 3MYVA 1K57A 2PYRA 5E2HA 5A93A 1H8MA 4Y0UA 2XLNA 1BDSA 5HL1A 1BT5A 4CQHA 1NYYA 1W5DA 2ZQCA 5FSRA 1KGGA 4JLFA 3A3FA 2Q0OA 2O0YA 2ZJ9A 1I5QA 4S2LA 4JGPA 1S1YA 4DE2A 4N1XA 2PD8A 4CLCB 4FTXA 4LCMA 1AWIA 4MN5A 2FFYA 2Q9MA 1TS0A 1HVBA 1JWZA 1FIKA 4IUHA 3C38A 4LLOB 3MS6A 4LRYC 2HDUA 1VEUB 2E8IA 2QSHA 4EWFA 2EX6A 3FPVA 2OV5A 3M2KA 4QHCA 4PAUA 4S2KA 2WK0A 4N9LA 5AQ9A 3VOYA 3ZYTA 3C8CA 2BLSA 2C6WB 5J4EA 3BFGA 1ODVA 3G35A 1XX2A 4S2NC 3EQVA 3PBTA 1XJ3A 1IYSA 1V9YA 1L0EA 4XT2B 3CPTA 3VSLA 3QHYA 4WF0A 5EOOA 2R9XA 4DKIA 2OSUA 2J80A 3CI6A 4L9GA 4DDSA 4QB8A 2VGLM 3MKEA 2QKPA 1JWVA 2Y91A 3SH9A 4Q8IA 4OVDA 2IA2A 4KZ8A 2V0UA 5GLDA 4KQDA 3ULFA 1F9IA 2XEPA 4WUJA 2M1CA 4P87A 4S2OA 3H9WA 5HX9A 4L9EA 3Q82A 5CTMA 4WMCD 1MWTA 5HWTA 1LL9A 2QJ5A 4L9FA 4BBUA 4QU3A 1BUEA 2WUQA 4DXBA 1NZOA 1YPRA 2GX5A 2HDQA 2XK1A 1T19A 1TD5A 4EERA 2WAEA 3W2ZA 1Z09A 4X55A 3EWKA 2O9BA 4N1HA 1MWRA 3LR5A 3NOTC 3ZNYA 4ZRRA 1APFA 3PBOA 1VEUA 2Z6CA 3BJNA 4FH2A 2M7UA 3BEBA 1T18A 1MWUA 1OTBA 4OPQA 3UDFA 1K54C 4GS9A 3UE1A 2Y4AA 1DP8A 4DDYA 3DTIA 4HI4A 4NK3A 3UDXA 2H5SA 3PBSA 5A91A 2ZQ8A 5GLBA 1SCWA 3D3OA 5EVID 2G2UA 3S7PA 3IHBA 1VM1A 2FH5A 2W27A 3FC7A 3UB9A 5L07A 5AJGA 4H6JB 2ZOIA 2R9WA 1YM1A 2A24A 1GSXA 5HD5A 4ZBEA 4OLGA 3QP4A 1PW1A 3OCLA 4KZ9A 1TDLA 3HLGA 4EXOA 3VE3A 1JTGA 4BQMA 3B42A 1F2KA 4I5SA 5IT5A 2EX9A 3MQOA 1NLYA 4NXBA 4X1MA 1S66L 4XUZA 4RA7A 3RXWA 3T4JA 4YIRA 3G31A 4EQIA 4WL9A 4FH4A 5HAQA 3RJUA 2PR5A 3PBQA 3E2KA 4WBGA 4AFIA 1IYOA 2ZOHA 3ISGA 1ES3A 4E3NA 3PHYA 3OCNA 2W3FA 1XJ6A 1W8YA 3LR4A 4Y5FA 3T4LA 4JF6A 3B33A 5F1GA 5I94A 5CHMA 3GR2A 1BSGA 1J9MA 3RH8B 2VJWA 3VSKA 3CJMA 3IWOA 2R78A 2I9VA 5G18A 4R3JA 1RGYA 3MCXA 3NHQA 2QSGA 3LIEA 4X25A 2IKEA 3QNCA 4IVIA 4FCFA 3GRJA 1XKZA 4PHTA 1K25A 5DFXA 2J9PA 3CUEC 1ZG4A 2XGNA 2ZM2A 4X1LA 3PBRA 4H6JA 3ZVWA 5AQ7A 3E4PA 4PM6A 1BLPA 2RL3A 3IXDA 1NWZA 4GHIA 2C5WB 1SKFA 3E4QA 2VGJA 3IBRA 4WZ5A 4E6WA 1NY0A 4NETA 4PM7A 3UE0A 1XGIA 3H7WB 3NULA 4ZTKA 1IKIA 5CGSA 1N9LA 5CTNA 3FWLA 1GKUB 2XDMA 4GV5A 2P9VB 4G3VA 2O9CA 1PI5A 1WXNA 3JYIA 3CITA 1JWPA 4LRZE 2PBDP 4BBTA 4CJNA 2HDRA 5A8BA 2XR0A 3GSGA 5FI7A 2HZ5A 3VOLA 4NXFA 1GSWA 4WELA 4K08A 4Y15A 4O8GA 2YKHA 3G6OA 3WWXA 1KVMA 5GHXA 4CLCD 1XJ2A 2HJ9C 1YLTA 1T1CA 2WKPA 1IEMA 4IJGA 4OQHA 2PRFA 4IHQA 1GHIA 1DRMA 2WZXA 3VFFA 2K2NA 1XA1A 3VOZA 1ZTUA 2ZMAA 2ZC3B 1K56D 3UB6A 4EUZA 5IU1A 4UHUA 2D01A 4HJ4A 4QY6A 4NXEA 3DBAA 1K6SA 2V8FA 1PZPA 3LUQA 1BLSA 3ICYA 4MBKA 3QP1A 4KG5A 1NYMA 4WLAA 5HAIA 3WS1A 5FAOA 1QMEA 1S0WA 1F5MA 2JHEA 5EVIB 1GHMA 2IWDA 1D06A 3NY4A 1IELA 3IS2B 5EM1A 3LYXA 1CF0A 1AXBA 5A92A 2BDSA 1EL6A 1BLHA 4MCWA 2P74A 4DMZA 4KZ5A 1PIOA 1SHVA 2XQZA 4QY5A 2SH1A 1FQGA 2V0WA 5FQMA 2W1TA 4D2OA 2VZWA 4ID4A 3W8KA 1TS8A 2UWXA 1BTLA 3ZHHA 1YLYA 3U4LP 1KE3A 3VP2A 4FSFA 4LFUA 4PPRA 4R4SA 3BFDA 5E43A 1YSPA 3O5YA 3UNWA 5F68A 1SZVA 3Q7VA 4WMCA 4X6TA 4Z9QA 2K2XA 3P09A 2B18A 1YQSA 1EWZA 4QJGA 3S1YA 4R23A 2QWSA 3W4PA 3UB7A 1NRFA 1L2SA 3MKFA 4X68A 4GDNA 1TF1A 3BQAA 3PYPA 4BLMA 2XH9A 1FR1A 4MNRA 3QP6A 3K3CA 3NDGA 4UA7A 3O88A 1F98A 3T4OA 1Y28A 2UV0E 4OQ0A 2Y2OA 2P7JA 5DJTA 1XXMA 5EVIA 4EBLA 2ZL1B 3ZG9B 1E3UD 2NUTC 2Y8HA 3IS2A 3MFXA 1IOUA 3D4FA 3UE3A 2WKQA 1ES5A 1U60A 3HLWA 3K2NA 4IUKA 4MBHA 4I3JA 4KZ3A 4JXSA 4KUOA 1ES4A 3HL9A 4KZAA 1D6BA 3ZCZA 3HREA 5DKLA 3KX0X 5HDSA 1QMFA 3UMDA 4BJPA 3IWQA 2B9KA 4JKTA 1KE4A 2FFFB 2Y2PA 4MEZA 3FKWA 2WKEA 2EFXA 2Y2MA 3OPPA 4KZ4A 1TEMA 2ZMFA 4DJ3A 3ZQ5A 3SS5A 1PRQA 3RFBA 1MC0A 3WRZA 2Y2LA 2Q9NA 2DLAA 4E04A 4OKPA 1K55C 2VV6A 4JGOA 4UQIM 4Q0HA 1ES2A 2JKTM 3B3XA 1OT6A 3G30A 2V1ZA 4OPYA 3IXGA 3JPUA 3ZVTA 1XGJA 4S2IA 3UO9A 3UE6A 4OQGA 2ZQ7A 3BRMA 4OP8A 4ARZA 1YT4A 2XA7S 3ZFZA 1OTAA 1JVJA 3IF6C 1IFQA 4C3QA 2W3GA 5CECA 1MXOA 4GD6A 5HPFA 4HJ6A 3WRTA 4DF6A 1TVFA 3DWZA 1OTDA 4MLLA 4GZBA 1CEFA 1YLJA 4GJ4A 4N9KA 4Y17A 1SHIA 2JKTI 5HD3A 2AVXA 2JR3A 1E4DA 3E0YA 3T4KA 2VKSA 1NJ4A 5C5KA 2Z2MB 3Q81A 3HUMA 3IF4A 2WGWA 1N4OA 3M6HA 3F1NB 5FDSA 2A3UA 3A3IA 2JCHA 2B95A 2L1MA 1L0GA 3M2JA 4B4XA 4KG2A 1BULA 2H9XA 1EW0A 4E3KA 5AVFA 3S7QA 3IT9A 2PYPA 1YLWA 1PYYA 3W4QA 2OAQ1 5FI6A 2CMNA 5L8MA 1ERQA 1ATXA 1A0KA 1ESUA 1Q2QA 4RVAA 2XFTA 4CLCA 3GMWA 4HIAA 1KDSA 4CPKA 3G4PA 1XP4A 2KOIA 2XD1A 3EQUA 4F94A 1KE0A 5F83A 1GSVA 1ONGA 2RNGA 3JVUA 4LV3A 1VETB 2W3DA 2ZQDA 1HZOA 1O7EA 4LV2A 4WEKA 3BFEA 1TS6A 4R70A 2Y2JA 3MFDA 3VP4A 4DE0A 4LENA 3G2YA 3PAEA 3BW6A 3KSIA 4XT2A 2YKFA 2H0YA 4BL3A 3VP0A 2INWA 2VGKA 4U0XA 1JTDA 4HQAA 2QZ6A 1DP6A 1RCJA 4EU0A 4OOYA 2G2WA 2GNXA 3CHWP 1KGFA 1STZA 1Q2PA 3NOUC 2OLVA 3BFCA 1OTIA 4LV1A 3SZTA 3K3DA 2RCXA 3JVVA 2H28A 3HVFA 2PBYA 5CEBA 1G68A 4XXRA 2E8JA 2J3TC 4ETXA 2IWBA 2V8CA 4QD4A 3LI9A 1MY8A 2HV1A 1S4RA 2Z2LB 1LI0A 2HPBA 1FSWA 2EXBA 5HAPA 3BECA 3BY9A 3GDIA 3G34A 1IYPA 4EQ1A 3NOPC 3ZG7B 3LIBA 3UN7A 3N4IA 2PAVP 4GW9A 1CK3A 3T50A 1H5XA 3O3VA 4LCLA 5CERA 1VETA 4P6BA 3HLEA 3KEZA 4NEED 3TSGA 1H8YA 1D7EA 2QMIA 3BLSA 3IF6B 5GLAA 2IWCA 1LT0A 3IF5A 1K57C 1S1ZA 4IEDA 2G7UA 1RGZA 3LI8A 2Y2GA 1PWGA 2XRNA 4BD1A 5J8XA 2ZD8A 4O0PA 1ERMA 1MZUA 3O86A 4II7A 2Y59A 5HPIA 4HJ3A 4UEYA 4MBFA 3CAXA 5KSHA 2EXAA 2VGLS 3MJQA 5AQAA 3CMZA 1Z6FA 5TJJA 2W1RA 1E3UA 3EEHA 4GCZA 2ZQ9A 1PZOA 3E4OA 3R7WB 2OAP1 5EFWA 1PFLA 3HLFA 5DVAA 4B9OA 4I39A 2EFUA 4EBNA 1K0KA 1SDNA 3ZDJA 2JTOA 3WS2A 3TRCA 1ZLHB 2DMWA 1G5UA 1LI9A 1OT9A 2GZAA 2GDNA 4JXWA 5KSCA 3FYZA 4UAAA 5DTKA 3NCKA 2JKFA 3S4XA 4B93A 2P04A 5IHVA 3NECA 1LSWA 4RX2A 3P98A 4B88A 1KDWA 2ZC6B 3G32A 2XXLA 3SS4A 1UWPX 3BFFA 5HWWA 3LIFA 4CLCE 4UA9A 2V20A 5DTTA 1ZUEA 5FA7A 5GLCA 4E3LA 2EX8A 5E2FA 2OWJA 2Y2KA 3OBFA 4LPZA 2PD7A 2ZC7A 4S2NA 4ZJ1A 1EROA 4BWIA 4EESA 2XD5A 2EWWA 3HUNA 4NG2A 3UPPA 1W8QA 3IQAA 1GHPA 3NIAA 2L4RA 4D60A 1YKDA 3PTEA 4HBUA 4HH3A 5GHYA 1MWSA 4KZ7A 3C4OA 2LB5A 2A49A 3IXBA 2JKRI 3KSFA 1K38A 5HFOA 1CJFA 3Q7ZA 4P0MA 3H7WA 3SH7A 2B5RA 4JXGA 4ETZA 4ZDXA 2QHKA 3MR0A 5KMWA 3LR3A 3R7WA 4A5RA 4PKYA 4YNRA 2P9VA 5HSQA 4BL2A 3DW0A 3DTMA 3KO6A 2PR6A 3OPRA 4DN0A 4HESA 4JGRA 4OOMA 2XA7M 3UB5P 2HP9A 2O99A 5JYOA 3V39A 2CC1A 1LHYA 1ACFA 3IHAA 3ITBA 5EVLA 5IS1A 1ZKJA 3OPHA 2KX6A 2PDRA 5FEFA 3A3JA 1G6AA 4QPRA 1PWCA 4QWOA 3ITAA 2J9OA 4KQOA 5E2EA 3T1XA 4F3LB 3F1PB 3BQ8A 3GECA 2VLGA 3C5AA 3GV9A 4Z1WA 2QYBA 1K54A 2P08A 4EETB 5F69A 3QNBA 5HDDA 5AVEA 3MZFA 1FOFA 5CHJA 1K6RA 2EX2A 3PXPA 4JGQA 4E3MA 4Y13A 4RQ9A 3UB8A 4ZJ3A 5EPHA 3HJKA 4O01A 3KYEA 3UPNA 1GA9A 3EEAA 1VB6A 5F1FA 3FZCA 3I7JA 3VMAA 4PM9A 2KDKA 1BZAA 1FCOA 3EGXC 1P97A 1WYCA 1S67L 2JC7A 2A2LA 3ZNTA 3MF0A 3ZG0A 2HJEA 3FKVA 1ONHA 3Q07A 1IYQA 1W79A 2HP5A 3KYZA 4EUVA 1XPBA 4WN5A 4MN6A 4KG6A 5HDCA 3N7WA 3D72A 1UWNX 3A0RA 4OPZA 4JF5A 2XSSA 1H5OA 1XA7A 3F1OB 4ESPA 4KQRA 1CEGA 1YAXA 3P01A 2MN3A 2VV7A 3QP2A 3MQ0A 4DJ2A 4NXGA 3V67A 1N9BA 5DKKA 3LCEA 1T1BA 1VHMA 5FQKA 4MN7A 1OMEA 4DRTA 4EV4A 2VX8A 3BYDA 4YFMA 4U0TA 5CEDA 4F3LA 5EVEA 3LY4A 3F1PA 3KSHA 4WZ5C 4M4XA 2JKGA 3BWLA 2ACGA 3NDEA 4YOFA 4GNUA 1OJGA 2ZM0A 4JXVA 4GB7A 5J7EA 1G6OA 4WYYA 3TW8A 1OJ5A 4HP9A 5I5LA 2VV8A 2VK3A 1PWDA 3MZDA 3HLCA 4X56A 5EUAA 2NUPC 4YWZA 3CUEA 4HY8A 2EWVA 1HD8A 2K7SA 3T1SA 3T12B 1DJCA 2WKHA 1H0MA 1DP9A 5KZHA 5J3WA 4L0LA 5FAQA 5DTSA 2Z6DA 3NJAA 1H8ZA 2XF3A 4OP5A 3RTYA 3LR0A 3AGFA 3FPWA 1PI4A 1MKMA 3A3EA 5TFQA 3IX4A 1DY6A 2ZL1A 4WEJA 3GVBA 3F1OA 2LB9A 4G3KA 5HL6A 1GCEA 4GS9B 2GJ3A 3LY3A 1ESIA 4P6ZS 4FUWA 4S2JA 4MDZA 2DNSA 3C4PA 4HH2A 2ZBBA 3LO7A 4R0QA 5DF7A 1WYBA 5EECA 3W4OA 3MQQA 3EOIA 3VV4A 2DCFA 2QJ7A 5DJUA 2OOLA 4R3AA 4B4ZA 5FATA 3IBJA 3KYQA 2ZQAA 2PU2A 2W0NA 3S7OA 5A90A 4PM8A 2A24B 5HZHA 4HBTA 4HNBA 3SOIA 2M7VA 5CGXA 3GQZA 4JF4A 1E25A 2W3EA 4WZ4A 1W63Q 4K0WA 1MBLA 3IH8A 5HARA 4OH0A 3OC2A 3WS0A 4JPMA 5HW3A 1CQAA 2EA9A 1O07A 3ZGAB 4I3AA 5G4YA 1CI8A 1NLZA 2IKDA 5FQIA 2X71A 4XUXA 3C7UA 1Z99A 2WAFA 4GD8A 4I3IA 1W63M 5FQQA 2WGIA 1P0ZA 1HLUP 2DRWA 3N8RA 1K56A 3P7NA 2HP6A 3DTKA 5JYPA 1M40A 3MZEA 3S7NA 1FILA 3G2ZA 1L0DA 2J7VA 3GTCA 2V2FF 5FQJA 1P9RA 3LFVA 3TOIA 1K4EA 3OOVA 2J3TD 1OTEA 3NBLA 1HTZA 4OLDA 2XROA 1IKGA 1GL9B 1I2SA 1LSVA 1VQQA 1N9NA 4ZJ2A 3A0VA 3F1NA 4C6YA 2PT7A 4OPRA 4HOIA 1EI5A 1YMSA 1C3BA 3MSHA 4GHIB 5U47A 4N92A 4UQIS 3TE8A 4Y2FA 1KGEA 3T1RA 2X01A 2HGVA 3D4UB 1NZUA 1SDEA 5EVIC 2ZC5B 4K0XA 4Q0JA 3LIDA 3A3DA 1J3WA 1ZUFA 3CWFA 2BASA 4PKYG 3EGDC 2WZZA 3HUOA 2QSFA 3MXRA 2PHYA 5CX7A 1JNUA 3PAGA 1BYWA 4IBRA 2W3HA 2B02A 3V5MA 1Y4OA 4E3JA 3SW1A 3NI9A 3C2WA 2WADA 3LIAA 3N8LA 4FD8A 3A0SA 5EE8A 1S6RA 4S2MA 3VP3A 1LL8A 4S2PA 3UDIA 1P9WA 1L0FA 3ZG8B 4O7DA 5FL3A 2Y2QA 3UPOA 4LGWA 1DJBA 5BOHA 4HHDA 4R1GA 2H10A 5KIZA 2HDSA 5DF8A 4EBPA 1FCMA 2O9AA 3L7HA 1DJAA 3OLOA 2JN7A 3C7VA 1WA9A 2WKIA 3FV7A 3HJIA 4KZ6A 3KSGA 3R4KA 2MJ6A 1YMXA 1H3QA 3IX3A 5EV0A 3H82B 4UA6A 1XFNA 1ZC2A 5DFYA 4KZBA 4EEPA 4IVKA 4DXCA 5EOEA 3UY6A 2H0TA 1N9OA 3LGOA 1NRJA 5F6AA 3OPLA 2JE5A 1K55A 3WS5A 4HP4A 3QP5A 5AQBA 3IH9A 1Y54A 4K91A 4OOLA 2QPNA 3IX8A 4MMNA 3DTEA 3MBZA 5GHZA 4JBFA 3BM6A 5FEGA 4Y7PA 5E2GA 3SS3A 2BTFP 2JKRM 2V9AA 2Y2NA 1ZLIB 1ZHHB 2W1TB 5TGFA 2ZMVA 4KENB 1XJ4A 4M3KA 4NKPA 3IF6A 1LSXA 2WKRA 5F82A 4OONA 5F5YA 1YSQA 5CGWA 1X0OA 3S22A 5M1AA 3ZG5A 4Y0TA 3VFHA 5G4ZA 1TDGA 3HBRA 3LEZA 1YLZA 3RXXA 5FQ9A 3T4SA 4BBVA 3Q7VB 4GKUA 4RX3A 1WQKA 4FOFA 1S4SA 3PBNA 1D1JA 2OWHA 2L0WA 1WE4A 1FSYA 1ZG6A 3AGEA 3MMHA 4R3BA 5TR7A 4CLCC 2ZLYA 2Y55A 1PW8A 5L2FA 1SH1A 4PM5A 2Y79A 2JBFA 1LL5A 5CRFA 1RP5A 2WGVA 5FASA 1G28A 3IWIA 3HCYA 3AGDA 3QP8A 4BMWA 2V1BA 2WYXA 3H82A 5CHUA 4EW7A 4X53A 1T1AA 5MC7A 1K4FA 3E98A 4PMAA 1MKIA 3HLBA 4Y0OA 4Y3IA 2KLIA 3UMEA 4H8RA 3T4TA 3U2AA 3WS4A 2VEAA 3B47A 3D9YA 1SKOB 1MPLA 2OLUA 1UGUA 3VE4A 3FG8A 3N6IA 3MXSA 5M19A 5FDHA 1FCNA 1I2WA 3CLOA 3O87A 1M6KA 2J3WA 4E3OA 4WM9A 1PNEA 1CI9A 4U3TA
chains in the Genus database with same CATH topology
5TBMB 4P6ZM 1N9LA 3BW6A 2HF6A 3KSIA 1DP9A 4GV5A 4XT2A 2YKFA 4G3VA 2O9CA 5J3WA 2INWA 4L0LA 1WXNA 2Z6DA 4HQAA 3NJAA 3CITA 1DP6A 4LRZE 4EU0A 3RTYA 3LR0A 3FPWA 1OPXA 1MKMA 4BBTA 5A8BA 2GNXA 5DF9A 1STZA 4WEJA 3NOUC 3VOLA 3MXQA 1XFQA 4NXFA 1OTIA 1GSWA 4WELA 4K08A 3F1OA 2LB9A 3K3DA 3TJZC 4O8GA 2YKHA 3G6OA 4G3KA 2D02A 5HL6A 4GS9B 4CLCD 2GJ3A 4I38A 4P6ZS 1XJ2A 1AHLA 4MDZA 4G3WA 2HJ9C 2H28A 3JVVA 2ZBBA 4HH2A 4KUKA 4R6LA 3MQQA 3EOIA 1T1CA 4LRXC 2WKPA 3VV4A 3C30A 4IJGA 4ETXA 2J3TC 3LI9A 4IHQA 2QJ7A 2HV1A 2FZ0A 1S4RA 5DJUA 2OOLA 4R3AA 1DRMA 4ARZB 2K2NA 3IBJA 3LMSB 1KOUA 1ZTUA 3BY9A 3KYQA 3GDIA 2W0NA 3S7OA 3UB6A 4EQ1A 2A24B 3NOPC 5HZHA 3LIBA 5IU1A 4HNBA 1TS7A 2D01A 4HJ4A 2K31A 2M7VA 5HWVA 4GW9A 3T50A 2MUBA 4GLQA 2W3EA 4NXEA 3DBAA 4Q0IA 1W63Q 3BY8A 3T4QA 3KEZA 4NEED 1D7EA 3LUQA 4ME4A 3ICYA 3OC2A 1LT0A 1B8WA 4WLAA 2EA9A 3PR6A 4EEUA 4I3AA 5G4YA 2V1AA 1NLZA 2IKDA 2VA0A 1S1ZA 5TBMA 2G7UA 1F5MA 2JHEA 3LI8A 1Z99A 4I3IA 1W63M 1D06A 2XRNA 3IS2B 5K5BA 1P0ZA 1V9ZA 4O0PA 3LYXA 5LBRA 4R38A 1MZUA 4II7A 5HPIA 4HJ3A 3LICA 4UEYA 3MYVA 2BDSA 3CAXA 5KSHA 2VGLS 2PYRA 3MJQA 4MCWA 1H8MA 4DMZA 3P7NA 1BDSA 4CQHA 5TJJA 2SH1A 3S7NA 2V0WA 2W1TA 2O0YA 2W1RA 3EEHA 4GCZA 2VZWA 3E4OA 3R7WB 2OAP1 5EFWA 1TS8A 1P9RA 3LFVA 4JGPA 1S1YA 4B9OA 4CLCB 2PD8A 4I39A 4MN5A 3OOVA 2J3TD 1OTEA 1TS0A 4FSFA 2JTOA 2XROA 4IUHA 3TRCA 1ZLHB 1LSVA 3C38A 2DMWA 1YSPA 3O5YA 4LLOB 1N9NA 1OT9A 4LRYC 2GZAA 5F68A 2QSHA 3FPVA 2K2XA 3A0VA 3F1NA 2B18A 4PAUA 4B93A 2P04A 2PT7A 4HOIA 4GHIB 3ZYTA 2QWSA 1LSWA 3C8CA 5J4EA 2XXLA 3UB7A 4UQIS 1ODVA 1UWPX 3TE8A 4Y2FA 5HWWA 3LIFA 4CLCE 3EQVA 1TF1A 3PBTA 2HGVA 3D4UB 1XJ3A 3BQAA 3PYPA 1V9YA 4Q0JA 3LIDA 1ZUFA 1ZUEA 2BASA 3CWFA 3K3CA 4XT2B 4PKYG 3EGDC 2OWJA 2QSFA 4WF0A 3OBFA 1F98A 2PHYA 5CX7A 1JNUA 1BYWA 3T4OA 4LPZA 2PD7A 1Y28A 2W3HA 2B02A 4BWIA 2P7JA 5DJTA 2J80A 3CI6A 4EESA 3SW1A 2EWWA 3C2WA 3LIAA 4L9GA 3A0SA 1LL8A 2NUTC 2Y8HA 3IS2A 2VGLM 3MFXA 1IOUA 2QKPA 2L4RA 2WKQA 3UE3A 1YKDA 4HH3A 1P9WA 3K2NA 2LB5A 4IUKA 2IA2A 4I3JA 5FL3A 2V0UA 4KUOA 4KQDA 2JKRI 3KSFA 3ULFA 1F9IA 4WUJA 3H7WA 2M1CA 1D6BA 3H9WA 4L9EA 4ETZA 5DKLA 3KX0X 2QHKA 3MR0A 4HHDA 5HDSA 5HWTA 3UMDA 4BJPA 2QJ5A 3LR3A 4L9FA 4BBUA 3R7WA 4PKYA 2B9KA 4YNRA 5KIZA 5HSQA 2O9AA 2GX5A 3KO6A 1T19A 1TD5A 2PR6A 4EERA 2ZMFA 4DJ3A 3W2ZA 3ZQ5A 3OLOA 4DN0A 4JGRA 4OOMA 2XA7M 2JN7A 3EWKA 2O99A 2O9BA 1WA9A 3LR5A 3RFBA 3NOTC 3HJIA 1APFA 4ZRRA 1MC0A 3PBOA 3KSGA 3R4KA 2Z6CA 3BJNA 2DLAA 2MJ6A 2M7UA 1T18A 1H3QA 1OTBA 4E04A 2VV6A 4JGOA 4GS9A 4UQIM 3H82B 5IS1A 4Q0HA 1DP8A 1XFNA 2KX6A 4HI4A 5DFYA 2JKTM 1OT6A 2PDRA 3PBSA 4EEPA 4QPRA 3D3OA 3S7PA 4KQOA 1N9OA 1NRJA 4F3LB 3F1PB 3BQ8A 3GECA 2VLGA 5F6AA 3UE6A 4Z1WA 2FH5A 2QYBA 2W27A 3FC7A 4HP4A 3UB9A 4ARZA 2P08A 5AJGA 4EETB 5F69A 4H6JB 5HDDA 2XA7S 5AVEA 2ZOIA 4OOLA 3PXPA 4JGQA 4MMNA 1OTAA 4RQ9A 3UB8A 2A24A 1GSXA 5HD5A 1IFQA 3HJKA 4O01A 2JKRM 2V9AA 2W3GA 3OCLA 3EEAA 1VB6A 5HPFA 1ZLIB 4HJ6A 1ZHHB 4EXOA 2KDKA 3VE3A 2W1TB 3EGXC 2ZMVA 1P97A 1OTDA 1XJ4A 3B42A 1S67L 4I5SA 5IT5A 2A2LA 3MQOA 3MF0A 4NKPA 2HJEA 4GJ4A 1NLYA 4NXBA 1SHIA 2JKTI 5HD3A 1LSXA 2WKRA 1S66L 2JR3A 3KYZA 3T4JA 5F5YA 3E0YA 3T4KA 4YIRA 1YSQA 4EUVA 2VKSA 4WN5A 1X0OA 4MN6A 4WL9A 5C5KA 5HDCA 5G4ZA 2PR5A 3PBQA 3D72A 1UWNX 3A0RA 4AFIA 3T4SA 4BBVA 1WQKA 2XSSA 4FOFA 1H5OA 1S4SA 2ZOHA 3F1NB 3PBNA 3F1OB 2L1MA 2OWHA 3PHYA 3OCNA 2L0WA 2W3FA 2H9XA 1EW0A 1XJ6A 3LR4A 4Y5FA 3T4LA 3MMHA 1YAXA 5AVFA 3S7QA 3P01A 3B33A 4CLCC 2PYPA 2MN3A 2VV7A 2OAQ1 3MQ0A 1SH1A 2Y79A 4DJ2A 3RH8B 2CMNA 2VJWA 4NXGA 5L8MA 1ATXA 3V67A 1G28A 3HCYA 2R78A 5DKKA 4BMWA 2I9VA 1T1BA 1VHMA 2V1BA 3H82A 4MN7A 3MCXA 3NHQA 2QSGA 3LIEA 4CLCA 4EW7A 1T1AA 2IKEA 5MC7A 3E98A 4HIAA 2VX8A 4Y3IA 2KLIA 3UMEA 4PHTA 2KOIA 3T4TA 4F3LA 5DFXA 3F1PA 3KSHA 3CUEC 3U2AA 4M4XA 3EQUA 3BWLA 2VEAA 3B47A 3PBRA 4H6JA 1GSVA 4YOFA 1OJGA 1UGUA 2RNGA 3E4PA 3VE4A 3JVUA 2W3DA 3FG8A 5J7EA 1G6OA 1NWZA 3TW8A 4WEKA 1OJ5A 4GHIA 4HP9A 5I5LA 1TS6A 2VV8A 3CLOA 3E4QA 4R70A 3IBRA 2J3WA 2NUPC 4YWZA 3CUEA 4HY8A 3H7WB 2EWVA 2K7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C38 A;  3C30 A;  2HJ9 C;  1ZHH B;  2HJE A; 
#chains in the Genus database with same CATH topology
 5TBM B;  4P6Z M;  2PU4 A;  3NC8 A;  2HF6 A;  4GOG A;  3TG9 A;  1W7F A;  4E6X A;  4GN2 A;  3CG5 A;  5GL9 A;  3DAV A;  3VP1 A;  4R4R A;  1OPX A;  3CZD A;  5L09 A;  1BLC A;  5DF9 A;  2Y2H A;  3HLD A;  2XFS A;  3BLM A;  1FR6 A;  3MXQ A;  1XFQ A;  4BEN A;  1ALQ A;  3IXH A;  3TJZ C;  1LLB A;  2D02 A;  4I38 A;  1AHL A;  3L9K A;  3Q1F A;  4G3W A;  4KUK A;  4R6L A;  2Y2I A;  2BG1 A;  4LRX C;  3C30 A;  2J8Y A;  5M18 A;  4KQQ A;  3LEQ A;  2FZ0 A;  4DE1 A;  4ARZ B;  4ZAM A;  4HEF A;  1NXY A;  3M6B A;  3LMS B;  1KOU A;  3E2L A;  5D3O A;  3DWK A;  2ZC4 B;  2I72 A;  3SH8 A;  5EM0 A;  5FI2 A;  3N8S A;  1TS7 A;  4P85 A;  2X02 A;  2K31 A;  4YIN A;  5HWV A;  3V3S A;  2MUB A;  1SKO A;  4GLQ A;  1L3L A;  4Q0I A;  3BY8 A;  3T4Q A;  4E3I A;  3CPT B;  5FAP A;  4DE3 A;  4ME4 A;  1KVL A;  4LV0 A;  1YLP A;  4C75 A;  4RYE A;  1B8W A;  3PR6 A;  3OZH A;  4EEU A;  2V1A A;  5L10 A;  2VA0 A;  4OQI A;  5TBM A;  4X69 A;  3T1Q B;  4BD0 A;  5CXW A;  3V50 A;  4GDB A;  2WGW B;  2ZM8 A;  4IBX A;  1V9Z A;  3V3R A;  5K5B A;  5LBR A;  4R38 A;  1GA0 A;  3LIC A;  3MYV A;  1K57 A;  2PYR A;  5E2H A;  5A93 A;  1H8M A;  4Y0U A;  2XLN A;  1BDS A;  5HL1 A;  1BT5 A;  4CQH A;  1NYY A;  1W5D A;  2ZQC A;  5FSR A;  1KGG A;  4JLF A;  3A3F A;  2Q0O A;  2O0Y A;  2ZJ9 A;  1I5Q A;  4S2L A;  4JGP A;  1S1Y A;  4DE2 A;  4N1X A;  2PD8 A;  4CLC B;  4FTX A;  4LCM A;  1AWI A;  4MN5 A;  2FFY A;  2Q9M A;  1TS0 A;  1HVB A;  1JWZ A;  1FIK A;  4IUH A;  3C38 A;  4LLO B;  3MS6 A;  4LRY C;  2HDU A;  1VEU B;  2E8I A;  2QSH A;  4EWF A;  2EX6 A;  3FPV A;  2OV5 A;  3M2K A;  4QHC A;  4PAU A;  4S2K A;  2WK0 A;  4N9L A;  5AQ9 A;  3VOY A;  3ZYT A;  3C8C A;  2BLS A;  2C6W B;  5J4E A;  3BFG A;  1ODV A;  3G35 A;  1XX2 A;  4S2N C;  3EQV A;  3PBT A;  1XJ3 A;  1IYS A;  1V9Y A;  1L0E A;  4XT2 B;  3CPT A;  3VSL A;  3QHY A;  4WF0 A;  5EOO A;  2R9X A;  4DKI A;  2OSU A;  2J80 A;  3CI6 A;  4L9G A;  4DDS A;  4QB8 A;  2VGL M;  3MKE A;  2QKP A;  1JWV A;  2Y91 A;  3SH9 A;  4Q8I A;  4OVD A;  2IA2 A;  4KZ8 A;  2V0U A;  5GLD A;  4KQD A;  3ULF A;  1F9I A;  2XEP A;  4WUJ A;  2M1C A;  4P87 A;  4S2O A;  3H9W A;  5HX9 A;  4L9E A;  3Q82 A;  5CTM A;  4WMC D;  1MWT A;  5HWT A;  1LL9 A;  2QJ5 A;  4L9F A;  4BBU A;  4QU3 A;  1BUE A;  2WUQ A;  4DXB A;  1NZO A;  1YPR A;  2GX5 A;  2HDQ A;  2XK1 A;  1T19 A;  1TD5 A;  4EER A;  2WAE A;  3W2Z A;  1Z09 A;  4X55 A;  3EWK A;  2O9B A;  4N1H A;  1MWR A;  3LR5 A;  3NOT C;  3ZNY A;  4ZRR A;  1APF A;  3PBO A;  1VEU A;  2Z6C A;  3BJN A;  4FH2 A;  2M7U A;  3BEB A;  1T18 A;  1MWU A;  1OTB A;  4OPQ A;  3UDF A;  1K54 C;  4GS9 A;  3UE1 A;  2Y4A A;  1DP8 A;  4DDY A;  3DTI A;  4HI4 A;  4NK3 A;  3UDX A;  2H5S A;  3PBS A;  5A91 A;  2ZQ8 A;  5GLB A;  1SCW A;  3D3O A;  5EVI D;  2G2U A;  3S7P A;  3IHB A;  1VM1 A;  2FH5 A;  2W27 A;  3FC7 A;  3UB9 A;  5L07 A;  5AJG A;  4H6J B;  2ZOI A;  2R9W A;  1YM1 A;  2A24 A;  1GSX A;  5HD5 A;  4ZBE A;  4OLG A;  3QP4 A;  1PW1 A;  3OCL A;  4KZ9 A;  1TDL A;  3HLG A;  4EXO A;  3VE3 A;  1JTG A;  4BQM A;  3B42 A;  1F2K A;  4I5S A;  5IT5 A;  2EX9 A;  3MQO A;  1NLY A;  4NXB A;  4X1M A;  1S66 L;  4XUZ A;  4RA7 A;  3RXW A;  3T4J A;  4YIR A;  3G31 A;  4EQI A;  4WL9 A;  4FH4 A;  5HAQ A;  3RJU A;  2PR5 A;  3PBQ A;  3E2K A;  4WBG A;  4AFI A;  1IYO A;  2ZOH A;  3ISG A;  1ES3 A;  4E3N A;  3PHY A;  3OCN A;  2W3F A;  1XJ6 A;  1W8Y A;  3LR4 A;  4Y5F A;  3T4L A;  4JF6 A;  3B33 A;  5F1G A;  5I94 A;  5CHM A;  3GR2 A;  1BSG A;  1J9M A;  3RH8 B;  2VJW A;  3VSK A;  3CJM A;  3IWO A;  2R78 A;  2I9V A;  5G18 A;  4R3J A;  1RGY A;  3MCX A;  3NHQ A;  2QSG A;  3LIE A;  4X25 A;  2IKE A;  3QNC A;  4IVI A;  4FCF A;  3GRJ A;  1XKZ A;  4PHT A;  1K25 A;  5DFX A;  2J9P A;  3CUE C;  1ZG4 A;  2XGN A;  2ZM2 A;  4X1L A;  3PBR A;  4H6J A;  3ZVW A;  5AQ7 A;  3E4P A;  4PM6 A;  1BLP A;  2RL3 A;  3IXD A;  1NWZ A;  4GHI A;  2C5W B;  1SKF A;  3E4Q A;  2VGJ A;  3IBR A;  4WZ5 A;  4E6W A;  1NY0 A;  4NET A;  4PM7 A;  3UE0 A;  1XGI A;  3H7W B;  3NUL A;  4ZTK A;  1IKI A;  5CGS A;  1N9L A;  5CTN A;  3FWL A;  1GKU B;  2XDM A;  4GV5 A;  2P9V B;  4G3V A;  2O9C A;  1PI5 A;  1WXN A;  3JYI A;  3CIT A;  1JWP A;  4LRZ E;  2PBD P;  4BBT A;  4CJN A;  2HDR A;  5A8B A;  2XR0 A;  3GSG A;  5FI7 A;  2HZ5 A;  3VOL A;  4NXF A;  1GSW A;  4WEL A;  4K08 A;  4Y15 A;  4O8G A;  2YKH A;  3G6O A;  3WWX A;  1KVM A;  5GHX A;  4CLC D;  1XJ2 A;  2HJ9 C;  1YLT A;  1T1C A;  2WKP A;  1IEM A;  4IJG A;  4OQH A;  2PRF A;  4IHQ A;  1GHI A;  1DRM A;  2WZX A;  3VFF A;  2K2N A;  1XA1 A;  3VOZ A;  1ZTU A;  2ZMA A;  2ZC3 B;  1K56 D;  3UB6 A;  4EUZ A;  5IU1 A;  4UHU A;  2D01 A;  4HJ4 A;  4QY6 A;  4NXE A;  3DBA A;  1K6S A;  2V8F A;  1PZP A;  3LUQ A;  1BLS A;  3ICY A;  4MBK A;  3QP1 A;  4KG5 A;  1NYM A;  4WLA A;  5HAI A;  3WS1 A;  5FAO A;  1QME A;  1S0W A;  1F5M A;  2JHE A;  5EVI B;  1GHM A;  2IWD A;  1D06 A;  3NY4 A;  1IEL A;  3IS2 B;  5EM1 A;  3LYX A;  1CF0 A;  1AXB A;  5A92 A;  2BDS A;  1EL6 A;  1BLH A;  4MCW A;  2P74 A;  4DMZ A;  4KZ5 A;  1PIO A;  1SHV A;  2XQZ A;  4QY5 A;  2SH1 A;  1FQG A;  2V0W A;  5FQM A;  2W1T A;  4D2O A;  2VZW A;  4ID4 A;  3W8K A;  1TS8 A;  2UWX A;  1BTL A;  3ZHH A;  1YLY A;  3U4L P;  1KE3 A;  3VP2 A;  4FSF A;  4LFU A;  4PPR A;  4R4S A;  3BFD A;  5E43 A;  1YSP A;  3O5Y A;  3UNW A;  5F68 A;  1SZV A;  3Q7V A;  4WMC A;  4X6T A;  4Z9Q A;  2K2X A;  3P09 A;  2B18 A;  1YQS A;  1EWZ A;  4QJG A;  3S1Y A;  4R23 A;  2QWS A;  3W4P A;  3UB7 A;  1NRF A;  1L2S A;  3MKF A;  4X68 A;  4GDN A;  1TF1 A;  3BQA A;  3PYP A;  4BLM A;  2XH9 A;  1FR1 A;  4MNR A;  3QP6 A;  3K3C A;  3NDG A;  4UA7 A;  3O88 A;  1F98 A;  3T4O A;  1Y28 A;  2UV0 E;  4OQ0 A;  2Y2O A;  2P7J A;  5DJT A;  1XXM A;  5EVI A;  4EBL A;  2ZL1 B;  3ZG9 B;  1E3U D;  2NUT C;  2Y8H A;  3IS2 A;  3MFX A;  1IOU A;  3D4F A;  3UE3 A;  2WKQ A;  1ES5 A;  1U60 A;  3HLW A;  3K2N A;  4IUK A;  4MBH A;  4I3J A;  4KZ3 A;  4JXS A;  4KUO A;  1ES4 A;  3HL9 A;  4KZA A;  1D6B A;  3ZCZ A;  3HRE A;  5DKL A;  3KX0 X;  5HDS A;  1QMF A;  3UMD A;  4BJP A;  3IWQ A;  2B9K A;  4JKT A;  1KE4 A;  2FFF B;  2Y2P A;  4MEZ A;  3FKW A;  2WKE A;  2EFX A;  2Y2M A;  3OPP A;  4KZ4 A;  1TEM A;  2ZMF A;  4DJ3 A;  3ZQ5 A;  3SS5 A;  1PRQ A;  3RFB A;  1MC0 A;  3WRZ A;  2Y2L A;  2Q9N A;  2DLA A;  4E04 A;  4OKP A;  1K55 C;  2VV6 A;  4JGO A;  4UQI M;  4Q0H A;  1ES2 A;  2JKT M;  3B3X A;  1OT6 A;  3G30 A;  2V1Z A;  4OPY A;  3IXG A;  3JPU A;  3ZVT A;  1XGJ A;  4S2I A;  3UO9 A;  3UE6 A;  4OQG A;  2ZQ7 A;  3BRM A;  4OP8 A;  4ARZ A;  1YT4 A;  2XA7 S;  3ZFZ A;  1OTA A;  1JVJ A;  3IF6 C;  1IFQ A;  4C3Q A;  2W3G A;  5CEC A;  1MXO A;  4GD6 A;  5HPF A;  4HJ6 A;  3WRT A;  4DF6 A;  1TVF A;  3DWZ A;  1OTD A;  4MLL A;  4GZB A;  1CEF A;  1YLJ A;  4GJ4 A;  4N9K A;  4Y17 A;  1SHI A;  2JKT I;  5HD3 A;  2AVX A;  2JR3 A;  1E4D A;  3E0Y A;  3T4K A;  2VKS A;  1NJ4 A;  5C5K A;  2Z2M B;  3Q81 A;  3HUM A;  3IF4 A;  2WGW A;  1N4O A;  3M6H A;  3F1N B;  5FDS A;  2A3U A;  3A3I A;  2JCH A;  2B95 A;  2L1M A;  1L0G A;  3M2J A;  4B4X A;  4KG2 A;  1BUL A;  2H9X A;  1EW0 A;  4E3K A;  5AVF A;  3S7Q A;  3IT9 A;  2PYP A;  1YLW A;  1PYY A;  3W4Q A;  2OAQ 1;  5FI6 A;  2CMN A;  5L8M A;  1ERQ A;  1ATX A;  1A0K A;  1ESU A;  1Q2Q A;  4RVA A;  2XFT A;  4CLC A;  3GMW A;  4HIA A;  1KDS A;  4CPK A;  3G4P A;  1XP4 A;  2KOI A;  2XD1 A;  3EQU A;  4F94 A;  1KE0 A;  5F83 A;  1GSV A;  1ONG A;  2RNG A;  3JVU A;  4LV3 A;  1VET B;  2W3D A;  2ZQD A;  1HZO A;  1O7E A;  4LV2 A;  4WEK A;  3BFE A;  1TS6 A;  4R70 A;  2Y2J A;  3MFD A;  3VP4 A;  4DE0 A;  4LEN A;  3G2Y A;  3PAE A;  3BW6 A;  3KSI A;  4XT2 A;  2YKF A;  2H0Y A;  4BL3 A;  3VP0 A;  2INW A;  2VGK A;  4U0X A;  1JTD A;  4HQA A;  2QZ6 A;  1DP6 A;  1RCJ A;  4EU0 A;  4OOY A;  2G2W A;  2GNX A;  3CHW P;  1KGF A;  1STZ A;  1Q2P A;  3NOU C;  2OLV A;  3BFC A;  1OTI A;  4LV1 A;  3SZT A;  3K3D A;  2RCX A;  3JVV A;  2H28 A;  3HVF A;  2PBY A;  5CEB A;  1G68 A;  4XXR A;  2E8J A;  2J3T C;  4ETX A;  2IWB A;  2V8C A;  4QD4 A;  3LI9 A;  1MY8 A;  2HV1 A;  1S4R A;  2Z2L B;  1LI0 A;  2HPB A;  1FSW A;  2EXB A;  5HAP A;  3BEC A;  3BY9 A;  3GDI A;  3G34 A;  1IYP A;  4EQ1 A;  3NOP C;  3ZG7 B;  3LIB A;  3UN7 A;  3N4I A;  2PAV P;  4GW9 A;  1CK3 A;  3T50 A;  1H5X A;  3O3V A;  4LCL A;  5CER A;  1VET A;  4P6B A;  3HLE A;  3KEZ A;  4NEE D;  3TSG A;  1H8Y A;  1D7E A;  2QMI A;  3BLS A;  3IF6 B;  5GLA A;  2IWC A;  1LT0 A;  3IF5 A;  1K57 C;  1S1Z A;  4IED A;  2G7U A;  1RGZ A;  3LI8 A;  2Y2G A;  1PWG A;  2XRN A;  4BD1 A;  5J8X A;  2ZD8 A;  4O0P A;  1ERM A;  1MZU A;  3O86 A;  4II7 A;  2Y59 A;  5HPI A;  4HJ3 A;  4UEY A;  4MBF A;  3CAX A;  5KSH A;  2EXA A;  2VGL S;  3MJQ A;  5AQA A;  3CMZ A;  1Z6F A;  5TJJ A;  2W1R A;  1E3U A;  3EEH A;  4GCZ A;  2ZQ9 A;  1PZO A;  3E4O A;  3R7W B;  2OAP 1;  5EFW A;  1PFL A;  3HLF A;  5DVA A;  4B9O A;  4I39 A;  2EFU A;  4EBN A;  1K0K A;  1SDN A;  3ZDJ A;  2JTO A;  3WS2 A;  3TRC A;  1ZLH B;  2DMW A;  1G5U A;  1LI9 A;  1OT9 A;  2GZA A;  2GDN A;  4JXW A;  5KSC A;  3FYZ A;  4UAA A;  5DTK A;  3NCK A;  2JKF A;  3S4X A;  4B93 A;  2P04 A;  5IHV A;  3NEC A;  1LSW A;  4RX2 A;  3P98 A;  4B88 A;  1KDW A;  2ZC6 B;  3G32 A;  2XXL A;  3SS4 A;  1UWP X;  3BFF A;  5HWW A;  3LIF A;  4CLC E;  4UA9 A;  2V20 A;  5DTT A;  1ZUE A;  5FA7 A;  5GLC A;  4E3L A;  2EX8 A;  5E2F A;  2OWJ A;  2Y2K A;  3OBF A;  4LPZ A;  2PD7 A;  2ZC7 A;  4S2N A;  4ZJ1 A;  1ERO A;  4BWI A;  4EES A;  2XD5 A;  2EWW A;  3HUN A;  4NG2 A;  3UPP A;  1W8Q A;  3IQA A;  1GHP A;  3NIA A;  2L4R A;  4D60 A;  1YKD A;  3PTE A;  4HBU A;  4HH3 A;  5GHY A;  1MWS A;  4KZ7 A;  3C4O A;  2LB5 A;  2A49 A;  3IXB A;  2JKR I;  3KSF A;  1K38 A;  5HFO A;  1CJF A;  3Q7Z A;  4P0M A;  3H7W A;  3SH7 A;  2B5R A;  4JXG A;  4ETZ A;  4ZDX A;  2QHK A;  3MR0 A;  5KMW A;  3LR3 A;  3R7W A;  4A5R A;  4PKY A;  4YNR A;  2P9V A;  5HSQ A;  4BL2 A;  3DW0 A;  3DTM A;  3KO6 A;  2PR6 A;  3OPR A;  4DN0 A;  4HES A;  4JGR A;  4OOM A;  2XA7 M;  3UB5 P;  2HP9 A;  2O99 A;  5JYO A;  3V39 A;  2CC1 A;  1LHY A;  1ACF A;  3IHA A;  3ITB A;  5EVL A;  5IS1 A;  1ZKJ A;  3OPH A;  2KX6 A;  2PDR A;  5FEF A;  3A3J A;  1G6A A;  4QPR A;  1PWC A;  4QWO A;  3ITA A;  2J9O A;  4KQO A;  5E2E A;  3T1X A;  4F3L B;  3F1P B;  3BQ8 A;  3GEC A;  2VLG A;  3C5A A;  3GV9 A;  4Z1W A;  2QYB A;  1K54 A;  2P08 A;  4EET B;  5F69 A;  3QNB A;  5HDD A;  5AVE A;  3MZF A;  1FOF A;  5CHJ A;  1K6R A;  2EX2 A;  3PXP A;  4JGQ A;  4E3M A;  4Y13 A;  4RQ9 A;  3UB8 A;  4ZJ3 A;  5EPH A;  3HJK A;  4O01 A;  3KYE A;  3UPN A;  1GA9 A;  3EEA A;  1VB6 A;  5F1F A;  3FZC A;  3I7J A;  3VMA A;  4PM9 A;  2KDK A;  1BZA A;  1FCO A;  3EGX C;  1P97 A;  1WYC A;  1S67 L;  2JC7 A;  2A2L A;  3ZNT A;  3MF0 A;  3ZG0 A;  2HJE A;  3FKV A;  1ONH A;  3Q07 A;  1IYQ A;  1W79 A;  2HP5 A;  3KYZ A;  4EUV A;  1XPB A;  4WN5 A;  4MN6 A;  4KG6 A;  5HDC A;  3N7W A;  3D72 A;  1UWN X;  3A0R A;  4OPZ A;  4JF5 A;  2XSS A;  1H5O A;  1XA7 A;  3F1O B;  4ESP A;  4KQR A;  1CEG A;  1YAX A;  3P01 A;  2MN3 A;  2VV7 A;  3QP2 A;  3MQ0 A;  4DJ2 A;  4NXG A;  3V67 A;  1N9B A;  5DKK A;  3LCE A;  1T1B A;  1VHM A;  5FQK A;  4MN7 A;  1OME A;  4DRT A;  4EV4 A;  2VX8 A;  3BYD A;  4YFM A;  4U0T A;  5CED A;  4F3L A;  5EVE A;  3LY4 A;  3F1P A;  3KSH A;  4WZ5 C;  4M4X A;  2JKG A;  3BWL A;  2ACG A;  3NDE A;  4YOF A;  4GNU A;  1OJG A;  2ZM0 A;  4JXV A;  4GB7 A;  5J7E A;  1G6O A;  4WYY A;  3TW8 A;  1OJ5 A;  4HP9 A;  5I5L A;  2VV8 A;  2VK3 A;  1PWD A;  3MZD A;  3HLC A;  4X56 A;  5EUA A;  2NUP C;  4YWZ A;  3CUE A;  4HY8 A;  2EWV A;  1HD8 A;  2K7S A;  3T1S A;  3T12 B;  1DJC A;  2WKH A;  1H0M A;  1DP9 A;  5KZH A;  5J3W A;  4L0L A;  5FAQ A;  5DTS A;  2Z6D A;  3NJA A;  1H8Z A;  2XF3 A;  4OP5 A;  3RTY A;  3LR0 A;  3AGF A;  3FPW A;  1PI4 A;  1MKM A;  3A3E A;  5TFQ A;  3IX4 A;  1DY6 A;  2ZL1 A;  4WEJ A;  3GVB A;  3F1O A;  2LB9 A;  4G3K A;  5HL6 A;  1GCE A;  4GS9 B;  2GJ3 A;  3LY3 A;  1ESI A;  4P6Z S;  4FUW A;  4S2J A;  4MDZ A;  2DNS A;  3C4P A;  4HH2 A;  2ZBB A;  3LO7 A;  4R0Q A;  5DF7 A;  1WYB A;  5EEC A;  3W4O A;  3MQQ A;  3EOI A;  3VV4 A;  2DCF A;  2QJ7 A;  5DJU A;  2OOL A;  4R3A A;  4B4Z A;  5FAT A;  3IBJ A;  3KYQ A;  2ZQA A;  2PU2 A;  2W0N A;  3S7O A;  5A90 A;  4PM8 A;  2A24 B;  5HZH A;  4HBT A;  4HNB A;  3SOI A;  2M7V A;  5CGX A;  3GQZ A;  4JF4 A;  1E25 A;  2W3E A;  4WZ4 A;  1W63 Q;  4K0W A;  1MBL A;  3IH8 A;  5HAR A;  4OH0 A;  3OC2 A;  3WS0 A;  4JPM A;  5HW3 A;  1CQA A;  2EA9 A;  1O07 A;  3ZGA B;  4I3A A;  5G4Y A;  1CI8 A;  1NLZ A;  2IKD A;  5FQI A;  2X71 A;  4XUX A;  3C7U A;  1Z99 A;  2WAF A;  4GD8 A;  4I3I A;  1W63 M;  5FQQ A;  2WGI A;  1P0Z A;  1HLU P;  2DRW A;  3N8R A;  1K56 A;  3P7N A;  2HP6 A;  3DTK A;  5JYP A;  1M40 A;  3MZE A;  3S7N A;  1FIL A;  3G2Z A;  1L0D A;  2J7V A;  3GTC A;  2V2F F;  5FQJ A;  1P9R A;  3LFV A;  3TOI A;  1K4E A;  3OOV A;  2J3T D;  1OTE A;  3NBL A;  1HTZ A;  4OLD A;  2XRO A;  1IKG A;  1GL9 B;  1I2S A;  1LSV A;  1VQQ A;  1N9N A;  4ZJ2 A;  3A0V A;  3F1N A;  4C6Y A;  2PT7 A;  4OPR A;  4HOI A;  1EI5 A;  1YMS A;  1C3B A;  3MSH A;  4GHI B;  5U47 A;  4N92 A;  4UQI S;  3TE8 A;  4Y2F A;  1KGE A;  3T1R A;  2X01 A;  2HGV A;  3D4U B;  1NZU A;  1SDE A;  5EVI C;  2ZC5 B;  4K0X A;  4Q0J A;  3LID A;  3A3D A;  1J3W A;  1ZUF A;  3CWF A;  2BAS A;  4PKY G;  3EGD C;  2WZZ A;  3HUO A;  2QSF A;  3MXR A;  2PHY A;  5CX7 A;  1JNU A;  3PAG A;  1BYW A;  4IBR A;  2W3H A;  2B02 A;  3V5M A;  1Y4O A;  4E3J A;  3SW1 A;  3NI9 A;  3C2W A;  2WAD A;  3LIA A;  3N8L A;  4FD8 A;  3A0S A;  5EE8 A;  1S6R A;  4S2M A;  3VP3 A;  1LL8 A;  4S2P A;  3UDI A;  1P9W A;  1L0F A;  3ZG8 B;  4O7D A;  5FL3 A;  2Y2Q A;  3UPO A;  4LGW A;  1DJB A;  5BOH A;  4HHD A;  4R1G A;  2H10 A;  5KIZ A;  2HDS A;  5DF8 A;  4EBP A;  1FCM A;  2O9A A;  3L7H A;  1DJA A;  3OLO A;  2JN7 A;  3C7V A;  1WA9 A;  2WKI A;  3FV7 A;  3HJI A;  4KZ6 A;  3KSG A;  3R4K A;  2MJ6 A;  1YMX A;  1H3Q A;  3IX3 A;  5EV0 A;  3H82 B;  4UA6 A;  1XFN A;  1ZC2 A;  5DFY A;  4KZB A;  4EEP A;  4IVK A;  4DXC A;  5EOE A;  3UY6 A;  2H0T A;  1N9O A;  3LGO A;  1NRJ A;  5F6A A;  3OPL A;  2JE5 A;  1K55 A;  3WS5 A;  4HP4 A;  3QP5 A;  5AQB A;  3IH9 A;  1Y54 A;  4K91 A;  4OOL A;  2QPN A;  3IX8 A;  4MMN A;  3DTE A;  3MBZ A;  5GHZ A;  4JBF A;  3BM6 A;  5FEG A;  4Y7P A;  5E2G A;  3SS3 A;  2BTF P;  2JKR M;  2V9A A;  2Y2N A;  1ZLI B;  1ZHH B;  2W1T B;  5TGF A;  2ZMV A;  4KEN B;  1XJ4 A;  4M3K A;  4NKP A;  3IF6 A;  1LSX A;  2WKR A;  5F82 A;  4OON A;  5F5Y A;  1YSQ A;  5CGW A;  1X0O A;  3S22 A;  5M1A A;  3ZG5 A;  4Y0T A;  3VFH A;  5G4Z A;  1TDG A;  3HBR A;  3LEZ A;  1YLZ A;  3RXX A;  5FQ9 A;  3T4S A;  4BBV A;  3Q7V B;  4GKU A;  4RX3 A;  1WQK A;  4FOF A;  1S4S A;  3PBN A;  1D1J A;  2OWH A;  2L0W A;  1WE4 A;  1FSY A;  1ZG6 A;  3AGE A;  3MMH A;  4R3B A;  5TR7 A;  4CLC C;  2ZLY A;  2Y55 A;  1PW8 A;  5L2F A;  1SH1 A;  4PM5 A;  2Y79 A;  2JBF A;  1LL5 A;  5CRF A;  1RP5 A;  2WGV A;  5FAS A;  1G28 A;  3IWI A;  3HCY A;  3AGD A;  3QP8 A;  4BMW A;  2V1B A;  2WYX A;  3H82 A;  5CHU A;  4EW7 A;  4X53 A;  1T1A A;  5MC7 A;  1K4F A;  3E98 A;  4PMA A;  1MKI A;  3HLB A;  4Y0O A;  4Y3I A;  2KLI A;  3UME A;  4H8R A;  3T4T A;  3U2A A;  3WS4 A;  2VEA A;  3B47 A;  3D9Y A;  1SKO B;  1MPL A;  2OLU A;  1UGU A;  3VE4 A;  3FG8 A;  3N6I A;  3MXS A;  5M19 A;  5FDH A;  1FCN A;  1I2W A;  3CLO A;  3O87 A;  1M6K A;  2J3W A;  4E3O A;  4WM9 A;  1PNE A;  1CI9 A;  4U3T A; 
#chains in the Genus database with same CATH homology
 5TBM B;  4P6Z M;  1N9L A;  3BW6 A;  2HF6 A;  3KSI A;  1DP9 A;  4GV5 A;  4XT2 A;  2YKF A;  4G3V A;  2O9C A;  5J3W A;  2INW A;  4L0L A;  1WXN A;  2Z6D A;  4HQA A;  3NJA A;  3CIT A;  1DP6 A;  4LRZ E;  4EU0 A;  3RTY A;  3LR0 A;  3FPW A;  1OPX A;  1MKM A;  4BBT A;  5A8B A;  2GNX A;  5DF9 A;  1STZ A;  4WEJ A;  3NOU C;  3VOL A;  3MXQ A;  1XFQ A;  4NXF A;  1OTI A;  1GSW A;  4WEL A;  4K08 A;  3F1O A;  2LB9 A;  3K3D A;  3TJZ C;  4O8G A;  2YKH A;  3G6O A;  4G3K A;  2D02 A;  5HL6 A;  4GS9 B;  4CLC D;  2GJ3 A;  4I38 A;  4P6Z S;  1XJ2 A;  1AHL A;  4MDZ A;  4G3W A;  2HJ9 C;  2H28 A;  3JVV A;  2ZBB A;  4HH2 A;  4KUK A;  4R6L A;  3MQQ A;  3EOI A;  1T1C A;  4LRX C;  2WKP A;  3VV4 A;  3C30 A;  4IJG A;  4ETX A;  2J3T C;  3LI9 A;  4IHQ A;  2QJ7 A;  2HV1 A;  2FZ0 A;  1S4R A;  5DJU A;  2OOL A;  4R3A A;  1DRM A;  4ARZ B;  2K2N A;  3IBJ A;  3LMS B;  1KOU A;  1ZTU A;  3BY9 A;  3KYQ A;  3GDI A;  2W0N A;  3S7O A;  3UB6 A;  4EQ1 A;  2A24 B;  3NOP C;  5HZH A;  3LIB A;  5IU1 A;  4HNB A;  1TS7 A;  2D01 A;  4HJ4 A;  2K31 A;  2M7V A;  5HWV A;  4GW9 A;  3T50 A;  2MUB A;  4GLQ A;  2W3E A;  4NXE A;  3DBA A;  4Q0I A;  1W63 Q;  3BY8 A;  3T4Q A;  3KEZ A;  4NEE D;  1D7E A;  3LUQ A;  4ME4 A;  3ICY A;  3OC2 A;  1LT0 A;  1B8W A;  4WLA A;  2EA9 A;  3PR6 A;  4EEU A;  4I3A A;  5G4Y A;  2V1A A;  1NLZ A;  2IKD A;  2VA0 A;  1S1Z A;  5TBM A;  2G7U A;  1F5M A;  2JHE A;  3LI8 A;  1Z99 A;  4I3I A;  1W63 M;  1D06 A;  2XRN A;  3IS2 B;  5K5B A;  1P0Z A;  1V9Z A;  4O0P A;  3LYX A;  5LBR A;  4R38 A;  1MZU A;  4II7 A;  5HPI A;  4HJ3 A;  3LIC A;  4UEY A;  3MYV A;  2BDS A;  3CAX A;  5KSH A;  2VGL S;  2PYR A;  3MJQ A;  4MCW A;  1H8M A;  4DMZ A;  3P7N A;  1BDS A;  4CQH A;  5TJJ A;  2SH1 A;  3S7N A;  2V0W A;  2W1T A;  2O0Y A;  2W1R A;  3EEH A;  4GCZ A;  2VZW A;  3E4O A;  3R7W B;  2OAP 1;  5EFW A;  1TS8 A;  1P9R A;  3LFV A;  4JGP A;  1S1Y A;  4B9O A;  4CLC B;  2PD8 A;  4I39 A;  4MN5 A;  3OOV A;  2J3T D;  1OTE A;  1TS0 A;  4FSF A;  2JTO A;  2XRO A;  4IUH A;  3TRC A;  1ZLH B;  1LSV A;  3C38 A;  2DMW A;  1YSP A;  3O5Y A;  4LLO B;  1N9N A;  1OT9 A;  4LRY C;  2GZA A;  5F68 A;  2QSH A;  3FPV A;  2K2X A;  3A0V A;  3F1N A;  2B18 A;  4PAU A;  4B93 A;  2P04 A;  2PT7 A;  4HOI A;  4GHI B;  3ZYT A;  2QWS A;  1LSW A;  3C8C A;  5J4E A;  2XXL A;  3UB7 A;  4UQI S;  1ODV A;  1UWP X;  3TE8 A;  4Y2F A;  5HWW A;  3LIF A;  4CLC E;  3EQV A;  1TF1 A;  3PBT A;  2HGV A;  3D4U B;  1XJ3 A;  3BQA A;  3PYP A;  1V9Y A;  4Q0J A;  3LID A;  1ZUF A;  1ZUE A;  2BAS A;  3CWF A;  3K3C A;  4XT2 B;  4PKY G;  3EGD C;  2OWJ A;  2QSF A;  4WF0 A;  3OBF A;  1F98 A;  2PHY A;  5CX7 A;  1JNU A;  1BYW A;  3T4O A;  4LPZ A;  2PD7 A;  1Y28 A;  2W3H A;  2B02 A;  4BWI A;  2P7J A;  5DJT A;  2J80 A;  3CI6 A;  4EES A;  3SW1 A;  2EWW A;  3C2W A;  3LIA A;  4L9G A;  3A0S A;  1LL8 A;  2NUT C;  2Y8H A;  3IS2 A;  2VGL M;  3MFX A;  1IOU A;  2QKP A;  2L4R A;  2WKQ A;  3UE3 A;  1YKD A;  4HH3 A;  1P9W A;  3K2N A;  2LB5 A;  4IUK A;  2IA2 A;  4I3J A;  5FL3 A;  2V0U A;  4KUO A;  4KQD A;  2JKR I;  3KSF A;  3ULF A;  1F9I A;  4WUJ A;  3H7W A;  2M1C A;  1D6B A;  3H9W A;  4L9E A;  4ETZ A;  5DKL A;  3KX0 X;  2QHK A;  3MR0 A;  4HHD A;  5HDS A;  5HWT A;  3UMD A;  4BJP A;  2QJ5 A;  3LR3 A;  4L9F A;  4BBU A;  3R7W A;  4PKY A;  2B9K A;  4YNR A;  5KIZ A;  5HSQ A;  2O9A A;  2GX5 A;  3KO6 A;  1T19 A;  1TD5 A;  2PR6 A;  4EER A;  2ZMF A;  4DJ3 A;  3W2Z A;  3ZQ5 A;  3OLO A;  4DN0 A;  4JGR A;  4OOM A;  2XA7 M;  2JN7 A;  3EWK A;  2O99 A;  2O9B A;  1WA9 A;  3LR5 A;  3RFB A;  3NOT C;  3HJI A;  1APF A;  4ZRR A;  1MC0 A;  3PBO A;  3KSG A;  3R4K A;  2Z6C A;  3BJN A;  2DLA A;  2MJ6 A;  2M7U A;  1T18 A;  1H3Q A;  1OTB A;  4E04 A;  2VV6 A;  4JGO A;  4GS9 A;  4UQI M;  3H82 B;  5IS1 A;  4Q0H A;  1DP8 A;  1XFN A;  2KX6 A;  4HI4 A;  5DFY A;  2JKT M;  1OT6 A;  2PDR A;  3PBS A;  4EEP A;  4QPR A;  3D3O A;  3S7P A;  4KQO A;  1N9O A;  1NRJ A;  4F3L B;  3F1P B;  3BQ8 A;  3GEC A;  2VLG A;  5F6A A;  3UE6 A;  4Z1W A;  2FH5 A;  2QYB A;  2W27 A;  3FC7 A;  4HP4 A;  3UB9 A;  4ARZ A;  2P08 A;  5AJG A;  4EET B;  5F69 A;  4H6J B;  5HDD A;  2XA7 S;  5AVE A;  2ZOI A;  4OOL A;  3PXP A;  4JGQ A;  4MMN A;  1OTA A;  4RQ9 A;  3UB8 A;  2A24 A;  1GSX A;  5HD5 A;  1IFQ A;  3HJK A;  4O01 A;  2JKR M;  2V9A A;  2W3G A;  3OCL A;  3EEA A;  1VB6 A;  5HPF A;  1ZLI B;  4HJ6 A;  1ZHH B;  4EXO A;  2KDK A;  3VE3 A;  2W1T B;  3EGX C;  2ZMV A;  1P97 A;  1OTD A;  1XJ4 A;  3B42 A;  1S67 L;  4I5S A;  5IT5 A;  2A2L A;  3MQO A;  3MF0 A;  4NKP A;  2HJE A;  4GJ4 A;  1NLY A;  4NXB A;  1SHI A;  2JKT I;  5HD3 A;  1LSX A;  2WKR A;  1S66 L;  2JR3 A;  3KYZ A;  3T4J A;  5F5Y A;  3E0Y A;  3T4K A;  4YIR A;  1YSQ A;  4EUV A;  2VKS A;  4WN5 A;  1X0O A;  4MN6 A;  4WL9 A;  5C5K A;  5HDC A;  5G4Z A;  2PR5 A;  3PBQ A;  3D72 A;  1UWN X;  3A0R A;  4AFI A;  3T4S A;  4BBV A;  1WQK A;  2XSS A;  4FOF A;  1H5O A;  1S4S A;  2ZOH A;  3F1N B;  3PBN A;  3F1O B;  2L1M A;  2OWH A;  3PHY A;  3OCN A;  2L0W A;  2W3F A;  2H9X A;  1EW0 A;  1XJ6 A;  3LR4 A;  4Y5F A;  3T4L A;  3MMH A;  1YAX A;  5AVF A;  3S7Q A;  3P01 A;  3B33 A;  4CLC C;  2PYP A;  2MN3 A;  2VV7 A;  2OAQ 1;  3MQ0 A;  1SH1 A;  2Y79 A;  4DJ2 A;  3RH8 B;  2CMN A;  2VJW A;  4NXG A;  5L8M A;  1ATX A;  3V67 A;  1G28 A;  3HCY A;  2R78 A;  5DKK A;  4BMW A;  2I9V A;  1T1B A;  1VHM A;  2V1B A;  3H82 A;  4MN7 A;  3MCX A;  3NHQ A;  2QSG A;  3LIE A;  4CLC A;  4EW7 A;  1T1A A;  2IKE A;  5MC7 A;  3E98 A;  4HIA A;  2VX8 A;  4Y3I A;  2KLI A;  3UME A;  4PHT A;  2KOI A;  3T4T A;  4F3L A;  5DFX A;  3F1P A;  3KSH A;  3CUE C;  3U2A A;  4M4X A;  3EQU A;  3BWL A;  2VEA A;  3B47 A;  3PBR A;  4H6J A;  1GSV A;  4YOF A;  1OJG A;  1UGU A;  2RNG A;  3E4P A;  3VE4 A;  3JVU A;  2W3D A;  3FG8 A;  5J7E A;  1G6O A;  1NWZ A;  3TW8 A;  4WEK A;  1OJ5 A;  4GHI A;  4HP9 A;  5I5L A;  1TS6 A;  2VV8 A;  3CLO A;  3E4Q A;  4R70 A;  3IBR A;  2J3W A;  2NUP C;  4YWZ A;  3CUE A;  4HY8 A;  3H7W B;  2EWV A;  2K7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...