2RNGA

Solution structure of big defensin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
79
structure length
79
Chain Sequence
NPLIPAIYIGATVGPSVWAYLVALVGAAAVTAANIRRASSDNHSCAGNRGWCRSKCFRHEYVDTYYSAVCGRYFCCRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords Big defensin
publication title A novel beta-defensin structure: a potential strategy of big defensin for overcoming resistance by Gram-positive bacteria
pubmed doi rcsb
total genus 12
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2007-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14862 Defensin_big Big defensin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2000 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2rngA01
2.20.20.10 Mainly Beta Single Sheet Anthopleurin-A Anthopleurin-A 2rngA02
1ZUEA 1SH1A 2JTOA 1ATXA 1Z99A 3D4UB 1WXNA 4GV5A 1SHIA 1WQKA 2SH1A 2BDSA 2MN3A 1H5OA 1AHLA 1ZLIB 1ZUFA 1ZLHB 3LMSB 2MUBA 2K2XA 2H9XA 1APFA 2RNGA 1B8WA 1D6BA 1BDSA
chains in the Genus database with same CATH superfamily
1LPQA 4GFBA 3W6VA 3AG2H 2ACJA 4KN7X 1X1PA 5GPAA 1FOYA 3I71A 3HXLA 3HEFA 1X1DA 5HLGA 2PX9A 2W4SA 1MMDA 4UXNA 2VASA 2MD5A 4HNVA 5IP9J 3PUBA 2UUZA 2DLLA 3GCMA 3F0CA 4HLXA 3GBGA 4EMSA 2Q2EA 1LDDA 1XGSA 2BVLA 2X1CA 3W2VA 4DIQA 2H8WA 2DCEA 4Y33A 1WCMJ 2A5WA 2K9SA 3AKZA 4RS8A 2KHMA 2JZYA 3QPTA 2W25A 1W7PD 1WHUA 4Z6YA 4ESFA 2JQ7A 4A12A 3HRTA 1MH3A 3ZN0A 2W84A 2A6TA 1WH5A 4L5EA 4KISA 1WJDA 2K4JA 4ZC3A 1MIJA 4I76A 4BXUA 1NK2P 1T08B 2XF5A 2CUEA 4M6XA 1RUNA 2L01A 1P4XA 2E1MC 1TQPA 1ZG1A 4II3A 4BJTA 2AHQA 4M9ZA 4ABZA 4M74A 4HF1A 3S1NJ 1PYVA 4RGUA 3JREA 3OIQA 1IG7A 5FFXA 2OQGA 2AXLA 2MC4A 4EGZA 1O3TA 5GAHJ 2CV2A 3M1CA 5LEJA 1WPKA 2HYJA 2GWRA 3FK6A 2VQLA 4R1HA 1ZLKA 1B1BA 2VI6A 2WV0A 3WU0A 3GFMA 3TO9A 3K0LA 3ZMVA 2W57A 3Q0UA 1XMKA 4PSXA 4IKFA 4E6KG 3P5JA 4BE1A 2CU7A 4P55A 3KLNA 3QU6A 5M3MJ 1TW3A 3ZXSA 1BR4A 1M1EB 4E7JA 5TJJA 2KDZA 1FYKA 4PDKA 2N8GA 1IAWA 4X6AJ 1ON2A 2JVHA 1BJZA 4CCOA 5DM7F 3OY9A 4D7NA 4DOZA 1R4MB 2O7OA 2VODA 3G1OA 5M5WJ 2QQBA 1J5YA 2DFFA 5DS9A 2O9LA 2KIMA 1DU6A 2DAOA 2E5NA 1W5CC 3KE2A 4CGZA 4JOMA 1XTAA 3RKWA 2EQRA 2HOEA 3M1EA 1O7LA 2LTPA 1WJEA 5HDNA 1SVOA 5CVRA 2COBA 2FU4A 4GXOA 5AIPA 2ZJRF 1T39A 3H3VK 2MG4A 1OR7A 1AHDP 1NTCA 2JT1A 3CUQB 4EM0B 2UXXA 3E0JB 1I3QJ 5HLTA 1U3EM 1RKTA 1VQNI 3CJNA 2P6TA 2NVYJ 4ESJA 3J7AO 1IUYA 3BJ6A 4DJAA 2V26A 2QZ8A 2M1BA 2O5RA 2Z5UA 1ETVA 3GTKJ 5H6QA 5E3OA 1JTXA 3KYDB 2HOAA 1SMTA 2RNGA 3MKWB 4BBSJ 1LNWA 4HRIA 3AG4H 2QKMB 3RKYA 1VNDA 3RKXA 4G12A 5J1UA 1VQ9I 5D6EA 3OL4A 1UHSA 2V4JC 2XVCA 3OSFA 2A69F 2Y9ZA 3Q5FA 1R00A 1I6XA 3F8FA 3MQ0A 4IVNA 2DT5A 3H3ZA 4O6JA 4IJAA 4IXAA 3PO2J 1RNLA 2OTLI 1B4AA 2CV1A 2XGCA 3I64A 1PUFB 5J4YA 1VQPI 5EF6A 3BPVA 1YI2I 3F3XA 4YELA 1S9HA 4E7IA 2VXDA 3G3ZA 3QU3A 2ZO4A 4NQWA 3BR6A 1ZUEA 4B44A 1MBEA 3K4CA 4FQGA 2IKDA 4BEHB 2PQ8A 3MKYB 1U5TC 4XSXF 2HQNA 1ZREA 1J7KA 2BDSA 2JSCA 2O03A 2PI0A 5DD4A 4ENKA 4KNYA 1JI8A 4A3MJ 4XLAA 1R4NB 3CCUI 4WCGA 1EH8A 2HYGD 1IXSB 1YTYA 2JA5J 1Y6IA 4DYRA 3C18A 2VIXA 1HC8A 2ZFUA 3IH2A 1EH7A 1P4WA 3FXJA 1K6YA 2CUZA 2RVCA 2CQNA 3I53A 1MNEA 4C3JJ 3C2BA 3HGGA 2IGKA 3D0SA 3LSRA 2WAQN 3KP3A 1E3HA 5IT3A 1JJ8C 3QOPA 1PUEE 1WJCA 3CO6C 2A5YB 2X1EA 2DA4A 2FBHA 3JRHA 4LLNA 1U9NA 4XLNF 3GVAA 1ZRFA 4G6TB 4OU0A 3LA2A 3CCSI 4D1QA 3KP2A 5FLXZ 3L9FA 3X2QH 2ECBA 2K27A 4KIBA 1E0EA 4LIVA 2DMPA 2OV7A 2MLGA 1IRXA 3QPSA 1Z7LA 2JTVA 5DCFA 3LSTA 3PUFA 2CO5A 2RDPA 3VSKA 3F23A 2IEKA 2K4BA 4IHSA 4G94A 4ZTFA 2L7MP 4EJVA 2PMHA 1G3SA 3U9GA 4XN3A 4J19A 2OTJI 2QQ9A 3K1MA 1H8AC 2XRNA 3IL2A 3RPUA 1JT0A 4G8XA 2BOLA 2ZJQF 2GZWA 4M9SA 3SXYA 4N4OB 4AIJA 1OCTC 3EQLF 1YJWI 5LD2C 1W36C 3WTSC 3MKLA 4JK1X 4LK1F 4KT6A 2YU3A 3IV5A 4XRFA 3OYEA 1SD6A 2JTOA 3LSPA 2HOTA 3WTVC 2KKOA 3HOTA 1NG7A 1A36A 5ICGA 5L3EA 3BP8A 3R6SA 1T38A 1YHQI 2HQRA 2WWYA 1WKMA 1Z3YA 2NYXA 1YG2A 2A07F 2X48A 2TDXA 1UJ8A 4HX8A 2VT2A 3ESWB 3H92A 3IWFA 4FETA 2ZXJA 5FROA 5E3NA 3LWFA 4L5JA 2BZTA 4BBRJ 2GM4A 3PNTA 2Z16A 1B6AA 4MGRA 5GP9A 4ESBA 3IUOA 1ZN2A 1FTZA 4RMNA 4U88A 2HZDA 1BA5A 1SH1A 3K7AJ 4GDFA 3ZMDA 4U7DA 3I59B 3QP5A 1YO5C 1YIJI 1WSUA 2E1CA 3KCCA 2JUCA 1ULYA 4N9HA 3S2HJ 2EB7A 1P7IA 2FNPA 5IP7J 4JX6A 2XPUA 3B6CA 1X2MA 3CF2A 3LA3A 4GGGA 4XLHA 2YX4A 3WTUC 1Z9CA 3FXRA 4M6YA 1HW2A 2HEOA 2KPMA 2Y2ZA 4G6DA 3KFWX 1IW7F 2M45A 1WWXA 3GTMJ 3F72A 4U0WA 2R7OA 3WTWC 3WGHA 4P9FA 3S1RJ 2E1OA 2HXOA 2V1XA 1TT5B 2HI3A 3E5QA 3E97A 4HBLA 3OYNA 3N97A 2NVTJ 1DPUA 3W2AA 3MZ8A 1Q1HA 3VYRB 1GVJA 4UY8I 4L0ZB 4JP0A 1F9NA 3I4NJ 2XXLA 2KIUA 5BMZA 4PZJA 4UVBA 4P1WA 2IS1A 3LQQA 2WV1A 2P6SA 4BYYA 1APFA 1DP3A 3I59A 1ZRDA 1N77A 4UNOA 1JGSA 4TV7A 2FBKA 3ULQB 1HLVA 2VOPA 5E17F 2F4MB 4BHBA 3HJEA 1TT0A 2EZKA 1T56A 1SAUA 2DDAA 4CYCA 2NNYA 3KP5A 3HSRA 2K7LA 3DF8A 4PK4A 3W6JB 3TP0A 4FISA 9ANTA 2L54A 4CICA 5BOXA 1HDDC 3DBRB 4A3GJ 2DODA 1MZBA 2M9HA 2CJJA 3FK7A 2LFBA 3REOA 3FWEA 2HQ5A 2OF7A 3CMEI 1JKRC 3DEUA 2A05A 1ZG5A 2BY0A 2XKOA 1TWHJ 3MKZA 1TWAJ 4GYIA 4LB5A 3A1YA 4A3CJ 2DA3A 1RI7A 2M30A 4EEFG 2P7CB 3ABLH 5H20A 4M3BA 2JJ7A 2LBFB 1OFCX 4UV9A 1R71A 3F8NA 2CFOA 3E3VA 4NB5A 4IOCF 3Q0VA 2RV8A 4M71A 3R61A 1BI0A 2K02A 5IOZA 2DN0A 2FOKA 3CCVI 1X1BA 3JRIA 1FBQA 2V1NA 4FTHA 3M3YJ 3BROA 5J1YA 4BACA 1W36D 2JA6J 3CJQB 2FMYA 4QLCU 1BW5A 4KMUX 4G6QA 4A6EA 2YS9A 5GADJ 4PJJA 3ZQFA 2JR3A 3SDBA 2R7QA 4C2UA 5J6XA 3J80K 3RZOJ 1HW5A 1LJ9A 2Y31A 1IDZA 2M7BA 3K9TA 2LOOA 1YRNA 3HKZN 2M2EA 1OKRA 4ASNA 3OYLA 1Y1WJ 4KUMA 2EA4A 4LITA 3LOCA 4I02A 3TW6A 3D5SC 5BQTA 1KYWA 2Y69H 4L18B 4NC7A 1PP8F 1KU7A 3HSEA 3CJTB 3BQZA 1TQIA 2D1HA 3BY6A 2MW8A 2DYSH 4A3DJ 4ANJA 2UWMA 5FKLA 3O6BB 5E1ZB 4HYEA 3S14J 2ZMEB 1AU7A 5J4VA 5FLVA 3KYLA 4X0GA 1VQOI 1X1AA 1Y56A 4L9TA 1AA7A 1SD4A 1RUOA 1O4XA 2PJRB 1D8JA 2HVSA 1HSJA 4ENNA 2KP6A 3LSMA 5CPRB 1G2HA 1SFXA 4GYGA 3LMSB 3S2DJ 2JUGA 1YYVA 3H3UA 2DA6A 2WC2A 2ZXIA 3GZ5A 1EH6A 4OWRB 2F5DA 3TL4X 4PFPA 4BQNA 1D3YA 5ED4A 1FOWA 1JKPC 2EFOA 1MJBA 4B47A 4C9YA 1TWFJ 1IGNA 1I1SA 2DW4A 3BG6A 4N9IA 2GXGA 5KVRA 3H5AA 3AL0B 4OMYA 1FPQA 5J40A 1NG6A 2MH2A 2WY8Q 4ZZLA 1V5GA 3KEQA 2ZMEA 2P5VA 2HPIA 2R5YB 1Z1DA 1Y0UA 2CQXA 2J5OA 1G59A 2PLYA 1Z3XA 2XDVA 4F52A 3JSPA 1MBJA 4OAYA 3HUGA 2PJRA 2HWVA 2CQQA 2VOOA 4O5VA 2EV0A 1I1GA 3CMYA 3MN2A 4MHGA 5D5UB 3KX2A 2PG4A 4DW6A 1EL6A 4QPOA 3ZMSA 5L3DA 3F6OA 5LBQA 3OYIA 2IS4A 2DA1A 5ICFA 1D1BA 2O8KA 1W7PA 3Q9SA 3H1CA 4XOPA 1YJNI 2VBXA 2YSRA 2COMA 5LHIA 4S04A 5HS7A 4YFKF 3IKVA 1KA8A 2M3AA 4A3KJ 1FMVA 2DMQA 3IH3A 1RPWA 3TMOA 4MQVA 5A2QZ 2E5ZA 3CC7I 4PJMA 1VF9A 1JHFA 3HOZJ 2BXZA 2FF4A 3QRFF 3KLOA 1A6QA 2P0WA 2DO7A 4IF4A 1ETOA 4N4NB 4YEJA 4XBFA 5C3EJ 2R5YA 2QSFX 3GTLJ 3CESA 1MJAA 4F3QA 4F93B 1ZQ3P 3LFUA 1VZ0A 3F8BA 4UUSB 1EKEA 5F0HA 3ZCOA 5E20A 2R7XA 3H36A 1QGPA 2HS5A 2LK2A 3DEEA 3BZCA 2R7VA 2IPQX 3U1DA 3W6KB 3J81K 1X4PA 2EV6A 3OSGA 2ZXWH 2VUMJ 3HIFA 1Y39A 1Q1VA 2GXBA 4BS9A 2OQRA 4Y3OA 3WTXC 2QWWA 4M73A 4ZZDA 2F5VA 2HGCA 5EZGA 1WFXA 2DT6A 2FOWA 3PQJA 2B9KA 2DMUA 2GXAA 4MIMA 5C4JJ 3S93A 5LGUA 2M34A 2XHKA 3BCBA 4RA2A 1HOMA 5BPIA 1MMNA 3S2WA 3PQKA 1UHMA 2XB0X 1P2FA 1JUPA 3GFLA 1C0WA 2JMWA 1K7AA 2WB1N 1QBJA 2GBYA 1JUSA 3K6GA 1MD0A 5GAGJ 3T1BA 3JR9A 4UUSA 2CQKA 2XAQA 1IC8A 1S7OA 1A35A 4U0YA 5LHGA 1BM9A 3LSKA 2OCCH 3NQOA 1V3FA 3FXMA 2G7HA 3HGYA 3ZMTA 1WZ2A 2PMZA 5L3CA 1O3QA 2F6CA 1FYMA 3J81Z 3OIOA 1OCPA 3GO5A 3WU1B 2G9WA 4OIOF 2Q2EB 3CCRI 2DYRH 3LL7A 3SZTA 4A3FJ 2R3SA 2FX0A 3FKIJ 3JRAA 1VQ4I 2OA4A 3HOWJ 1GKUB 1ZR4A 1XMAA 2JA7J 1SVMA 3L2VA 5DV5A 1APLC 4BKXA 4DZPA 3BOQA 5EGOB 1LUJB 1YFHA 3S1QJ 2BE5F 3K2AA 2CSOA 1BC7C 2RQQA 1XDSA 3DLAA 4C30A 1R5GA 4EQQA 3G2BA 2WADA 4YFXF 2F2EA 1SFUA 2AO9A 3VB2A 1FTTA 1RC9A 3GTPJ 2O6GE 3ABUA 1QU3A 2I10A 1J0RA 1XSDA 3KYCB 2DOAA 4Y52J 2EFQA 1TC3C 4XRMA 1LE8A 1F4KA 3IF4A 1X1CA 3HOXJ 2ID3A 3RYPA 1LQ1A 3GLLA 4PJLA 3H5NA 4EJWA 6PAXA 2X9DA 3K4NA 3AG3H 1JT6A 2L7ZA 1UAAA 1FWZA 5IYCJ 5ERIA 3KZIC 3C7JA 5IP6A 1GHCA 2WTEA 4UHTA 3OYBA 4IEJA 5EGOA 2QQ8A 4QSHA 5KCMA 4V19K 2QSGX 3A4CA 2JVGA 4LLLA 3ASOH 2R7ZJ 1Z67A 5B1BH 5LEKA 4FX4A 2IRFG 4ZYGA 1YX3A 4DYQA 4WX9A 2G7UA 2HJ9C 3K10A 1U0JA 2FQ3A 2FBIA 5J3LA 4WWCA 3KEZA 2QVOA 4V2GA 1R49A 4WF2A 3GXOA 2IVMA 4PFOA 3BR3A 1N78A 1JKQC 1LDJA 1LFPA 3MD2A 3TDUC 3VYTB 5BPDA 4XICA 1KQ8A 4QPQA 2FNAA 1ZLJA 1WQKA 1XGMA 3OYFA 1KQ0A 3V7SA 4BDZA 2P5LC 2ISZA 2PFBA 1FC3A 4AC0A 3ISPA 1MW7A 3GUDA 4XLPF 5EEGA 5EEHA 4NC6A 2GLOA 2DBBA 1T33A 1MMGA 3DBHB 3J7YJ 5M3FJ 1SFEA 1FOXA 2KQRA 2OC6A 3EYIA 4BXXJ 4CCLA 1FLIA 1T98A 1K6OA 3K4MA 2XPWA 1T6SA 3HL2A 2HKOA 3RZDJ 3BWGA 5CVIA 5F08A 4NUBA 1CF7B 4XLCA 4M3FA 1FZPB 4FHTA 5J8CA 1BR2A 3MAJA 4IQJA 2H94A 1QHHD 2KRHA 2JK3A 1EV7A 4RAYA 4M6VA 4RB2C 3BZ6A 1DDNA 1E17A 2VLAA 4A5MA 4XRSG 3KP6A 2O61A 3QOEA 3ZQCA 2JRTA 3EUAA 4B48A 3VOEA 1Z99A 2L02A 3LAPA 1AKHB 4J01A 1KGSA 3JCUC 2MBFA 4BGDA 4KJZA 2R7DA 3SEQA 4BHPA 3UKGA 1H5OA 3K4JA 1S6LA 2V9VA 2GIVA 4NQWB 1B72B 2C6YA 1DU0A 4KMFA 1IN7A 1ETWA 2W1OA 4WXCA 2Y0SN 4N0BA 2GAUA 4RAZA 4HQEA 1CF7A 2IS2A 2XV4S 4HOBA 5FLMJ 2MA3A 4CZCA 1MNDA 2A3SA 2M0CA 3PL8A 4OOIA 5D8LB 1MDMA 1HF0A 1SC7A 1VI0A 4LG0B 1G8XA 4NC8A 3G6EI 3DTEA 4ETSA 2FMLA 1GV2A 1Z7UA 1FJLA 1YITI 2KZGA 5B66C 1TW2A 1ZLHB 1HW1A 2H09A 2CH0A 3A0BC 1AKHA 3BLYA 3SZGA 4EJUA 5DDGA 3FDYA 3CDLA 4NBQA 3U21A 5FRMA 2AXTC 1SD5A 1U8RA 5J47A 3L2UA 2EWNA 1T0FC 2Z3YA 1B72A 4KICA 1R9TJ 2Y75A 2M4GA 2R7UA 3CUQC 5KNLA 2X6WA 1OCRH 3OS2A 3L7WA 5GPCA 4Y15A 2NXNB 3BJOA 4D5CA 2VQGA 4CA0A 5FLXK 3DCFA 1WJBA 4ZJZA 1QZEA 4HEA2 5J8FA 2IKEA 1R6RA 3H35A 4Q48A 1G3YA 1RKWA 1U5TA 2GOMA 4LG0A 4HV5A 1FNNA 2IT0A 2MSYA 1XMXA 1A6IA 5F0CA 3CTAA 2R7SA 5FB2A 2VL8A 4A3IJ 3C2HA 3ZP5A 1OCZH 2AQEA 2DJIA 2P81A 5EYRA 3VSLA 4BY7J 4A0YA 1U2WA 2XAUA 3S3OA 3OS0A 3RKQA 1FEXA 3B6AA 2FJ1A 4BQOA 1LFUP 1BIAA 2Z33A 2P4WA 1WRJA 2RNJA 2WAQA 3DTIA 3V4GA 4BU2A 2QENA 5BS6A 2DOFA 2X1DA 2R7WA 4E7LA 2L5QA 5LGNA 4XL9A 5HS9A 1QRYA 4RB0A 4YIIA 1P7JA 1HKSA 2MGQA 3ZQ7A 4RLFA 4L9JA 3P9CA 1X58A 2ZSHB 1R5ID 4AYBA 1Z6RA 3FKJA 2KL4A 3D1NI 4L0YB 3LA7A 3R60A 4PJ0C 2KJBA 3GZNB 2ADUA 5FD6A 2MN3A 3DKXA 3PNYA 4BL0B 5HS8A 4IPAA 2JPCA 4HF2A 4F92B 2W85A 3A02A 4HX7A 5D5VB 5B1AH 5JVGF 3MZHA 4BDYA 3HOUJ 4IHVA 1IJWC 2CQ7A 2XSDC 3TEDA 2ZB9A 2H1KA 3TGNA 3GLXA 4BJ5C 1OYYA 3L1PA 2CS3A 2FXAA 1SFKA 5CQEA 1S72I 4RGXA 1ZHFA 4ENJA 3CLOA 4M3GA 3CCMI 4YG2F 2Q0OA 3FZVA 3CLQA 1TZLA 1F1ZA 3TW7A 1UG2A 3CF5F 1LVKA 1B8IB 1R58A 2NS8A 5IT9K 3TO6A 1S3JA 1RZ4A 2LLKA 5JLXA 2V9PA 2LY1A 2ELKA 5E8IA 2CW7A 3DKYA 1VFCA 1WJFA 3OIPA 4I09A 3I58A 1W1WE 1MMSA 2WAFA 1E3PA 2XGEA 2ZC2A 2F5CA 2X85A 3DQVC 1UHWA 4ZYAA 1D8KA 4K2EA 5AIQA 3FF5A 4LJZF 2Y0MA 2E2HJ 1B9MA 3ABKH 2QSFA 3DEWA 2Q1ZB 4LIUA 2CMPA 3ZOBA 2JN6A 3ZMUA 3WU2C 4CYCB 1EJ9A 3MVPA 2HDDA 1WQ2A 4U87A 1VQ6I 3QYFA 3RCOA 3KETA 1ATXA 3DP7A 1H9GA 4A0ZA 2DT7B 3V42A 1IXCA 4RAGA 1IRZA 1X19A 2D2WA 4F91B 3NWTA 2DFIA 2MD0A 3C1DA 2X4HA 3S8PA 1B8IA 1LFBA 5D4RA 3JTGA 5LGTA 5IT9Z 5DYMA 1GV5A 2MUBA 2OBPA 1BW6A 1V5EA 2RAEA 4AIHA 1MBFA 3HRUA 2VBYA 3QYEA 2CGPA 3HSFA 2KMUA 1DUXC 2LR8A 3OS1A 1X4OA 1QVTA 5DCMA 2R93J 1BDSA 3SYTA 4XRSA 5ICEA 5HVQC 4FX0A 3P7NA 4KIGA 1JHHA 3K1PA 3HRMA 1D0ZA 3GTGJ 1SHIA 3BC8A 2SH1A 1YIOA 1OYWA 1KU3A 2EFPA 2MYSA 1R1UA 4A2UA 2X6OA 3KP4A 3RQ4A 3BZKA 4J00A 4F7ZA 2E34A 4AM3A 5HODA 3K4KA 1QPMA 5CVJA 1O57A 3RSNA 5E3MA 1T8IA 1G3TA 1GVDA 3F21A 3PIPF 4DGWB 2EZIA 3CMMA 4MTEA 4KIFA 3D5LA 3FMRA 4HSRA 1BOBA 5KHDA 3RPQA 2XRLA 4U0VA 5E1WA 1FIAA 2L3DA 4WXDA 1YRNB 4AIDA 2VB6A 1TTYA 3I0TA 2BV6A 4EATA 2V1UA 1MKMA 3ZRGA 2OZUA 3V7RA 2V7FA 2DTZA 3DWLE 5LFAA 2NRAC 4IO9F 4CUGA 4BHCA 4JX5A 3OYCA 4CO8A 3NWSA 5F0FA 4HA8A 2XGDA 4RAFA 1XS9A 2KJCA 3FM5A 1G3WA 3OR2C 4A69C 4KN4X 3SFIA 1T2KA 4OIRF 2DFEA 2ECCA 5CVUA 5FJ8J 3OYGA 2MLKA 3O8GA 1B8WA 4H0EA 1WI3A 5M5XJ 2RGVA 3JRGA 3H9JA 2EFWA 4HW0A 2LDUA 4A3EJ 4Q47A 4EVIA 2HJEA 4RB1A 1YX5A 5DUIA 1X3WB 4NNJA 4CCKA 4ZH4F 2KDOA 2K86A 5K7FA 3EUHC 3P9IA 3UNGC 4MEYF 2M4KA 2QBYA 3HHGA 3VWBA 1FIPA 3I9V2 2HQAA 4CSWA 2FE3A 3VFZA 2I8DA 1Z77A 4AUXA 3HKZA 2VT3A 3MYVA 3RTRA 2LP0A 3NEUA 3ROUA 2LNBA 5E3LA 1FYLA 2QSGA 4BE2A 2E36A 4PGGA 4NHJA 2YU9J 1TL8A 3CD6I 5JLWA 2QM3A 2GA1A 4D5FA 1I3AA 1X2NA 4A93J 4CZZA 4HV6A 4S0HB 3HUGB 3IWZA 4FE7A 5IY5H 2WBMA 2X6YA 2NOJB 2Z99A 2HDWA 1FSEA 5FRNA 3GTQJ 1QVUA 1FOKA 4ITVA 3M4OJ 5D5XB 4B4CA 2E7WA 1LEAA 1ZGWA 3AG1H 2E2JJ 1W7PB 2ETHA 2NS7A 4M9XA 2EA2A 1K61A 4MTDA 1XX5A 1WGXA 2XPVA 2DU9A 4O3MA 3NAUA 5HNHA 3C38A 5A2QK 1POGA 3H0DA 1Y0NA 2BY3A 3GTJJ 2XKPA 4XSZF 1Z21A 4XLFA 3IHUA 5FGMA 3M9AA 3K1NA 3R4KA 1JTYA 1I39A 2MH9A 1MBGA 1D0XA 1UB9A 1R1TA 3L2QA 1FBSA 1FY7A 3WE2A 4UVAA 5D6FA 3SJMA 3COAC 1J59A 4RGRA 2LY9A 2WA0A 3T5XA 1ZARA 3BG3A 1SMYF 2R5ZB 2PN6A 5TISC 3SZPA 1ITYA 1OLTA 2B9SA 1ETYA 2BY2A 4PGHA 1HDPA 4HPQA 4D0PA 1PP7U 3HBLA 1TBXA 2VE8A 2IAIA 2L7FP 1W5SA 4IRIA 3U2RA 4G7OF 2QYOA 2LH9A 1S29A 1LKXA 2H1LA 1IZ1A 1USTA 2DMNA 4BQQA 2FSWA 3QPHA 2EIMH 3TP3A 3BR1A 4I98B 2P5KA 1FSHA 3RQIA 3TOAA 5IYBJ 1TQMA 1Z91A 1OYIA 4HNUA 1D6BA 3S1MJ 2YX7A 3B73A 2E71A 1MSEC 4GRIA 2DA2A 5BNGA 3DFGA 2BXYA 2O0YA 2W00A 3JW4A 3H9GA 2BW3A 3WGGA 4I6ZA 2GQQA 2OJED 2R5ZA 1UFMA 3SEZA 2HR3A 4WK8F 3I56I 3K4LA 3ZQGA 5CLSA 3E5UA 4CH7A 5CQGA 2KIQA 2L4MA 3ECHA 2IP2A 1RRJA 2K85A 1XGNA 3M7GA 4YIRX 1ETKA 2M8GX 3NARA 1MGTA 1G6NA 5F6FA 4CYDA 4A3LJ 4C3HJ 3IAM2 2YPRA 4AIKA 4QTRA 1STZA 2CWEA 3HTUA 5JI6A 2BHZA 2DQLA 3HB9A 2NVQJ 1Y8QB 4MEXF 5KAIC 2XC7A 4MFEA 2DDBA 2P8TA 4XNFA 3CMAI 3V7CA 4E4HA 3RDIA 4I2OA 2J5PA 5LLQA 2E35A 1ZGJA 2VC1A 2XF7A 2IXSA 2XUBA 1GT0C 1LE8B 1X3ZB 2MABA 2HFHA 3A03A 4RB3C 4B09A 4PUSA 2MC3A 2HZTA 2UZKA 4IOAF 2R0QC 2M8EA 3G1LA 1I50J 1BC8C 2Y9YA 3ABTA 4XOTA 1RR7A 4RM2A 2BY1A 5F27A 1VQMI 4IZZA 2PMZN 4W1UA 4I0AA 4BXFA 5TRDA 2L9VA 4HDUA 1ONVA 3O8HA 3PO3J 2A6HF 5GTIC 3HM5A 4RBOA 3OYAA 3T8RA 1IUFA 2E7XA 2OU2A 3WGIA 2PJPA 2PBIA 1HBXG 1UZCA 1F5TA 2QF7A 3I54A 1WXNA 4GV5A 5E8GA 4IL6C 1MMAA 1OQYA 3LSIA 2HOSA 2DPUA 2LMDA 2E1MB 3VYUB 5H2FC 3RYRA 2H8RA 2W7NA 2CRGA 3D5RC 1BIBA 3GMEA 3PM1A 4LOCA 3FXUA 5K1YA 1REPC 2CYYA 1LDKB 5HOOA 2Y48A 4OMZA 3OYKA 1UMQA 4E70A 2EFNA 1S8NA 3CO7C 2GOXB 1ZH5A 1ZRCA 1HKTA 3HZJA 3A01A 3QYBA 3VEPA 4YFNF 3BTJA 3HG9A 2CG4A 4ZYHA 1X3UA 3DLLF 4BQAA 1RESA 4BY1J 2XSJC 1XCBA 3QPLA 2DLAA 4EM1A 4B3AA 2KISA 1J2XA 1BR1A 2DTRA 2R92J 2KT0A 1W4MA 3IAS2 3TBIA 1R22A 1D5YA 2STTA 2XF6A 3H9QA 2GIZA 2IA2A 4XKVA 5CJ9A 3V8JA 3OMYA 4RGSA 4OIPF 3Q3SA 1A04A 1GUUA 3MCXA 2LREA 3JRBA 4QWQA 2CV0A 5ILVA 3LNQA 3CCEI 1VQ8I 5F04A 4A0XA 2ZNZA 1WJ5A 1MBHA 1OCOH 2G0EA 4M3DA 3DPTA 4B43A 1OCCH 2EZLA 1UCRA 4HLYA 4G7ZF 1VQKI 1XSVA 2FRHA 1YS7A 4AWXB 1H9TA 1XC5A 2IBDA 4XQFA 4DBQA 1PJRA 1ZLIB 2ME0A 1S5LC 1IO2A 3FHNA 1A5JA 4Y13A 3PJRA 2VPRA 3UR3C 2H6BA 2IW5A 5CVVA 3WHBA 3S15J 4L9VA 4XKCA 5K5RA 2DXIA 3CQZJ 2B63J 1ZYRF 3BTIA 5FKMA 2ZSIB 3S3NA 2NS0A 4FASD 4IRHA 3CJRB 4AU7A 4BUPA 4LD5A 2E1NA 2VKVA 2O8XA 1VQLI 4R8HA 5E1XA 1Z05A 5M5YJ 3O3KA 3RJPA 3W3CA 2Q8KA 1WVRA 1RIOH 3C30A 1O3SA 1CQTA 1I27A 3FXQA 2VXZA 4CDGA 3GTOJ 3I3LA 1QQIA 3B02A 2NOGA 1MBKA 2DA7A 1U9OA 3OYJA 1YLFA 1MDMB 2RN7A 2K3FA 1ZK8A 2K9QA 3BG9A 4I99C 2XAGA 1LEBA 3JSOA 1IDYA 1LB2A 3MMYB 2FA5A 2ISYA 3I5UA 4PCQA 2DQRA 1XG1A 3F9KA 3OV8A 3EDPA 2IGNA 1IN8A 3EYYA 2QEXI 5J1RA 1EF4A 4I0BA 4MNUA 3OOPA 5GTHC 5IPAA 2EH3A 1SVLA 5FD5A 2TRTA 1H89C 2D45A 4HG2A 3DV8A 3IP4B 3F8MA 1OR7C 1ZELA 2H9XA 4I01A 2ZJ2A 3DXJF 4JX4A 1I6HJ 1JXSA 5H6RA 2HVRA 1E3OC 1HCRA 3JTHA 2L2OA 3FMSA 1DP7P 5EJCA 4XORA 3KPHA 5DD8A 2UXNA 1LVAA 2Y0SA 1XSXA 2QA4I 1W0TA 4C2TA 1KZHA 2NNNA 3KZYA 3KEYA 3OOUA 2R7FA 1U5TB 4GO1A 1U78A 3BT9A 3CUOA 1S7EA 2K3PA 1G4DA 3FIWA 4OINF 2UV1A 5C44J 1GXPA 1KQ9A 4BH9A 2IA0A 1E2XA 2CFXA 4HF0A 4AD9A 1XD7A 3LAJA 2STWA 2LKSA 2BGCA 4UVCA 1R1VA 3FMQA 4XLEA 3ZMZA 2D5VA 4Z2YA 4XONA 3ABMH 4CCMA 1QZYA 1JJ6C 2V9KA 2K9NA 1BBYA 4BNCA 2QSHX 2F5EA 1PDNC 4OIQF 1T0FA 4V2FA 3G71I 1YW8A 3ZR8X 3CUQA 2ZJPF 3ASNH 3ZQHA 3WTYC 1R7JA 1SD7A 3T8TA 5D8KB 3WTTC 2KFDA 1SFOJ 1JE8A 2ID6A 2X6XA 1D0YA 3HHHA 1ZGAA 4XR6A 1FP1D 1ZTRA 4IHXA 1KYZA 1DQUA 1BI2A 3C2GA 3WTZA 1CGPA 2M0MA 4LB6B 3K70C 2OPTA 3ZPLA 5B5EC 3BQYA 3G1MA 2E60A 4LFUA 4Y4RA 4ZTJA 2DI3A 2LC2A 1D1AA 3SQNA 2HTSA 3VDXA 4XKBA 1DGWY 3E6DA 2FEZA 4Q5SF 4UV8A 1D5VA 4XKWA 1VTNC 2A61A 3HTSB 3DPLC 1QZZA 1PUFA 1ACIA 4RDUA 2NAZA 3BCAA 3LSJA 2HYFA 3ERMA 4CCJA 2KLOA 2KRFA 2OAZA 3WE3A 4A5NA 1YW7A 3JRFA 4IQ4A 1BL0A 4XN0A 1K78B 3WG9A 5L3BA 5LHHA 2L7KA 1P92A 1UELB 3TKYA 4B1RA 5DM6F 2JWTA 2EILH 1FX7A 3A0HC 3R0JA 1YS6A 3ERED 3Q0WA 4B3XA 3HC7A 2W82A 5F1RA 4BEHA 3W2WA 1AWCA 4EGYA 4AYBN 3OYHA 2L9SA 4FCYA 3F8CA 1IV8A 2DOEA 1NH3A 2QLZA 1QPIA 1RETA 2ELHA 4S05A 3LSHA 2VN2A 1YE9A 2DFHA 4HDVA 4LK0F 2F5FA 5FFZA 3PSFA 2KIFA 4L5IA 5GAEJ 2GA2A 2PEXA 3MZYA 1Z6TA 4HNTA 4G9YA 2EJRA 1H88C 2ESNA 3ONQA 5EG0B 1WJAA 3OWTA 2DMTA 4M72A 3SDGA 4H4KC 3S17J 3PFIA 4KYWA 3SFZA 3EUKL 1ZG3A 4PJNA 1TWCJ 4HQMA 1K78A 4ZDOA 1DGRM 2ZXHA 3HOYJ 2CW0F 1K79A 2DK5A 3JAMK 1KU9A 2R7TA 5DTDA 3SHFA 3L00A 1AOYA 4JYKA 5K5OA 1ENHA 5EZHA 4ZDPA 2ZBKA 4C2MJ 3BG5A 4OAZA 1HXDA 1ZHHB 4IX7A 2ICWG 4EJOA 3RI4A 2AS5F 1KU2A 3FX3A 3ZGKA 3PFYA 5DCMB 1L3LA 3RIRA 1SANA 2EZHA 1USSA 1XN7A 4P9UA 2DA5A 4MO7A 5FO5A 5EG0A 3CC4I 3CZ6A 5JR3A 3G73A 2F48A 3PSIA 1QO0D 5TGTA 4P96A 2VPLA 3HDDA 2VQCA 3QAHA 1GXQA 1FT9A 5HLIA 3T0YA 4LG3A 2NVXJ 1PVEA 2RREA 4Q4ZF 4DYCA 2EIJH 2X51A 3JAMZ 3JRDA 4YIRA 5FKKA 1K4TA 1Z0XA 5L3GA 4A3JJ 2K5CA 3MEXA 3TDZC 1UG0A 2HPMA 3BR5A 4X1EA 1SAXA 2ESHA 4DBRA 4EV0A 5K5QA 2VONA 3ML6A 4I7HA 2FQ4A 1QHGA 2VBZA 2RQPA 2LG4A 1K83J 1P6RA 2JA2A 1IRFA 3BJAA 4LMYA 5ILUA 1JUMA 4CCNA 1GLNA 2EIKH 3HYIA 1ORKA 2CUJA 2LF7A 3MCZA 3S3MA 4KFCA 1HKQA 3DTKA 4KITB 3O2PE 5CYVA 2EINH 2Z9OA 1ZKGA 1IN6A 4A6DA 5KK1A 3K70D 3P9KA 2YR2A 4MFDA 3VODA 2V6EA 3WODF 1R23A 2L4AA 1D1CA 3A2KA 1WH7A 2LRDA 3DU6A 2K40A 1MJ9A 3I55I 3FBIB 2KRCA 2JSPA 1OPCA 2H6CA 2Y30A 2LYCA 5ILSA 5EEAA 4UB6C 1W0UA 2HNHA 4XIDA 3E5XA 3QODA 4PSWA 5CKTA 1FBUA 3MFKA 3IKTA 2QBYB 2ZCWA 4HSTA 3GW2A 1NHAA 1OISA 3FXOA 2DPDA 1IN5A 2LY2A 3E6MA 3F6VA 1KONA 3BR2A 3VPRA 1J09A 2M7AA 2X0LA 3ZQQA 4E7SA 5K7HA 1RR8C 4LLGF 5EDNA 1ZUFA 2HTJA 2XASA 5F64A 2VJIA 2F4OB 3I4PA 5HNFA 5HDKA 2LF8A 3DPUA 2Z2SB 3IRRA 1HQCA 2VE9A 3KEOA 3L2WA 2CW8A 3IH4A 1IN4A 1ERDA 2VQHA 4E7KA 2V79A 5JHFA 1HA8A 1V4RA 1NK3P 1QNTA 5FKNA 3U1KA 2LKXA 2W24A 2XGXA 5FKOA 3RPUD 4ZDLA 2QQAA 4A3BJ 2VKEA 2O3FA 4AVZA 3J7AY 3L2RA 1L0OC 2B0LA 3GFJA 4BJ6C 5B3SH 5HLHA 3J7ZI 3QQAA 3E6CC 2VBWA 4KDPA 1MH4A 2BEOA 3EUHA 1P9QC 3VYSB 3IRQA 2OUMA 1B9NA 2VC0A 3TQNA 1O3RA 1YQAA 2F4IA 5E79C 2OCEA 1I5ZA 4YIFA 2VJJA 4IHTA 3QWLA 3KP7A 4DNCA 3OYMA 4DZJA 2BVMA 3DU5A 3E6BA 1MNMC 5F1JA 4L9NA 1GL9B 2M5WA 2TCTA 2JPBA 3BTCA 4FE4A 3FXLA 5JFRA 2L0KA 3IC7A 2LSOA 2XAHA 3CCJI 3FISA 1TLHB 2VJ4A 5IOYA 3M8FA 4XM3A 5JHUA 2R4GA 4E7HA 1ETQA 2QKLB 1ON1A 5AONA 2LBFA 4QIWN 4M3EA 4HAMA 4KA4A 4Y17A 1V55H 5KAFC 2HVQA 4U7BA 2XB5A 2W48A 1JGGA 3BR0A 2OZ6A 2MFZA 2DK8A 2WAEA 3ECOA 2IS6A 2BHYA 3I4MJ 2QGUA 3CDIA 4B8XA 1V54H 2Z1DA 4F55A 1P4AA 3FHZA 4IHYA 2B7EA 1YJ9I 3KZZA 1O7FA 2IGOA 2ZFWA 4KT5C 1Y1VJ 2NVUB 3J80Z 4Y7NJ 2BW3B 3JRCA 1ODDA 3EETA 3LSGA 1TNTA 2L9RA 4C3IJ 3V8KA 4FT8A 1OJLA 3HRSA 1VQ7I 2E2IJ 3CCQI 2ME6A 1R5HA 3DKWA 2ZMEC 4EJTA 1TWGJ 2BYVE 2EV5A 5C4XJ 4ZYEA 3L09A 4UUVA 2K9MA 3ZQIA 2AQFA 2XAFA 1N75A 3LQRA 4HX4A 4IRGA 3S32A 5E18F 2XIGA 1XB4A 4JQFA 2KZVA 1ZR2A 4G7HF 1SEUA 1XDUA 3BG7A 2WY7Q 2ZKZA 4RM3A 3DBLB 4W97A 1J9IA 1T95A 3M8JA 1IV6A 2K9LA 2HXIA 2LVSA 2IJLA 2R7RA 3CCLI 1BI3A 3F22A 2H27A 3Q9VA 2HU9A 2EPFA 3M07A 4GCVA 2DJNA 3E7LA 3D4UB 1V5FA 5LRSA 5HDGA 2I5UA 2VKDA 3AL0C 1XPXA 5IYDJ 1AHLA 3GZ6A 3GYHX 1J75A 4WXHA 1YW9A 3K4BA 1DPRA 1XCVA 3NRVA 1JKOC 3M8EA 5L3FA 5DUKA 1F43A 5D5WB 2XAJA 5LRRA 3WG7H 2BBYA 4CXFA 3H0GJ 1U8BA 4CHUA 1FP2A 2ELJA 1YOVB 4MLOA 2VJ5A 3PNVA 2QUFA 1BN5A 3FM3A 3WHCA 2ZNYA 1F36A 3K69A 3LFKA 4XK4A 4ON0A 1Y8RB 3GEZA 2IA1A 1S7AA 3LMMA 1U6GA 4XMYA 2LKPA 2A6EF 2CUFA 2FD5A 1IF1A 3CCYA 2L9NA 2VKHA 5K7ZA 3OYDA 3TOBA 3FBNB 2HDCA 4IHWA 4EM2A 4D7MA 5JVTA 2XROA 4RLQA 3V8LA 1TNSA 1MSFC 1GDTA 1IXRC 3ELKA 4AVPA 2LD5A 5DEQA 3BDDA 3K2ZA 1A31A 3G4SI 2QCOA 2QSHA 2WB1A 4LGWA 3QP6A 1H0MA 3OL3A 3CC2I 4HZFA 1B59A 3ZQLA 4R79A 3N4MA 1BOAA 4D9JA 4P5OA 5ICCA 3CP8A 3GWZA 2V6CA 2EK5A 5D4SA 3HOVJ 3A01B 2K2XA 3E1SA 4JBAA 1WI9A 2D1VA 1FMWA 4ENMA 3C3WA 3KIOA 1EA3A 4ZYDA 1BJAA 1W5TA 1ZAOA 4NDLA 2OD5A 3BTLA 3CDHA 3N05A 2V1DA 3MWMA 3OR1C 2PMUA 1BI1A 1OMIA 3GF2A 3PIOF 2JA8J 1IRGA 4DQ2A 3EPZA 4UB8C 3GX4X 3S16J 3BPXA 3L2CA 3CP2A 1TP4A 2IGMA 2HKXA 3FXKA 3AFHA 1QA6A 2RC4A 3HPHA 1HSTA 2A68F 4YRVA 3TO7A 1R36A 1ETXA 2YUSA 2FUG2 4UUTA 2M87A 4BE0A 4E7ZA 3R0AA 3GFIA 1VQ5I 1N25A 2E19A 4II2A 1K4SA 2EBIA 3ZN1A 2RKHA 3AAFA 4BAYA 3HOSA 3H5RA 3HPGA 2JRMA 2P7VB 4MQ9F 1XGOA
chains in the Genus database with same CATH topology
4XLEA 3BG6A 3QYFA 3RCOA 4CCMA 4XONA 1ATXA 3H5AA 2V9KA 3AL0B 2DT7B 3V42A 1X19A 3HXLA 1X1DA 3NWTA 4F91B 2MD0A 1NG6A 2W4SA 3S8PA 2WY8Q 1MMDA 2VASA 1V5GA 3ZR8X 3PUBA 2HPIA 2UUZA 2MUBA 3GBGA 1V5EA 1G59A 1Z3XA 2XDVA 2X1CA 2BVLA 3W2VA 4F52A 4DIQA 4OAYA 2DCEA 4Y33A 3AKZA 2A5WA 3QYEA 2PJRA 2KHMA 2KMUA 3OS1A 1X4OA 2X6XA 3KX2A 1D0YA 3SYTA 1BDSA 4QPOA 5HVQC 4XR6A 3OYIA 2IS4A 1D1BA 1DQUA 2A6TA 3C2GA 4XOPA 4KISA 2M0MA 1D0ZA 1WJDA 4ZC3A 1SHIA 3BC8A 3K70C 2SH1A 2MYSA 2XF5A 3RQ4A 2M3AA 2E60A 1FMVA 4Y4RA 4J00A 4ZTJA 3TMOA 2E1MC 2E5ZA 2LC2A 1D1AA 3K4KA 3RSNA 4II3A 4XKBA 1DGWY 3VDXA 4PJMA 4BJTA 4DGWB 4XKWA 3CMMA 1PYVA 3D5LA 2P0WA 4HSRA 3DPLC 4N4NB 1BOBA 4YEJA 5KHDA 3BCAA 3OIQA 4CCJA 2KLOA 2MC4A 3CESA 2VB6A 4IQ4A 4EATA 4F3QA 4XN0A 3ZRGA 4F93B 3M1CA 2CV2A 2V7FA 3DWLE 1VZ0A 3LFUA 2L7KA 5LFAA 1UELB 4CUGA 3ZCOA 3OYCA 2VQLA 3NWSA 2R7XA 3OR2C 3DEEA 2R7VA 4B3XA 3HC7A 2W82A 4BEHA 1X4PA 3W2WA 4PSXA 3OYGA 4E6KG 4IKFA 4BE1A 4BS9A 3OYHA 2L9SA 1B8WA 4Y3OA 3ZXSA 2F5VA 3LSHA 1BR4A 3H9JA 4E7JA 1WFXA 2DT6A 1YE9A 2B9KA 2HJEA 1YX5A 3PSFA 2JVHA 4CCOA 3S93A 3OY9A 4NNJA 4CCKA 4DOZA 2KDOA 3BCBA 3EUHC 4HNTA 1MMNA 3ONQA 3UNGC 1WJAA 2M4KA 3OWTA 3VWBA 4H4KC 2E5NA 3I9V2 2HQAA 3EUKL 4JOMA 4CSWA 4PJNA 2I8DA 3K6GA 1WJEA 4ZDOA 3HKZA 3MYVA 1DGRM 2ZXHA 3RTRA 2QSGA 3LSKA 4BE2A 2R7TA 2PMZA 2F6CA 4ZDPA 3E0JB 2Q2EB 5HLTA 3LL7A 4OAZA 1ZHHB 4IX7A 3HUGB 2WBMA 2X6YA 2NOJB 3ZGKA 2V26A 4DJAA 2O5RA 2HDWA 3PFYA 3L2VA 5FRNA 4ITVA 2RNGA 3MKWB 4HRIA 2RQQA 3DLAA 2QKMB 4C30A 3CZ6A 3G2BA 2WADA 3PSIA 5TGTA 5HNHA 3OL4A 2VPLA 3C38A 2V4JC 2VQCA 3H0DA 1QU3A 1Z21A 4LG3A 4XLFA 2RREA 2DOAA 2X51A 4YIRA 2CV1A 1D0XA 1X1CA 2K5CA 3L2QA 1UG0A 2HPMA 4PJLA 4DBRA 3H5NA 3K4NA 4YELA 1S9HA 1QHGA 1UAAA 2LG4A 2JA2A 2WA0A 4E7IA 2VXDA 4CCNA 1GLNA 1OLTA 1ZUEA 4B44A 3OYBA 3K4CA 5KCMA 2IKDA 2CUJA 3A4CA 2JVGA 4HPQA 4BEHB 3S3MA 3DTKA 4KITB 3MKYB 2BDSA 3K70D 2V6EA 2LH9A 1YX3A 1LKXA 2HJ9C 1D1CA 3A2KA 2LRDA 3DU6A 3K10A 1JI8A 1U0JA 4XLAA 4BQQA 3FBIB 2KRCA 2JSPA 2LYCA 3KEZA 2HNHA 1Y6IA 2VIXA 1D6BA 3QODA 4PSWA 2ZFUA 5CKTA 4HNUA 4PFOA 1K6YA 2CUZA 4HSTA 1N78A 4GRIA 1LFPA 1MNEA 3MD2A 3VYTB 2LY2A 2W00A 4QPQA 3H9GA 2BW3A 2IGKA 1WQKA 1KONA 3OYFA 1J09A 2M7AA 3SEZA 4BDZA 3ZQQA 4E7SA 3K4LA 1WJCA 4CH7A 1ZUFA 5CQGA 2VJIA 1MW7A 2X1EA 5HNFA 3DPUA 4G6TB 2Z2SB 1MMGA 4D1QA 2KQRA 2OC6A 2CW8A 3L2WA 1E0EA 4LIVA 2OV7A 1ERDA 2VQHA 1IRXA 4E7KA 1Z7LA 4CCLA 3K4MA 3IAM2 5JHFA 3HL2A 1HA8A 3VSKA 4NUBA 4XLCA 3RPUD 4ZDLA 4ZTFA 1BR2A 4IQJA 2XC7A 4AVZA 3J7AY 3L2RA 4BJ6C 1QHHD 4XN3A 4XNFA 2KRHA 4E4HA 2BOLA 1P9QC 3VYSB 4N4OB 2OUMA 2XF7A 2IXSA 5LD2C 2VLAA 2F4IA 1W36C 2VJJA 3QOEA 2MABA 4KT6A 3OYEA 3EUAA 4B48A 3OYMA 2JTOA 1Z99A 2BVMA 3DU5A 4PUSA 1NG7A 3HOTA 4J01A 4BGDA 4KJZA 3SEQA 1Z3YA 1H5OA 3K4JA 4NQWB 4FETA 4XOTA 4RM2A 2VJ4A 5FROA 4XM3A 2R4GA 2W1OA 4E7HA 4IZZA 2QKLB 2LBFA 2IS2A 3PNTA 2Z16A 4BXFA 3IUOA 4RMNA 2HVQA 4CZCA 1MNDA 4U7BA 2HZDA 3PL8A 2MFZA 1SH1A 3OYAA 2WAEA 1G8XA 4NC8A 2IS6A 1WXNA 3DTEA 4GV5A 1MMAA 3LSIA 2Z1DA 2E1MB 3VYUB 4F55A 2W7NA 1ZLHB 3D5RC 3CF2A 2CH0A 2IGOA 3BLYA 4XLHA 1LDKB 3SZGA 5HOOA 3FDYA 3U21A 3OYKA 2BW3B 5FRMA 2KPMA 3LSGA 3L2UA 2GOXB 1T0FC 3QYBA 3HG9A 2M4GA 2R7UA 2R7OA 5KNLA 2XSJC 2X6WA 3OS2A 2DLAA 3OYNA 2K9MA 2VQGA 3W2AA 2AQFA 1BR1A 1N75A 3S32A 3VYRB 4CA0A 1WJBA 3IAS2 4JQFA 3TBIA 4ZJZA 2KZVA 4HEA2 2IKEA 2XXLA 1R6RA 2XF6A 3H9QA 3H35A 4XKVA 4P1WA 3OMYA 2IS1A 2GOMA 1APFA 1DP3A 3MCXA 2LREA 3BG7A 2WY7Q 4RM3A 1N77A 2CV0A 1T95A 3M8JA 2K9LA 2R7SA 2R7RA 2VL8A 3C2HA 1WJ5A 2AQEA 2DJIA 2HU9A 3DPTA 3VSLA 4B43A 1TT0A 2XAUA 3D4UB 1V5FA 3S3OA 2VKDA 3OS0A 3AL0C 1SAUA 4XQFA 4DBQA 1PJRA 1AHLA 4BQOA 1ZLIB 3FHNA 4PK4A 3PJRA 3UR3C 2WAQA 3DTIA 3K4BA 4XKCA 4BU2A 2DXIA 2X1DA 2R7WA 4E7LA 2L5QA 2ZSIB 3S3NA 4XL9A 4FASD 3CJRB 4AU7A 2ELJA 4BUPA 4MLOA 4RLFA 2VJ5A 3PNVA 2ZSHB 4AYBA 3MKZA 3FKJA 3A1YA 2KL4A 3W3CA 3LMMA 2LBFB 3C30A 4XMYA 2MN3A 3DKXA 3PNYA 2VXZA 4BL0B 2L9NA 3I3LA 2CFOA 2VKHA 3OYDA 3FBNB 4F92B 3OYJA 4RLQA 1X1BA 2V1NA 3MMYB 4BDYA 4BACA 2QSHA 2WB1A 1W36D 3CJQB 3F9KA 2IGNA 3OL3A 4BJ5C 4R79A 4PJJA 2CS3A 2JR3A 3SDBA 2R7QA 4C2UA 4HG2A 4D9JA 4P5OA 2M7BA 3IP4B 2LOOA 1SFKA 3CP8A 5CQEA 3OYLA 1OR7C 4LITA 1ZELA 2K2XA 2H9XA 3D5SC 3E1SA 4NC7A 2HVRA 1TZLA 1FMWA 2L2OA 1EA3A 4XORA 2UWMA 1LVKA 4ANJA 2Y0SA 3N05A 3KYLA 3OR1C 4C2TA 4X0GA 1X1AA 1Y56A 3EPZA 3KEYA 3OOUA 2LY1A 3CP2A 1AA7A 2IGMA 2PJRB 3AFHA 2CW7A 3DKYA 3HPHA 1WJFA 3OIPA 4YRVA 2K3PA 2HVSA 2UV1A 2FUG2 2KP6A 2WAFA 3LSMA 5CPRB 4BE0A 4E7ZA 2X85A 3DQVC 4ZYAA 3LMSB 2JUGA 4II2A 2ZXIA 4OWRB 3TL4X 4PFPA 4BQNA 3HOSA 2QSFA 2Q1ZB 3H5RA 3HPGA 4LIUA 2CMPA 4B47A 4C9YA 4U87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZUE A;  1SH1 A;  2JTO A;  1ATX A;  1Z99 A;  3D4U B;  1WXN A;  4GV5 A;  1SHI A;  1WQK A;  2SH1 A;  2BDS A;  2MN3 A;  1H5O A;  1AHL A;  1ZLI B;  1ZUF A;  1ZLH B;  3LMS B;  2MUB A;  2K2X A;  2H9X A;  1APF A;  2RNG A;  1B8W A;  1D6B A;  1BDS A; 
#chains in the Genus database with same CATH topology
 1LPQ A;  4GFB A;  3W6V A;  3AG2 H;  2ACJ A;  4KN7 X;  1X1P A;  5GPA A;  1FOY A;  3I71 A;  3HXL A;  3HEF A;  1X1D A;  5HLG A;  2PX9 A;  2W4S A;  1MMD A;  4UXN A;  2VAS A;  2MD5 A;  4HNV A;  5IP9 J;  3PUB A;  2UUZ A;  2DLL A;  3GCM A;  3F0C A;  4HLX A;  3GBG A;  4EMS A;  2Q2E A;  1LDD A;  1XGS A;  2BVL A;  2X1C A;  3W2V A;  4DIQ A;  2H8W A;  2DCE A;  4Y33 A;  1WCM J;  2A5W A;  2K9S A;  3AKZ A;  4RS8 A;  2KHM A;  2JZY A;  3QPT A;  2W25 A;  1W7P D;  1WHU A;  4Z6Y A;  4ESF A;  2JQ7 A;  4A12 A;  3HRT A;  1MH3 A;  3ZN0 A;  2W84 A;  2A6T A;  1WH5 A;  4L5E A;  4KIS A;  1WJD A;  2K4J A;  4ZC3 A;  1MIJ A;  4I76 A;  4BXU A;  1NK2 P;  1T08 B;  2XF5 A;  2CUE A;  4M6X A;  1RUN A;  2L01 A;  1P4X A;  2E1M C;  1TQP A;  1ZG1 A;  4II3 A;  4BJT A;  2AHQ A;  4M9Z A;  4ABZ A;  4M74 A;  4HF1 A;  3S1N J;  1PYV A;  4RGU A;  3JRE A;  3OIQ A;  1IG7 A;  5FFX A;  2OQG A;  2AXL A;  2MC4 A;  4EGZ A;  1O3T A;  5GAH J;  2CV2 A;  3M1C A;  5LEJ A;  1WPK A;  2HYJ A;  2GWR A;  3FK6 A;  2VQL A;  4R1H A;  1ZLK A;  1B1B A;  2VI6 A;  2WV0 A;  3WU0 A;  3GFM A;  3TO9 A;  3K0L A;  3ZMV A;  2W57 A;  3Q0U A;  1XMK A;  4PSX A;  4IKF A;  4E6K G;  3P5J A;  4BE1 A;  2CU7 A;  4P55 A;  3KLN A;  3QU6 A;  5M3M J;  1TW3 A;  3ZXS A;  1BR4 A;  1M1E B;  4E7J A;  5TJJ A;  2KDZ A;  1FYK A;  4PDK A;  2N8G A;  1IAW A;  4X6A J;  1ON2 A;  2JVH A;  1BJZ A;  4CCO A;  5DM7 F;  3OY9 A;  4D7N A;  4DOZ A;  1R4M B;  2O7O A;  2VOD A;  3G1O A;  5M5W J;  2QQB A;  1J5Y A;  2DFF A;  5DS9 A;  2O9L A;  2KIM A;  1DU6 A;  2DAO A;  2E5N A;  1W5C C;  3KE2 A;  4CGZ A;  4JOM A;  1XTA A;  3RKW A;  2EQR A;  2HOE A;  3M1E A;  1O7L A;  2LTP A;  1WJE A;  5HDN A;  1SVO A;  5CVR A;  2COB A;  2FU4 A;  4GXO A;  5AIP A;  2ZJR F;  1T39 A;  3H3V K;  2MG4 A;  1OR7 A;  1AHD P;  1NTC A;  2JT1 A;  3CUQ B;  4EM0 B;  2UXX A;  3E0J B;  1I3Q J;  5HLT A;  1U3E M;  1RKT A;  1VQN I;  3CJN A;  2P6T A;  2NVY J;  4ESJ A;  3J7A O;  1IUY A;  3BJ6 A;  4DJA A;  2V26 A;  2QZ8 A;  2M1B A;  2O5R A;  2Z5U A;  1ETV A;  3GTK J;  5H6Q A;  5E3O A;  1JTX A;  3KYD B;  2HOA A;  1SMT A;  2RNG A;  3MKW B;  4BBS J;  1LNW A;  4HRI A;  3AG4 H;  2QKM B;  3RKY A;  1VND A;  3RKX A;  4G12 A;  5J1U A;  1VQ9 I;  5D6E A;  3OL4 A;  1UHS A;  2V4J C;  2XVC A;  3OSF A;  2A69 F;  2Y9Z A;  3Q5F A;  1R00 A;  1I6X A;  3F8F A;  3MQ0 A;  4IVN A;  2DT5 A;  3H3Z A;  4O6J A;  4IJA A;  4IXA A;  3PO2 J;  1RNL A;  2OTL I;  1B4A A;  2CV1 A;  2XGC A;  3I64 A;  1PUF B;  5J4Y A;  1VQP I;  5EF6 A;  3BPV A;  1YI2 I;  3F3X A;  4YEL A;  1S9H A;  4E7I A;  2VXD A;  3G3Z A;  3QU3 A;  2ZO4 A;  4NQW A;  3BR6 A;  1ZUE A;  4B44 A;  1MBE A;  3K4C A;  4FQG A;  2IKD A;  4BEH B;  2PQ8 A;  3MKY B;  1U5T C;  4XSX F;  2HQN A;  1ZRE A;  1J7K A;  2BDS A;  2JSC A;  2O03 A;  2PI0 A;  5DD4 A;  4ENK A;  4KNY A;  1JI8 A;  4A3M J;  4XLA A;  1R4N B;  3CCU I;  4WCG A;  1EH8 A;  2HYG D;  1IXS B;  1YTY A;  2JA5 J;  1Y6I A;  4DYR A;  3C18 A;  2VIX A;  1HC8 A;  2ZFU A;  3IH2 A;  1EH7 A;  1P4W A;  3FXJ A;  1K6Y A;  2CUZ A;  2RVC A;  2CQN A;  3I53 A;  1MNE A;  4C3J J;  3C2B A;  3HGG A;  2IGK A;  3D0S A;  3LSR A;  2WAQ N;  3KP3 A;  1E3H A;  5IT3 A;  1JJ8 C;  3QOP A;  1PUE E;  1WJC A;  3CO6 C;  2A5Y B;  2X1E A;  2DA4 A;  2FBH A;  3JRH A;  4LLN A;  1U9N A;  4XLN F;  3GVA A;  1ZRF A;  4G6T B;  4OU0 A;  3LA2 A;  3CCS I;  4D1Q A;  3KP2 A;  5FLX Z;  3L9F A;  3X2Q H;  2ECB A;  2K27 A;  4KIB A;  1E0E A;  4LIV A;  2DMP A;  2OV7 A;  2MLG A;  1IRX A;  3QPS A;  1Z7L A;  2JTV A;  5DCF A;  3LST A;  3PUF A;  2CO5 A;  2RDP A;  3VSK A;  3F23 A;  2IEK A;  2K4B A;  4IHS A;  4G94 A;  4ZTF A;  2L7M P;  4EJV A;  2PMH A;  1G3S A;  3U9G A;  4XN3 A;  4J19 A;  2OTJ I;  2QQ9 A;  3K1M A;  1H8A C;  2XRN A;  3IL2 A;  3RPU A;  1JT0 A;  4G8X A;  2BOL A;  2ZJQ F;  2GZW A;  4M9S A;  3SXY A;  4N4O B;  4AIJ A;  1OCT C;  3EQL F;  1YJW I;  5LD2 C;  1W36 C;  3WTS C;  3MKL A;  4JK1 X;  4LK1 F;  4KT6 A;  2YU3 A;  3IV5 A;  4XRF A;  3OYE A;  1SD6 A;  2JTO A;  3LSP A;  2HOT A;  3WTV C;  2KKO A;  3HOT A;  1NG7 A;  1A36 A;  5ICG A;  5L3E A;  3BP8 A;  3R6S A;  1T38 A;  1YHQ I;  2HQR A;  2WWY A;  1WKM A;  1Z3Y A;  2NYX A;  1YG2 A;  2A07 F;  2X48 A;  2TDX A;  1UJ8 A;  4HX8 A;  2VT2 A;  3ESW B;  3H92 A;  3IWF A;  4FET A;  2ZXJ A;  5FRO A;  5E3N A;  3LWF A;  4L5J A;  2BZT A;  4BBR J;  2GM4 A;  3PNT A;  2Z16 A;  1B6A A;  4MGR A;  5GP9 A;  4ESB A;  3IUO A;  1ZN2 A;  1FTZ A;  4RMN A;  4U88 A;  2HZD A;  1BA5 A;  1SH1 A;  3K7A J;  4GDF A;  3ZMD A;  4U7D A;  3I59 B;  3QP5 A;  1YO5 C;  1YIJ I;  1WSU A;  2E1C A;  3KCC A;  2JUC A;  1ULY A;  4N9H A;  3S2H J;  2EB7 A;  1P7I A;  2FNP A;  5IP7 J;  4JX6 A;  2XPU A;  3B6C A;  1X2M A;  3CF2 A;  3LA3 A;  4GGG A;  4XLH A;  2YX4 A;  3WTU C;  1Z9C A;  3FXR A;  4M6Y A;  1HW2 A;  2HEO A;  2KPM A;  2Y2Z A;  4G6D A;  3KFW X;  1IW7 F;  2M45 A;  1WWX A;  3GTM J;  3F72 A;  4U0W A;  2R7O A;  3WTW C;  3WGH A;  4P9F A;  3S1R J;  2E1O A;  2HXO A;  2V1X A;  1TT5 B;  2HI3 A;  3E5Q A;  3E97 A;  4HBL A;  3OYN A;  3N97 A;  2NVT J;  1DPU A;  3W2A A;  3MZ8 A;  1Q1H A;  3VYR B;  1GVJ A;  4UY8 I;  4L0Z B;  4JP0 A;  1F9N A;  3I4N J;  2XXL A;  2KIU A;  5BMZ A;  4PZJ A;  4UVB A;  4P1W A;  2IS1 A;  3LQQ A;  2WV1 A;  2P6S A;  4BYY A;  1APF A;  1DP3 A;  3I59 A;  1ZRD A;  1N77 A;  4UNO A;  1JGS A;  4TV7 A;  2FBK A;  3ULQ B;  1HLV A;  2VOP A;  5E17 F;  2F4M B;  4BHB A;  3HJE A;  1TT0 A;  2EZK A;  1T56 A;  1SAU A;  2DDA A;  4CYC A;  2NNY A;  3KP5 A;  3HSR A;  2K7L A;  3DF8 A;  4PK4 A;  3W6J B;  3TP0 A;  4FIS A;  9ANT A;  2L54 A;  4CIC A;  5BOX A;  1HDD C;  3DBR B;  4A3G J;  2DOD A;  1MZB A;  2M9H A;  2CJJ A;  3FK7 A;  2LFB A;  3REO A;  3FWE A;  2HQ5 A;  2OF7 A;  3CME I;  1JKR C;  3DEU A;  2A05 A;  1ZG5 A;  2BY0 A;  2XKO A;  1TWH J;  3MKZ A;  1TWA J;  4GYI A;  4LB5 A;  3A1Y A;  4A3C J;  2DA3 A;  1RI7 A;  2M30 A;  4EEF G;  2P7C B;  3ABL H;  5H20 A;  4M3B A;  2JJ7 A;  2LBF B;  1OFC X;  4UV9 A;  1R71 A;  3F8N A;  2CFO A;  3E3V A;  4NB5 A;  4IOC F;  3Q0V A;  2RV8 A;  4M71 A;  3R61 A;  1BI0 A;  2K02 A;  5IOZ A;  2DN0 A;  2FOK A;  3CCV I;  1X1B A;  3JRI A;  1FBQ A;  2V1N A;  4FTH A;  3M3Y J;  3BRO A;  5J1Y A;  4BAC A;  1W36 D;  2JA6 J;  3CJQ B;  2FMY A;  4QLC U;  1BW5 A;  4KMU X;  4G6Q A;  4A6E A;  2YS9 A;  5GAD J;  4PJJ A;  3ZQF A;  2JR3 A;  3SDB A;  2R7Q A;  4C2U A;  5J6X A;  3J80 K;  3RZO J;  1HW5 A;  1LJ9 A;  2Y31 A;  1IDZ A;  2M7B A;  3K9T A;  2LOO A;  1YRN A;  3HKZ N;  2M2E A;  1OKR A;  4ASN A;  3OYL A;  1Y1W J;  4KUM A;  2EA4 A;  4LIT A;  3LOC A;  4I02 A;  3TW6 A;  3D5S C;  5BQT A;  1KYW A;  2Y69 H;  4L18 B;  4NC7 A;  1PP8 F;  1KU7 A;  3HSE A;  3CJT B;  3BQZ A;  1TQI A;  2D1H A;  3BY6 A;  2MW8 A;  2DYS H;  4A3D J;  4ANJ A;  2UWM A;  5FKL A;  3O6B B;  5E1Z B;  4HYE A;  3S14 J;  2ZME B;  1AU7 A;  5J4V A;  5FLV A;  3KYL A;  4X0G A;  1VQO I;  1X1A A;  1Y56 A;  4L9T A;  1AA7 A;  1SD4 A;  1RUO A;  1O4X A;  2PJR B;  1D8J A;  2HVS A;  1HSJ A;  4ENN A;  2KP6 A;  3LSM A;  5CPR B;  1G2H A;  1SFX A;  4GYG A;  3LMS B;  3S2D J;  2JUG A;  1YYV A;  3H3U A;  2DA6 A;  2WC2 A;  2ZXI A;  3GZ5 A;  1EH6 A;  4OWR B;  2F5D A;  3TL4 X;  4PFP A;  4BQN A;  1D3Y A;  5ED4 A;  1FOW A;  1JKP C;  2EFO A;  1MJB A;  4B47 A;  4C9Y A;  1TWF J;  1IGN A;  1I1S A;  2DW4 A;  3BG6 A;  4N9I A;  2GXG A;  5KVR A;  3H5A A;  3AL0 B;  4OMY A;  1FPQ A;  5J40 A;  1NG6 A;  2MH2 A;  2WY8 Q;  4ZZL A;  1V5G A;  3KEQ A;  2ZME A;  2P5V A;  2HPI A;  2R5Y B;  1Z1D A;  1Y0U A;  2CQX A;  2J5O A;  1G59 A;  2PLY A;  1Z3X A;  2XDV A;  4F52 A;  3JSP A;  1MBJ A;  4OAY A;  3HUG A;  2PJR A;  2HWV A;  2CQQ A;  2VOO A;  4O5V A;  2EV0 A;  1I1G A;  3CMY A;  3MN2 A;  4MHG A;  5D5U B;  3KX2 A;  2PG4 A;  4DW6 A;  1EL6 A;  4QPO A;  3ZMS A;  5L3D A;  3F6O A;  5LBQ A;  3OYI A;  2IS4 A;  2DA1 A;  5ICF A;  1D1B A;  2O8K A;  1W7P A;  3Q9S A;  3H1C A;  4XOP A;  1YJN I;  2VBX A;  2YSR A;  2COM A;  5LHI A;  4S04 A;  5HS7 A;  4YFK F;  3IKV A;  1KA8 A;  2M3A A;  4A3K J;  1FMV A;  2DMQ A;  3IH3 A;  1RPW A;  3TMO A;  4MQV A;  5A2Q Z;  2E5Z A;  3CC7 I;  4PJM A;  1VF9 A;  1JHF A;  3HOZ J;  2BXZ A;  2FF4 A;  3QRF F;  3KLO A;  1A6Q A;  2P0W A;  2DO7 A;  4IF4 A;  1ETO A;  4N4N B;  4YEJ A;  4XBF A;  5C3E J;  2R5Y A;  2QSF X;  3GTL J;  3CES A;  1MJA A;  4F3Q A;  4F93 B;  1ZQ3 P;  3LFU A;  1VZ0 A;  3F8B A;  4UUS B;  1EKE A;  5F0H A;  3ZCO A;  5E20 A;  2R7X A;  3H36 A;  1QGP A;  2HS5 A;  2LK2 A;  3DEE A;  3BZC A;  2R7V A;  2IPQ X;  3U1D A;  3W6K B;  3J81 K;  1X4P A;  2EV6 A;  3OSG A;  2ZXW H;  2VUM J;  3HIF A;  1Y39 A;  1Q1V A;  2GXB A;  4BS9 A;  2OQR A;  4Y3O A;  3WTX C;  2QWW A;  4M73 A;  4ZZD A;  2F5V A;  2HGC A;  5EZG A;  1WFX A;  2DT6 A;  2FOW A;  3PQJ A;  2B9K A;  2DMU A;  2GXA A;  4MIM A;  5C4J J;  3S93 A;  5LGU A;  2M34 A;  2XHK A;  3BCB A;  4RA2 A;  1HOM A;  5BPI A;  1MMN A;  3S2W A;  3PQK A;  1UHM A;  2XB0 X;  1P2F A;  1JUP A;  3GFL A;  1C0W A;  2JMW A;  1K7A A;  2WB1 N;  1QBJ A;  2GBY A;  1JUS A;  3K6G A;  1MD0 A;  5GAG J;  3T1B A;  3JR9 A;  4UUS A;  2CQK A;  2XAQ A;  1IC8 A;  1S7O A;  1A35 A;  4U0Y A;  5LHG A;  1BM9 A;  3LSK A;  2OCC H;  3NQO A;  1V3F A;  3FXM A;  2G7H A;  3HGY A;  3ZMT A;  1WZ2 A;  2PMZ A;  5L3C A;  1O3Q A;  2F6C A;  1FYM A;  3J81 Z;  3OIO A;  1OCP A;  3GO5 A;  3WU1 B;  2G9W A;  4OIO F;  2Q2E B;  3CCR I;  2DYR H;  3LL7 A;  3SZT A;  4A3F J;  2R3S A;  2FX0 A;  3FKI J;  3JRA A;  1VQ4 I;  2OA4 A;  3HOW J;  1GKU B;  1ZR4 A;  1XMA A;  2JA7 J;  1SVM A;  3L2V A;  5DV5 A;  1APL C;  4BKX A;  4DZP A;  3BOQ A;  5EGO B;  1LUJ B;  1YFH A;  3S1Q J;  2BE5 F;  3K2A A;  2CSO A;  1BC7 C;  2RQQ A;  1XDS A;  3DLA A;  4C30 A;  1R5G A;  4EQQ A;  3G2B A;  2WAD A;  4YFX F;  2F2E A;  1SFU A;  2AO9 A;  3VB2 A;  1FTT A;  1RC9 A;  3GTP J;  2O6G E;  3ABU A;  1QU3 A;  2I10 A;  1J0R A;  1XSD A;  3KYC B;  2DOA A;  4Y52 J;  2EFQ A;  1TC3 C;  4XRM A;  1LE8 A;  1F4K A;  3IF4 A;  1X1C A;  3HOX J;  2ID3 A;  3RYP A;  1LQ1 A;  3GLL A;  4PJL A;  3H5N A;  4EJW A;  6PAX A;  2X9D A;  3K4N A;  3AG3 H;  1JT6 A;  2L7Z A;  1UAA A;  1FWZ A;  5IYC J;  5ERI A;  3KZI C;  3C7J A;  5IP6 A;  1GHC A;  2WTE A;  4UHT A;  3OYB A;  4IEJ A;  5EGO A;  2QQ8 A;  4QSH A;  5KCM A;  4V19 K;  2QSG X;  3A4C A;  2JVG A;  4LLL A;  3ASO H;  2R7Z J;  1Z67 A;  5B1B H;  5LEK A;  4FX4 A;  2IRF G;  4ZYG A;  1YX3 A;  4DYQ A;  4WX9 A;  2G7U A;  2HJ9 C;  3K10 A;  1U0J A;  2FQ3 A;  2FBI A;  5J3L A;  4WWC A;  3KEZ A;  2QVO A;  4V2G A;  1R49 A;  4WF2 A;  3GXO A;  2IVM A;  4PFO A;  3BR3 A;  1N78 A;  1JKQ C;  1LDJ A;  1LFP A;  3MD2 A;  3TDU C;  3VYT B;  5BPD A;  4XIC A;  1KQ8 A;  4QPQ A;  2FNA A;  1ZLJ A;  1WQK A;  1XGM A;  3OYF A;  1KQ0 A;  3V7S A;  4BDZ A;  2P5L C;  2ISZ A;  2PFB A;  1FC3 A;  4AC0 A;  3ISP A;  1MW7 A;  3GUD A;  4XLP F;  5EEG A;  5EEH A;  4NC6 A;  2GLO A;  2DBB A;  1T33 A;  1MMG A;  3DBH B;  3J7Y J;  5M3F J;  1SFE A;  1FOX A;  2KQR A;  2OC6 A;  3EYI A;  4BXX J;  4CCL A;  1FLI A;  1T98 A;  1K6O A;  3K4M A;  2XPW A;  1T6S A;  3HL2 A;  2HKO A;  3RZD J;  3BWG A;  5CVI A;  5F08 A;  4NUB A;  1CF7 B;  4XLC A;  4M3F A;  1FZP B;  4FHT A;  5J8C A;  1BR2 A;  3MAJ A;  4IQJ A;  2H94 A;  1QHH D;  2KRH A;  2JK3 A;  1EV7 A;  4RAY A;  4M6V A;  4RB2 C;  3BZ6 A;  1DDN A;  1E17 A;  2VLA A;  4A5M A;  4XRS G;  3KP6 A;  2O61 A;  3QOE A;  3ZQC A;  2JRT A;  3EUA A;  4B48 A;  3VOE A;  1Z99 A;  2L02 A;  3LAP A;  1AKH B;  4J01 A;  1KGS A;  3JCU C;  2MBF A;  4BGD A;  4KJZ A;  2R7D A;  3SEQ A;  4BHP A;  3UKG A;  1H5O A;  3K4J A;  1S6L A;  2V9V A;  2GIV A;  4NQW B;  1B72 B;  2C6Y A;  1DU0 A;  4KMF A;  1IN7 A;  1ETW A;  2W1O A;  4WXC A;  2Y0S N;  4N0B A;  2GAU A;  4RAZ A;  4HQE A;  1CF7 A;  2IS2 A;  2XV4 S;  4HOB A;  5FLM J;  2MA3 A;  4CZC A;  1MND A;  2A3S A;  2M0C A;  3PL8 A;  4OOI A;  5D8L B;  1MDM A;  1HF0 A;  1SC7 A;  1VI0 A;  4LG0 B;  1G8X A;  4NC8 A;  3G6E I;  3DTE A;  4ETS A;  2FML A;  1GV2 A;  1Z7U A;  1FJL A;  1YIT I;  2KZG A;  5B66 C;  1TW2 A;  1ZLH B;  1HW1 A;  2H09 A;  2CH0 A;  3A0B C;  1AKH A;  3BLY A;  3SZG A;  4EJU A;  5DDG A;  3FDY A;  3CDL A;  4NBQ A;  3U21 A;  5FRM A;  2AXT C;  1SD5 A;  1U8R A;  5J47 A;  3L2U A;  2EWN A;  1T0F C;  2Z3Y A;  1B72 A;  4KIC A;  1R9T J;  2Y75 A;  2M4G A;  2R7U A;  3CUQ C;  5KNL A;  2X6W A;  1OCR H;  3OS2 A;  3L7W A;  5GPC A;  4Y15 A;  2NXN B;  3BJO A;  4D5C A;  2VQG A;  4CA0 A;  5FLX K;  3DCF A;  1WJB A;  4ZJZ A;  1QZE A;  4HEA 2;  5J8F A;  2IKE A;  1R6R A;  3H35 A;  4Q48 A;  1G3Y A;  1RKW A;  1U5T A;  2GOM A;  4LG0 A;  4HV5 A;  1FNN A;  2IT0 A;  2MSY A;  1XMX A;  1A6I A;  5F0C A;  3CTA A;  2R7S A;  5FB2 A;  2VL8 A;  4A3I J;  3C2H A;  3ZP5 A;  1OCZ H;  2AQE A;  2DJI A;  2P81 A;  5EYR A;  3VSL A;  4BY7 J;  4A0Y A;  1U2W A;  2XAU A;  3S3O A;  3OS0 A;  3RKQ A;  1FEX A;  3B6A A;  2FJ1 A;  4BQO A;  1LFU P;  1BIA A;  2Z33 A;  2P4W A;  1WRJ A;  2RNJ A;  2WAQ A;  3DTI A;  3V4G A;  4BU2 A;  2QEN A;  5BS6 A;  2DOF A;  2X1D A;  2R7W A;  4E7L A;  2L5Q A;  5LGN A;  4XL9 A;  5HS9 A;  1QRY A;  4RB0 A;  4YII A;  1P7J A;  1HKS A;  2MGQ A;  3ZQ7 A;  4RLF A;  4L9J A;  3P9C A;  1X58 A;  2ZSH B;  1R5I D;  4AYB A;  1Z6R A;  3FKJ A;  2KL4 A;  3D1N I;  4L0Y B;  3LA7 A;  3R60 A;  4PJ0 C;  2KJB A;  3GZN B;  2ADU A;  5FD6 A;  2MN3 A;  3DKX A;  3PNY A;  4BL0 B;  5HS8 A;  4IPA A;  2JPC A;  4HF2 A;  4F92 B;  2W85 A;  3A02 A;  4HX7 A;  5D5V B;  5B1A H;  5JVG F;  3MZH A;  4BDY A;  3HOU J;  4IHV A;  1IJW C;  2CQ7 A;  2XSD C;  3TED A;  2ZB9 A;  2H1K A;  3TGN A;  3GLX A;  4BJ5 C;  1OYY A;  3L1P A;  2CS3 A;  2FXA A;  1SFK A;  5CQE A;  1S72 I;  4RGX A;  1ZHF A;  4ENJ A;  3CLO A;  4M3G A;  3CCM I;  4YG2 F;  2Q0O A;  3FZV A;  3CLQ A;  1TZL A;  1F1Z A;  3TW7 A;  1UG2 A;  3CF5 F;  1LVK A;  1B8I B;  1R58 A;  2NS8 A;  5IT9 K;  3TO6 A;  1S3J A;  1RZ4 A;  2LLK A;  5JLX A;  2V9P A;  2LY1 A;  2ELK A;  5E8I A;  2CW7 A;  3DKY A;  1VFC A;  1WJF A;  3OIP A;  4I09 A;  3I58 A;  1W1W E;  1MMS A;  2WAF A;  1E3P A;  2XGE A;  2ZC2 A;  2F5C A;  2X85 A;  3DQV C;  1UHW A;  4ZYA A;  1D8K A;  4K2E A;  5AIQ A;  3FF5 A;  4LJZ F;  2Y0M A;  2E2H J;  1B9M A;  3ABK H;  2QSF A;  3DEW A;  2Q1Z B;  4LIU A;  2CMP A;  3ZOB A;  2JN6 A;  3ZMU A;  3WU2 C;  4CYC B;  1EJ9 A;  3MVP A;  2HDD A;  1WQ2 A;  4U87 A;  1VQ6 I;  3QYF A;  3RCO A;  3KET A;  1ATX A;  3DP7 A;  1H9G A;  4A0Z A;  2DT7 B;  3V42 A;  1IXC A;  4RAG A;  1IRZ A;  1X19 A;  2D2W A;  4F91 B;  3NWT A;  2DFI A;  2MD0 A;  3C1D A;  2X4H A;  3S8P A;  1B8I A;  1LFB A;  5D4R A;  3JTG A;  5LGT A;  5IT9 Z;  5DYM A;  1GV5 A;  2MUB A;  2OBP A;  1BW6 A;  1V5E A;  2RAE A;  4AIH A;  1MBF A;  3HRU A;  2VBY A;  3QYE A;  2CGP A;  3HSF A;  2KMU A;  1DUX C;  2LR8 A;  3OS1 A;  1X4O A;  1QVT A;  5DCM A;  2R93 J;  1BDS A;  3SYT A;  4XRS A;  5ICE A;  5HVQ C;  4FX0 A;  3P7N A;  4KIG A;  1JHH A;  3K1P A;  3HRM A;  1D0Z A;  3GTG J;  1SHI A;  3BC8 A;  2SH1 A;  1YIO A;  1OYW A;  1KU3 A;  2EFP A;  2MYS A;  1R1U A;  4A2U A;  2X6O A;  3KP4 A;  3RQ4 A;  3BZK A;  4J00 A;  4F7Z A;  2E34 A;  4AM3 A;  5HOD A;  3K4K A;  1QPM A;  5CVJ A;  1O57 A;  3RSN A;  5E3M A;  1T8I A;  1G3T A;  1GVD A;  3F21 A;  3PIP F;  4DGW B;  2EZI A;  3CMM A;  4MTE A;  4KIF A;  3D5L A;  3FMR A;  4HSR A;  1BOB A;  5KHD A;  3RPQ A;  2XRL A;  4U0V A;  5E1W A;  1FIA A;  2L3D A;  4WXD A;  1YRN B;  4AID A;  2VB6 A;  1TTY A;  3I0T A;  2BV6 A;  4EAT A;  2V1U A;  1MKM A;  3ZRG A;  2OZU A;  3V7R A;  2V7F A;  2DTZ A;  3DWL E;  5LFA A;  2NRA C;  4IO9 F;  4CUG A;  4BHC A;  4JX5 A;  3OYC A;  4CO8 A;  3NWS A;  5F0F A;  4HA8 A;  2XGD A;  4RAF A;  1XS9 A;  2KJC A;  3FM5 A;  1G3W A;  3OR2 C;  4A69 C;  4KN4 X;  3SFI A;  1T2K A;  4OIR F;  2DFE A;  2ECC A;  5CVU A;  5FJ8 J;  3OYG A;  2MLK A;  3O8G A;  1B8W A;  4H0E A;  1WI3 A;  5M5X J;  2RGV A;  3JRG A;  3H9J A;  2EFW A;  4HW0 A;  2LDU A;  4A3E J;  4Q47 A;  4EVI A;  2HJE A;  4RB1 A;  1YX5 A;  5DUI A;  1X3W B;  4NNJ A;  4CCK A;  4ZH4 F;  2KDO A;  2K86 A;  5K7F A;  3EUH C;  3P9I A;  3UNG C;  4MEY F;  2M4K A;  2QBY A;  3HHG A;  3VWB A;  1FIP A;  3I9V 2;  2HQA A;  4CSW A;  2FE3 A;  3VFZ A;  2I8D A;  1Z77 A;  4AUX A;  3HKZ A;  2VT3 A;  3MYV A;  3RTR A;  2LP0 A;  3NEU A;  3ROU A;  2LNB A;  5E3L A;  1FYL A;  2QSG A;  4BE2 A;  2E36 A;  4PGG A;  4NHJ A;  2YU9 J;  1TL8 A;  3CD6 I;  5JLW A;  2QM3 A;  2GA1 A;  4D5F A;  1I3A A;  1X2N A;  4A93 J;  4CZZ A;  4HV6 A;  4S0H B;  3HUG B;  3IWZ A;  4FE7 A;  5IY5 H;  2WBM A;  2X6Y A;  2NOJ B;  2Z99 A;  2HDW A;  1FSE A;  5FRN A;  3GTQ J;  1QVU A;  1FOK A;  4ITV A;  3M4O J;  5D5X B;  4B4C A;  2E7W A;  1LEA A;  1ZGW A;  3AG1 H;  2E2J J;  1W7P B;  2ETH A;  2NS7 A;  4M9X A;  2EA2 A;  1K61 A;  4MTD A;  1XX5 A;  1WGX A;  2XPV A;  2DU9 A;  4O3M A;  3NAU A;  5HNH A;  3C38 A;  5A2Q K;  1POG A;  3H0D A;  1Y0N A;  2BY3 A;  3GTJ J;  2XKP A;  4XSZ F;  1Z21 A;  4XLF A;  3IHU A;  5FGM A;  3M9A A;  3K1N A;  3R4K A;  1JTY A;  1I39 A;  2MH9 A;  1MBG A;  1D0X A;  1UB9 A;  1R1T A;  3L2Q A;  1FBS A;  1FY7 A;  3WE2 A;  4UVA A;  5D6F A;  3SJM A;  3COA C;  1J59 A;  4RGR A;  2LY9 A;  2WA0 A;  3T5X A;  1ZAR A;  3BG3 A;  1SMY F;  2R5Z B;  2PN6 A;  5TIS C;  3SZP A;  1ITY A;  1OLT A;  2B9S A;  1ETY A;  2BY2 A;  4PGH A;  1HDP A;  4HPQ A;  4D0P A;  1PP7 U;  3HBL A;  1TBX A;  2VE8 A;  2IAI A;  2L7F P;  1W5S A;  4IRI A;  3U2R A;  4G7O F;  2QYO A;  2LH9 A;  1S29 A;  1LKX A;  2H1L A;  1IZ1 A;  1UST A;  2DMN A;  4BQQ A;  2FSW A;  3QPH A;  2EIM H;  3TP3 A;  3BR1 A;  4I98 B;  2P5K A;  1FSH A;  3RQI A;  3TOA A;  5IYB J;  1TQM A;  1Z91 A;  1OYI A;  4HNU A;  1D6B A;  3S1M J;  2YX7 A;  3B73 A;  2E71 A;  1MSE C;  4GRI A;  2DA2 A;  5BNG A;  3DFG A;  2BXY A;  2O0Y A;  2W00 A;  3JW4 A;  3H9G A;  2BW3 A;  3WGG A;  4I6Z A;  2GQQ A;  2OJE D;  2R5Z A;  1UFM A;  3SEZ A;  2HR3 A;  4WK8 F;  3I56 I;  3K4L A;  3ZQG A;  5CLS A;  3E5U A;  4CH7 A;  5CQG A;  2KIQ A;  2L4M A;  3ECH A;  2IP2 A;  1RRJ A;  2K85 A;  1XGN A;  3M7G A;  4YIR X;  1ETK A;  2M8G X;  3NAR A;  1MGT A;  1G6N A;  5F6F A;  4CYD A;  4A3L J;  4C3H J;  3IAM 2;  2YPR A;  4AIK A;  4QTR A;  1STZ A;  2CWE A;  3HTU A;  5JI6 A;  2BHZ A;  2DQL A;  3HB9 A;  2NVQ J;  1Y8Q B;  4MEX F;  5KAI C;  2XC7 A;  4MFE A;  2DDB A;  2P8T A;  4XNF A;  3CMA I;  3V7C A;  4E4H A;  3RDI A;  4I2O A;  2J5P A;  5LLQ A;  2E35 A;  1ZGJ A;  2VC1 A;  2XF7 A;  2IXS A;  2XUB A;  1GT0 C;  1LE8 B;  1X3Z B;  2MAB A;  2HFH A;  3A03 A;  4RB3 C;  4B09 A;  4PUS A;  2MC3 A;  2HZT A;  2UZK A;  4IOA F;  2R0Q C;  2M8E A;  3G1L A;  1I50 J;  1BC8 C;  2Y9Y A;  3ABT A;  4XOT A;  1RR7 A;  4RM2 A;  2BY1 A;  5F27 A;  1VQM I;  4IZZ A;  2PMZ N;  4W1U A;  4I0A A;  4BXF A;  5TRD A;  2L9V A;  4HDU A;  1ONV A;  3O8H A;  3PO3 J;  2A6H F;  5GTI C;  3HM5 A;  4RBO A;  3OYA A;  3T8R A;  1IUF A;  2E7X A;  2OU2 A;  3WGI A;  2PJP A;  2PBI A;  1HBX G;  1UZC A;  1F5T A;  2QF7 A;  3I54 A;  1WXN A;  4GV5 A;  5E8G A;  4IL6 C;  1MMA A;  1OQY A;  3LSI A;  2HOS A;  2DPU A;  2LMD A;  2E1M B;  3VYU B;  5H2F C;  3RYR A;  2H8R A;  2W7N A;  2CRG A;  3D5R C;  1BIB A;  3GME A;  3PM1 A;  4LOC A;  3FXU A;  5K1Y A;  1REP C;  2CYY A;  1LDK B;  5HOO A;  2Y48 A;  4OMZ A;  3OYK A;  1UMQ A;  4E70 A;  2EFN A;  1S8N A;  3CO7 C;  2GOX B;  1ZH5 A;  1ZRC A;  1HKT A;  3HZJ A;  3A01 A;  3QYB A;  3VEP A;  4YFN F;  3BTJ A;  3HG9 A;  2CG4 A;  4ZYH A;  1X3U A;  3DLL F;  4BQA A;  1RES A;  4BY1 J;  2XSJ C;  1XCB A;  3QPL A;  2DLA A;  4EM1 A;  4B3A A;  2KIS A;  1J2X A;  1BR1 A;  2DTR A;  2R92 J;  2KT0 A;  1W4M A;  3IAS 2;  3TBI A;  1R22 A;  1D5Y A;  2STT A;  2XF6 A;  3H9Q A;  2GIZ A;  2IA2 A;  4XKV A;  5CJ9 A;  3V8J A;  3OMY A;  4RGS A;  4OIP F;  3Q3S A;  1A04 A;  1GUU A;  3MCX A;  2LRE A;  3JRB A;  4QWQ A;  2CV0 A;  5ILV A;  3LNQ A;  3CCE I;  1VQ8 I;  5F04 A;  4A0X A;  2ZNZ A;  1WJ5 A;  1MBH A;  1OCO H;  2G0E A;  4M3D A;  3DPT A;  4B43 A;  1OCC H;  2EZL A;  1UCR A;  4HLY A;  4G7Z F;  1VQK I;  1XSV A;  2FRH A;  1YS7 A;  4AWX B;  1H9T A;  1XC5 A;  2IBD A;  4XQF A;  4DBQ A;  1PJR A;  1ZLI B;  2ME0 A;  1S5L C;  1IO2 A;  3FHN A;  1A5J A;  4Y13 A;  3PJR A;  2VPR A;  3UR3 C;  2H6B A;  2IW5 A;  5CVV A;  3WHB A;  3S15 J;  4L9V A;  4XKC A;  5K5R A;  2DXI A;  3CQZ J;  2B63 J;  1ZYR F;  3BTI A;  5FKM A;  2ZSI B;  3S3N A;  2NS0 A;  4FAS D;  4IRH A;  3CJR B;  4AU7 A;  4BUP A;  4LD5 A;  2E1N A;  2VKV A;  2O8X A;  1VQL I;  4R8H A;  5E1X A;  1Z05 A;  5M5Y J;  3O3K A;  3RJP A;  3W3C A;  2Q8K A;  1WVR A;  1RIO H;  3C30 A;  1O3S A;  1CQT A;  1I27 A;  3FXQ A;  2VXZ A;  4CDG A;  3GTO J;  3I3L A;  1QQI A;  3B02 A;  2NOG A;  1MBK A;  2DA7 A;  1U9O A;  3OYJ A;  1YLF A;  1MDM B;  2RN7 A;  2K3F A;  1ZK8 A;  2K9Q A;  3BG9 A;  4I99 C;  2XAG A;  1LEB A;  3JSO A;  1IDY A;  1LB2 A;  3MMY B;  2FA5 A;  2ISY A;  3I5U A;  4PCQ A;  2DQR A;  1XG1 A;  3F9K A;  3OV8 A;  3EDP A;  2IGN A;  1IN8 A;  3EYY A;  2QEX I;  5J1R A;  1EF4 A;  4I0B A;  4MNU A;  3OOP A;  5GTH C;  5IPA A;  2EH3 A;  1SVL A;  5FD5 A;  2TRT A;  1H89 C;  2D45 A;  4HG2 A;  3DV8 A;  3IP4 B;  3F8M A;  1OR7 C;  1ZEL A;  2H9X A;  4I01 A;  2ZJ2 A;  3DXJ F;  4JX4 A;  1I6H J;  1JXS A;  5H6R A;  2HVR A;  1E3O C;  1HCR A;  3JTH A;  2L2O A;  3FMS A;  1DP7 P;  5EJC A;  4XOR A;  3KPH A;  5DD8 A;  2UXN A;  1LVA A;  2Y0S A;  1XSX A;  2QA4 I;  1W0T A;  4C2T A;  1KZH A;  2NNN A;  3KZY A;  3KEY A;  3OOU A;  2R7F A;  1U5T B;  4GO1 A;  1U78 A;  3BT9 A;  3CUO A;  1S7E A;  2K3P A;  1G4D A;  3FIW A;  4OIN F;  2UV1 A;  5C44 J;  1GXP A;  1KQ9 A;  4BH9 A;  2IA0 A;  1E2X A;  2CFX A;  4HF0 A;  4AD9 A;  1XD7 A;  3LAJ A;  2STW A;  2LKS A;  2BGC A;  4UVC A;  1R1V A;  3FMQ A;  4XLE A;  3ZMZ A;  2D5V A;  4Z2Y A;  4XON A;  3ABM H;  4CCM A;  1QZY A;  1JJ6 C;  2V9K A;  2K9N A;  1BBY A;  4BNC A;  2QSH X;  2F5E A;  1PDN C;  4OIQ F;  1T0F A;  4V2F A;  3G71 I;  1YW8 A;  3ZR8 X;  3CUQ A;  2ZJP F;  3ASN H;  3ZQH A;  3WTY C;  1R7J A;  1SD7 A;  3T8T A;  5D8K B;  3WTT C;  2KFD A;  1SFO J;  1JE8 A;  2ID6 A;  2X6X A;  1D0Y A;  3HHH A;  1ZGA A;  4XR6 A;  1FP1 D;  1ZTR A;  4IHX A;  1KYZ A;  1DQU A;  1BI2 A;  3C2G A;  3WTZ A;  1CGP A;  2M0M A;  4LB6 B;  3K70 C;  2OPT A;  3ZPL A;  5B5E C;  3BQY A;  3G1M A;  2E60 A;  4LFU A;  4Y4R A;  4ZTJ A;  2DI3 A;  2LC2 A;  1D1A A;  3SQN A;  2HTS A;  3VDX A;  4XKB A;  1DGW Y;  3E6D A;  2FEZ A;  4Q5S F;  4UV8 A;  1D5V A;  4XKW A;  1VTN C;  2A61 A;  3HTS B;  3DPL C;  1QZZ A;  1PUF A;  1ACI A;  4RDU A;  2NAZ A;  3BCA A;  3LSJ A;  2HYF A;  3ERM A;  4CCJ A;  2KLO A;  2KRF A;  2OAZ A;  3WE3 A;  4A5N A;  1YW7 A;  3JRF A;  4IQ4 A;  1BL0 A;  4XN0 A;  1K78 B;  3WG9 A;  5L3B A;  5LHH A;  2L7K A;  1P92 A;  1UEL B;  3TKY A;  4B1R A;  5DM6 F;  2JWT A;  2EIL H;  1FX7 A;  3A0H C;  3R0J A;  1YS6 A;  3ERE D;  3Q0W A;  4B3X A;  3HC7 A;  2W82 A;  5F1R A;  4BEH A;  3W2W A;  1AWC A;  4EGY A;  4AYB N;  3OYH A;  2L9S A;  4FCY A;  3F8C A;  1IV8 A;  2DOE A;  1NH3 A;  2QLZ A;  1QPI A;  1RET A;  2ELH A;  4S05 A;  3LSH A;  2VN2 A;  1YE9 A;  2DFH A;  4HDV A;  4LK0 F;  2F5F A;  5FFZ A;  3PSF A;  2KIF A;  4L5I A;  5GAE J;  2GA2 A;  2PEX A;  3MZY A;  1Z6T A;  4HNT A;  4G9Y A;  2EJR A;  1H88 C;  2ESN A;  3ONQ A;  5EG0 B;  1WJA A;  3OWT A;  2DMT A;  4M72 A;  3SDG A;  4H4K C;  3S17 J;  3PFI A;  4KYW A;  3SFZ A;  3EUK L;  1ZG3 A;  4PJN A;  1TWC J;  4HQM A;  1K78 A;  4ZDO A;  1DGR M;  2ZXH A;  3HOY J;  2CW0 F;  1K79 A;  2DK5 A;  3JAM K;  1KU9 A;  2R7T A;  5DTD A;  3SHF A;  3L00 A;  1AOY A;  4JYK A;  5K5O A;  1ENH A;  5EZH A;  4ZDP A;  2ZBK A;  4C2M J;  3BG5 A;  4OAZ A;  1HXD A;  1ZHH B;  4IX7 A;  2ICW G;  4EJO A;  3RI4 A;  2AS5 F;  1KU2 A;  3FX3 A;  3ZGK A;  3PFY A;  5DCM B;  1L3L A;  3RIR A;  1SAN A;  2EZH A;  1USS A;  1XN7 A;  4P9U A;  2DA5 A;  4MO7 A;  5FO5 A;  5EG0 A;  3CC4 I;  3CZ6 A;  5JR3 A;  3G73 A;  2F48 A;  3PSI A;  1QO0 D;  5TGT A;  4P96 A;  2VPL A;  3HDD A;  2VQC A;  3QAH A;  1GXQ A;  1FT9 A;  5HLI A;  3T0Y A;  4LG3 A;  2NVX J;  1PVE A;  2RRE A;  4Q4Z F;  4DYC A;  2EIJ H;  2X51 A;  3JAM Z;  3JRD A;  4YIR A;  5FKK A;  1K4T A;  1Z0X A;  5L3G A;  4A3J J;  2K5C A;  3MEX A;  3TDZ C;  1UG0 A;  2HPM A;  3BR5 A;  4X1E A;  1SAX A;  2ESH A;  4DBR A;  4EV0 A;  5K5Q A;  2VON A;  3ML6 A;  4I7H A;  2FQ4 A;  1QHG A;  2VBZ A;  2RQP A;  2LG4 A;  1K83 J;  1P6R A;  2JA2 A;  1IRF A;  3BJA A;  4LMY A;  5ILU A;  1JUM A;  4CCN A;  1GLN A;  2EIK H;  3HYI A;  1ORK A;  2CUJ A;  2LF7 A;  3MCZ A;  3S3M A;  4KFC A;  1HKQ A;  3DTK A;  4KIT B;  3O2P E;  5CYV A;  2EIN H;  2Z9O A;  1ZKG A;  1IN6 A;  4A6D A;  5KK1 A;  3K70 D;  3P9K A;  2YR2 A;  4MFD A;  3VOD A;  2V6E A;  3WOD F;  1R23 A;  2L4A A;  1D1C A;  3A2K A;  1WH7 A;  2LRD A;  3DU6 A;  2K40 A;  1MJ9 A;  3I55 I;  3FBI B;  2KRC A;  2JSP A;  1OPC A;  2H6C A;  2Y30 A;  2LYC A;  5ILS A;  5EEA A;  4UB6 C;  1W0U A;  2HNH A;  4XID A;  3E5X A;  3QOD A;  4PSW A;  5CKT A;  1FBU A;  3MFK A;  3IKT A;  2QBY B;  2ZCW A;  4HST A;  3GW2 A;  1NHA A;  1OIS A;  3FXO A;  2DPD A;  1IN5 A;  2LY2 A;  3E6M A;  3F6V A;  1KON A;  3BR2 A;  3VPR A;  1J09 A;  2M7A A;  2X0L A;  3ZQQ A;  4E7S A;  5K7H A;  1RR8 C;  4LLG F;  5EDN A;  1ZUF A;  2HTJ A;  2XAS A;  5F64 A;  2VJI A;  2F4O B;  3I4P A;  5HNF A;  5HDK A;  2LF8 A;  3DPU A;  2Z2S B;  3IRR A;  1HQC A;  2VE9 A;  3KEO A;  3L2W A;  2CW8 A;  3IH4 A;  1IN4 A;  1ERD A;  2VQH A;  4E7K A;  2V79 A;  5JHF A;  1HA8 A;  1V4R A;  1NK3 P;  1QNT A;  5FKN A;  3U1K A;  2LKX A;  2W24 A;  2XGX A;  5FKO A;  3RPU D;  4ZDL A;  2QQA A;  4A3B J;  2VKE A;  2O3F A;  4AVZ A;  3J7A Y;  3L2R A;  1L0O C;  2B0L A;  3GFJ A;  4BJ6 C;  5B3S H;  5HLH A;  3J7Z I;  3QQA A;  3E6C C;  2VBW A;  4KDP A;  1MH4 A;  2BEO A;  3EUH A;  1P9Q C;  3VYS B;  3IRQ A;  2OUM A;  1B9N A;  2VC0 A;  3TQN A;  1O3R A;  1YQA A;  2F4I A;  5E79 C;  2OCE A;  1I5Z A;  4YIF A;  2VJJ A;  4IHT A;  3QWL A;  3KP7 A;  4DNC A;  3OYM A;  4DZJ A;  2BVM A;  3DU5 A;  3E6B A;  1MNM C;  5F1J A;  4L9N A;  1GL9 B;  2M5W A;  2TCT A;  2JPB A;  3BTC A;  4FE4 A;  3FXL A;  5JFR A;  2L0K A;  3IC7 A;  2LSO A;  2XAH A;  3CCJ I;  3FIS A;  1TLH B;  2VJ4 A;  5IOY A;  3M8F A;  4XM3 A;  5JHU A;  2R4G A;  4E7H A;  1ETQ A;  2QKL B;  1ON1 A;  5AON A;  2LBF A;  4QIW N;  4M3E A;  4HAM A;  4KA4 A;  4Y17 A;  1V55 H;  5KAF C;  2HVQ A;  4U7B A;  2XB5 A;  2W48 A;  1JGG A;  3BR0 A;  2OZ6 A;  2MFZ A;  2DK8 A;  2WAE A;  3ECO A;  2IS6 A;  2BHY A;  3I4M J;  2QGU A;  3CDI A;  4B8X A;  1V54 H;  2Z1D A;  4F55 A;  1P4A A;  3FHZ A;  4IHY A;  2B7E A;  1YJ9 I;  3KZZ A;  1O7F A;  2IGO A;  2ZFW A;  4KT5 C;  1Y1V J;  2NVU B;  3J80 Z;  4Y7N J;  2BW3 B;  3JRC A;  1ODD A;  3EET A;  3LSG A;  1TNT A;  2L9R A;  4C3I J;  3V8K A;  4FT8 A;  1OJL A;  3HRS A;  1VQ7 I;  2E2I J;  3CCQ I;  2ME6 A;  1R5H A;  3DKW A;  2ZME C;  4EJT A;  1TWG J;  2BYV E;  2EV5 A;  5C4X J;  4ZYE A;  3L09 A;  4UUV A;  2K9M A;  3ZQI A;  2AQF A;  2XAF A;  1N75 A;  3LQR A;  4HX4 A;  4IRG A;  3S32 A;  5E18 F;  2XIG A;  1XB4 A;  4JQF A;  2KZV A;  1ZR2 A;  4G7H F;  1SEU A;  1XDU A;  3BG7 A;  2WY7 Q;  2ZKZ A;  4RM3 A;  3DBL B;  4W97 A;  1J9I A;  1T95 A;  3M8J A;  1IV6 A;  2K9L A;  2HXI A;  2LVS A;  2IJL A;  2R7R A;  3CCL I;  1BI3 A;  3F22 A;  2H27 A;  3Q9V A;  2HU9 A;  2EPF A;  3M07 A;  4GCV A;  2DJN A;  3E7L A;  3D4U B;  1V5F A;  5LRS A;  5HDG A;  2I5U A;  2VKD A;  3AL0 C;  1XPX A;  5IYD J;  1AHL A;  3GZ6 A;  3GYH X;  1J75 A;  4WXH A;  1YW9 A;  3K4B A;  1DPR A;  1XCV A;  3NRV A;  1JKO C;  3M8E A;  5L3F A;  5DUK A;  1F43 A;  5D5W B;  2XAJ A;  5LRR A;  3WG7 H;  2BBY A;  4CXF A;  3H0G J;  1U8B A;  4CHU A;  1FP2 A;  2ELJ A;  1YOV B;  4MLO A;  2VJ5 A;  3PNV A;  2QUF A;  1BN5 A;  3FM3 A;  3WHC A;  2ZNY A;  1F36 A;  3K69 A;  3LFK A;  4XK4 A;  4ON0 A;  1Y8R B;  3GEZ A;  2IA1 A;  1S7A A;  3LMM A;  1U6G A;  4XMY A;  2LKP A;  2A6E F;  2CUF A;  2FD5 A;  1IF1 A;  3CCY A;  2L9N A;  2VKH A;  5K7Z A;  3OYD A;  3TOB A;  3FBN B;  2HDC A;  4IHW A;  4EM2 A;  4D7M A;  5JVT A;  2XRO A;  4RLQ A;  3V8L A;  1TNS A;  1MSF C;  1GDT A;  1IXR C;  3ELK A;  4AVP A;  2LD5 A;  5DEQ A;  3BDD A;  3K2Z A;  1A31 A;  3G4S I;  2QCO A;  2QSH A;  2WB1 A;  4LGW A;  3QP6 A;  1H0M A;  3OL3 A;  3CC2 I;  4HZF A;  1B59 A;  3ZQL A;  4R79 A;  3N4M A;  1BOA A;  4D9J A;  4P5O A;  5ICC A;  3CP8 A;  3GWZ A;  2V6C A;  2EK5 A;  5D4S A;  3HOV J;  3A01 B;  2K2X A;  3E1S A;  4JBA A;  1WI9 A;  2D1V A;  1FMW A;  4ENM A;  3C3W A;  3KIO A;  1EA3 A;  4ZYD A;  1BJA A;  1W5T A;  1ZAO A;  4NDL A;  2OD5 A;  3BTL A;  3CDH A;  3N05 A;  2V1D A;  3MWM A;  3OR1 C;  2PMU A;  1BI1 A;  1OMI A;  3GF2 A;  3PIO F;  2JA8 J;  1IRG A;  4DQ2 A;  3EPZ A;  4UB8 C;  3GX4 X;  3S16 J;  3BPX A;  3L2C A;  3CP2 A;  1TP4 A;  2IGM A;  2HKX A;  3FXK A;  3AFH A;  1QA6 A;  2RC4 A;  3HPH A;  1HST A;  2A68 F;  4YRV A;  3TO7 A;  1R36 A;  1ETX A;  2YUS A;  2FUG 2;  4UUT A;  2M87 A;  4BE0 A;  4E7Z A;  3R0A A;  3GFI A;  1VQ5 I;  1N25 A;  2E19 A;  4II2 A;  1K4S A;  2EBI A;  3ZN1 A;  2RKH A;  3AAF A;  4BAY A;  3HOS A;  3H5R A;  3HPG A;  2JRM A;  2P7V B;  4MQ9 F;  1XGO A; 
#chains in the Genus database with same CATH homology
 4XLE A;  3BG6 A;  3QYF A;  3RCO A;  4CCM A;  4XON A;  1ATX A;  3H5A A;  2V9K A;  3AL0 B;  2DT7 B;  3V42 A;  1X19 A;  3HXL A;  1X1D A;  3NWT A;  4F91 B;  2MD0 A;  1NG6 A;  2W4S A;  3S8P A;  2WY8 Q;  1MMD A;  2VAS A;  1V5G A;  3ZR8 X;  3PUB A;  2HPI A;  2UUZ A;  2MUB A;  3GBG A;  1V5E A;  1G59 A;  1Z3X A;  2XDV A;  2X1C A;  2BVL A;  3W2V A;  4F52 A;  4DIQ A;  4OAY A;  2DCE A;  4Y33 A;  3AKZ A;  2A5W A;  3QYE A;  2PJR A;  2KHM A;  2KMU A;  3OS1 A;  1X4O A;  2X6X A;  3KX2 A;  1D0Y A;  3SYT A;  1BDS A;  4QPO A;  5HVQ C;  4XR6 A;  3OYI A;  2IS4 A;  1D1B A;  1DQU A;  2A6T A;  3C2G A;  4XOP A;  4KIS A;  2M0M A;  1D0Z A;  1WJD A;  4ZC3 A;  1SHI A;  3BC8 A;  3K70 C;  2SH1 A;  2MYS A;  2XF5 A;  3RQ4 A;  2M3A A;  2E60 A;  1FMV A;  4Y4R A;  4J00 A;  4ZTJ A;  3TMO A;  2E1M C;  2E5Z A;  2LC2 A;  1D1A A;  3K4K A;  3RSN A;  4II3 A;  4XKB A;  1DGW Y;  3VDX A;  4PJM A;  4BJT A;  4DGW B;  4XKW A;  3CMM A;  1PYV A;  3D5L A;  2P0W A;  4HSR A;  3DPL C;  4N4N B;  1BOB A;  4YEJ A;  5KHD A;  3BCA A;  3OIQ A;  4CCJ A;  2KLO A;  2MC4 A;  3CES A;  2VB6 A;  4IQ4 A;  4EAT A;  4F3Q A;  4XN0 A;  3ZRG A;  4F93 B;  3M1C A;  2CV2 A;  2V7F A;  3DWL E;  1VZ0 A;  3LFU A;  2L7K A;  5LFA A;  1UEL B;  4CUG A;  3ZCO A;  3OYC A;  2VQL A;  3NWS A;  2R7X A;  3OR2 C;  3DEE A;  2R7V A;  4B3X A;  3HC7 A;  2W82 A;  4BEH A;  1X4P A;  3W2W A;  4PSX A;  3OYG A;  4E6K G;  4IKF A;  4BE1 A;  4BS9 A;  3OYH A;  2L9S A;  1B8W A;  4Y3O A;  3ZXS A;  2F5V A;  3LSH A;  1BR4 A;  3H9J A;  4E7J A;  1WFX A;  2DT6 A;  1YE9 A;  2B9K A;  2HJE A;  1YX5 A;  3PSF A;  2JVH A;  4CCO A;  3S93 A;  3OY9 A;  4NNJ A;  4CCK A;  4DOZ A;  2KDO A;  3BCB A;  3EUH C;  4HNT A;  1MMN A;  3ONQ A;  3UNG C;  1WJA A;  2M4K A;  3OWT A;  3VWB A;  4H4K C;  2E5N A;  3I9V 2;  2HQA A;  3EUK L;  4JOM A;  4CSW A;  4PJN A;  2I8D A;  3K6G A;  1WJE A;  4ZDO A;  3HKZ A;  3MYV A;  1DGR M;  2ZXH A;  3RTR A;  2QSG A;  3LSK A;  4BE2 A;  2R7T A;  2PMZ A;  2F6C A;  4ZDP A;  3E0J B;  2Q2E B;  5HLT A;  3LL7 A;  4OAZ A;  1ZHH B;  4IX7 A;  3HUG B;  2WBM A;  2X6Y A;  2NOJ B;  3ZGK A;  2V26 A;  4DJA A;  2O5R A;  2HDW A;  3PFY A;  3L2V A;  5FRN A;  4ITV A;  2RNG A;  3MKW B;  4HRI A;  2RQQ A;  3DLA A;  2QKM B;  4C30 A;  3CZ6 A;  3G2B A;  2WAD A;  3PSI A;  5TGT A;  5HNH A;  3OL4 A;  2VPL A;  3C38 A;  2V4J C;  2VQC A;  3H0D A;  1QU3 A;  1Z21 A;  4LG3 A;  4XLF A;  2RRE A;  2DOA A;  2X51 A;  4YIR A;  2CV1 A;  1D0X A;  1X1C A;  2K5C A;  3L2Q A;  1UG0 A;  2HPM A;  4PJL A;  4DBR A;  3H5N A;  3K4N A;  4YEL A;  1S9H A;  1QHG A;  1UAA A;  2LG4 A;  2JA2 A;  2WA0 A;  4E7I A;  2VXD A;  4CCN A;  1GLN A;  1OLT A;  1ZUE A;  4B44 A;  3OYB A;  3K4C A;  5KCM A;  2IKD A;  2CUJ A;  3A4C A;  2JVG A;  4HPQ A;  4BEH B;  3S3M A;  3DTK A;  4KIT B;  3MKY B;  2BDS A;  3K70 D;  2V6E A;  2LH9 A;  1YX3 A;  1LKX A;  2HJ9 C;  1D1C A;  3A2K A;  2LRD A;  3DU6 A;  3K10 A;  1JI8 A;  1U0J A;  4XLA A;  4BQQ A;  3FBI B;  2KRC A;  2JSP A;  2LYC A;  3KEZ A;  2HNH A;  1Y6I A;  2VIX A;  1D6B A;  3QOD A;  4PSW A;  2ZFU A;  5CKT A;  4HNU A;  4PFO A;  1K6Y A;  2CUZ A;  4HST A;  1N78 A;  4GRI A;  1LFP A;  1MNE A;  3MD2 A;  3VYT B;  2LY2 A;  2W00 A;  4QPQ A;  3H9G A;  2BW3 A;  2IGK A;  1WQK A;  1KON A;  3OYF A;  1J09 A;  2M7A A;  3SEZ A;  4BDZ A;  3ZQQ A;  4E7S A;  3K4L A;  1WJC A;  4CH7 A;  1ZUF A;  5CQG A;  2VJI A;  1MW7 A;  2X1E A;  5HNF A;  3DPU A;  4G6T B;  2Z2S B;  1MMG A;  4D1Q A;  2KQR A;  2OC6 A;  2CW8 A;  3L2W A;  1E0E A;  4LIV A;  2OV7 A;  1ERD A;  2VQH A;  1IRX A;  4E7K A;  1Z7L A;  4CCL A;  3K4M A;  3IAM 2;  5JHF A;  3HL2 A;  1HA8 A;  3VSK A;  4NUB A;  4XLC A;  3RPU D;  4ZDL A;  4ZTF A;  1BR2 A;  4IQJ A;  2XC7 A;  4AVZ A;  3J7A Y;  3L2R A;  4BJ6 C;  1QHH D;  4XN3 A;  4XNF A;  2KRH A;  4E4H A;  2BOL A;  1P9Q C;  3VYS B;  4N4O B;  2OUM A;  2XF7 A;  2IXS A;  5LD2 C;  2VLA A;  2F4I A;  1W36 C;  2VJJ A;  3QOE A;  2MAB A;  4KT6 A;  3OYE A;  3EUA A;  4B48 A;  3OYM A;  2JTO A;  1Z99 A;  2BVM A;  3DU5 A;  4PUS A;  1NG7 A;  3HOT A;  4J01 A;  4BGD A;  4KJZ A;  3SEQ A;  1Z3Y A;  1H5O A;  3K4J A;  4NQW B;  4FET A;  4XOT A;  4RM2 A;  2VJ4 A;  5FRO A;  4XM3 A;  2R4G A;  2W1O A;  4E7H A;  4IZZ A;  2QKL B;  2LBF A;  2IS2 A;  3PNT A;  2Z16 A;  4BXF A;  3IUO A;  4RMN A;  2HVQ A;  4CZC A;  1MND A;  4U7B A;  2HZD A;  3PL8 A;  2MFZ A;  1SH1 A;  3OYA A;  2WAE A;  1G8X A;  4NC8 A;  2IS6 A;  1WXN A;  3DTE A;  4GV5 A;  1MMA A;  3LSI A;  2Z1D A;  2E1M B;  3VYU B;  4F55 A;  2W7N A;  1ZLH B;  3D5R C;  3CF2 A;  2CH0 A;  2IGO A;  3BLY A;  4XLH A;  1LDK B;  3SZG A;  5HOO A;  3FDY A;  3U21 A;  3OYK A;  2BW3 B;  5FRM A;  2KPM A;  3LSG A;  3L2U A;  2GOX B;  1T0F C;  3QYB A;  3HG9 A;  2M4G A;  2R7U A;  2R7O A;  5KNL A;  2XSJ C;  2X6W A;  3OS2 A;  2DLA A;  3OYN A;  2K9M A;  2VQG A;  3W2A A;  2AQF A;  1BR1 A;  1N75 A;  3S32 A;  3VYR B;  4CA0 A;  1WJB A;  3IAS 2;  4JQF A;  3TBI A;  4ZJZ A;  2KZV A;  4HEA 2;  2IKE A;  2XXL A;  1R6R A;  2XF6 A;  3H9Q A;  3H35 A;  4XKV A;  4P1W A;  3OMY A;  2IS1 A;  2GOM A;  1APF A;  1DP3 A;  3MCX A;  2LRE A;  3BG7 A;  2WY7 Q;  4RM3 A;  1N77 A;  2CV0 A;  1T95 A;  3M8J A;  2K9L A;  2R7S A;  2R7R A;  2VL8 A;  3C2H A;  1WJ5 A;  2AQE A;  2DJI A;  2HU9 A;  3DPT A;  3VSL A;  4B43 A;  1TT0 A;  2XAU A;  3D4U B;  1V5F A;  3S3O A;  2VKD A;  3OS0 A;  3AL0 C;  1SAU A;  4XQF A;  4DBQ A;  1PJR A;  1AHL A;  4BQO A;  1ZLI B;  3FHN A;  4PK4 A;  3PJR A;  3UR3 C;  2WAQ A;  3DTI A;  3K4B A;  4XKC A;  4BU2 A;  2DXI A;  2X1D A;  2R7W A;  4E7L A;  2L5Q A;  2ZSI B;  3S3N A;  4XL9 A;  4FAS D;  3CJR B;  4AU7 A;  2ELJ A;  4BUP A;  4MLO A;  4RLF A;  2VJ5 A;  3PNV A;  2ZSH B;  4AYB A;  3MKZ A;  3FKJ A;  3A1Y A;  2KL4 A;  3W3C A;  3LMM A;  2LBF B;  3C30 A;  4XMY A;  2MN3 A;  3DKX A;  3PNY A;  2VXZ A;  4BL0 B;  2L9N A;  3I3L A;  2CFO A;  2VKH A;  3OYD A;  3FBN B;  4F92 B;  3OYJ A;  4RLQ A;  1X1B A;  2V1N A;  3MMY B;  4BDY A;  4BAC A;  2QSH A;  2WB1 A;  1W36 D;  3CJQ B;  3F9K A;  2IGN A;  3OL3 A;  4BJ5 C;  4R79 A;  4PJJ A;  2CS3 A;  2JR3 A;  3SDB A;  2R7Q A;  4C2U A;  4HG2 A;  4D9J A;  4P5O A;  2M7B A;  3IP4 B;  2LOO A;  1SFK A;  3CP8 A;  5CQE A;  3OYL A;  1OR7 C;  4LIT A;  1ZEL A;  2K2X A;  2H9X A;  3D5S C;  3E1S A;  4NC7 A;  2HVR A;  1TZL A;  1FMW A;  2L2O A;  1EA3 A;  4XOR A;  2UWM A;  1LVK A;  4ANJ A;  2Y0S A;  3N05 A;  3KYL A;  3OR1 C;  4C2T A;  4X0G A;  1X1A A;  1Y56 A;  3EPZ A;  3KEY A;  3OOU A;  2LY1 A;  3CP2 A;  1AA7 A;  2IGM A;  2PJR B;  3AFH A;  2CW7 A;  3DKY A;  3HPH A;  1WJF A;  3OIP A;  4YRV A;  2K3P A;  2HVS A;  2UV1 A;  2FUG 2;  2KP6 A;  2WAF A;  3LSM A;  5CPR B;  4BE0 A;  4E7Z A;  2X85 A;  3DQV C;  4ZYA A;  3LMS B;  2JUG A;  4II2 A;  2ZXI A;  4OWR B;  3TL4 X;  4PFP A;  4BQN A;  3HOS A;  2QSF A;  2Q1Z B;  3H5R A;  3HPG A;  4LIU A;  2CMP A;  4B47 A;  4C9Y A;  4U87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...