2RNGA

Solution structure of big defensin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
79
structure length
79
Chain Sequence
NPLIPAIYIGATVGPSVWAYLVALVGAAAVTAANIRRASSDNHSCAGNRGWCRSKCFRHEYVDTYYSAVCGRYFCCRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Big defensin
publication title A novel beta-defensin structure: a potential strategy of big defensin for overcoming resistance by Gram-positive bacteria
pubmed doi rcsb
molecule tags Antimicrobial protein
total genus 12
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2007-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14862 Defensin_big Big defensin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2000 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2rngA01
2.20.20.10 Mainly Beta Single Sheet Anthopleurin-A Anthopleurin-A 2rngA02
2MN3A 1Z99A 2K2XA 3LMSB 1H5OA 1ZUEA 2MUBA 1ZLHB 1ZUFA 1ATXA 1SHIA 1SH1A 1BDSA 1WXNA 2RNGA 1B8WA 4GV5A 1APFA 2JTOA 2BDSA 3D4UB 2SH1A 1AHLA 1WQKA 1D6BA 1ZLIB 2H9XA
chains in the Genus database with same CATH superfamily
2CFXA 5BNGA 2MABA 5D6FA 3E5QA 2Z2SB 3VEPA 3P5JA 4XR6A 5GTHC 3G1MA 1T0FA 2HQRA 2MC3A 2VKHA 2IW5A 4MQVA 3HC7A 2ISZA 1ATXA 2DODA 4AWXB 1U8BA 5KK1A 1FSHA 2LF7A 3H0GJ 1FTZA 4UVCA 5CVUA 5ILUA 3HDDA 1I27A 4DBRA 2VBWA 2HPIA 3ONQA 1QBJA 3VPRA 4YFNF 1ZLKA 1X1CA 1D6BA 2L2OA 4IL6C 4JP0A 2VT2A 3K0LA 3PL8A 2NVYJ 2CUZA 2EB7A 2RGVA 1Z3XA 2A3SA 5KHDA 2XAFA 3R61A 1SD7A 5DCMB 3OL4A 5CVJA 2HVQA 4MEXF 3HEFA 2KLOA 2H27A 3PNYA 2HOAA 3FMRA 1OPCA 3F8BA 2QENA 1X4PA 2A5WA 2B0LA 2VT3A 3H5AA 4GV5A 3T5XA 4UB8C 4RGSA 4EV0A 3M8FA 1ZG5A 2BDSA 3MEXA 2ACJA 2XF6A 5D4RA 1I1GA 3IC7A 4BE1A 1ACIA 3NAUA 2ZJPF 3GTQJ 4A2UA 1P9QC 3VYTB 4XONA 2EV5A 3HYIA 1SVMA 5JHUA 1YITI 1K7AA 3GZ5A 5D5VB 3GCMA 4R79A 5DD8A 3C3WA 3OYFA 3GEZA 1SD4A 1WQ2A 5LRRA 4NQWA 4EGZA 2WAEA 3OS2A 2JUCA 1QHHD 5IP6A 3CCMI 3GZNB 1KONA 2BGCA 2M7BA 3KZZA 1T39A 4RB1A 3CLQA 3QPTA 1TT5B 2L7ZA 4IF4A 3JTHA 1GHCA 4ZC3A 1YJWI 1TW3A 2STWA 4RA2A 2L9SA 2HKXA 2JA2A 1B59A 3BR2A 4DOZA 2QSGX 1ZG1A 1MH4A 3WHBA 2BHYA 5HLGA 1FZPB 1RKTA 4MFDA 2LOOA 2PBIA 3GLLA 1OCOH 5B3SH 4FX4A 2FOWA 2PN6A 1P4WA 4WCGA 4G7ZF 3WU1B 1VQ8I 1I3QJ 4QPOA 1SAXA 1GT0C 3MVPA 4E6KG 3KX2A 2LKSA 3HUGA 3MN2A 2EZKA 4LG0B 1DU6A 5BS6A 1SAUA 2K7LA 2QQ8A 2ZJ2A 4ASNA 1T33A 1ZUEA 4HRIA 3R0AA 4B44A 2GBYA 4PCQA 5FLMJ 2OJED 2L9RA 2JMWA 2L7KA 3EPZA 4HDVA 3ZP5A 3DFGA 1ETVA 2DLLA 2WV0A 4BHCA 3BR0A 3WE2A 1ON1A 3T0YA 2JR3A 1E3HA 4M74A 3F22A 2IJLA 5H2FC 1Z21A 4DGWB 1MMDA 2O3FA 3HL2A 1IN6A 4IPAA 2P0WA 2W82A 1YRNA 4UVAA 1G3SA 3O6BB 4B47A 3DF8A 3KZYA 2O8KA 3HSRA 1LNWA 5J47A 2LREA 1R00A 1N75A 2OD5A 1WJDA 3OL3A 1MH3A 1O57A 2FSWA 5FD6A 1KGSA 4I01A 3V8JA 2HYGD 2O03A 4HV5A 4I76A 3K70D 2QUFA 3LSJA 4Y4RA 3WTUC 2CG4A 4Q5SF 3FWEA 2XPUA 1FSEA 3K4CA 4A5MA 4OAYA 5E18F 2IGOA 4DBQA 3N97A 4M72A 2CFOA 5E1ZB 2L54A 2FEZA 3DPLC 4LLNA 4UNOA 1BR1A 2F6CA 2OCEA 4BHBA 1W1WE 4GXOA 2JTOA 3CP8A 3GTLJ 2C6YA 3FK7A 2X0LA 3FDYA 1LEBA 3U1DA 2VKEA 2UUZA 3I59A 2WV1A 3CMMA 1W5TA 5FKMA 1R1UA 3CLOA 5TRDA 1Z7LA 1VQ9I 3GWZA 3E6MA 2KJCA 2R7TA 2M1BA 4UHTA 3CMEI 2K40A 2VASA 2WY8Q 4N4OB 5FJ8J 2PMHA 2F4OB 3F3XA 2QYOA 2EV0A 3AG4H 2ICWG 4BJ6C 2NS0A 1OCCH 3H5RA 4CYCA 2R7WA 1XMAA 3GO5A 4CCOA 2LY1A 4NC6A 4XKWA 3HKZN 3PFIA 3E97A 5E8IA 2XRLA 1XDSA 2EIKH 3ZGKA 2FXAA 2R5ZB 3BR1A 1OJLA 1H88C 3HOWJ 1F1ZA 2VPRA 2Q1ZB 1WGXA 4FTHA 1ETQA 1SMYF 1NG6A 3SZPA 4LG3A 3SJMA 1R7JA 1MDMB 3S3MA 4PJJA 1FJLA 1SANA 1UCRA 5J6XA 1BA5A 1YX5A 5LEKA 1IN7A 4OIQF 3JAMZ 2Z99A 5F0HA 4LIVA 4HA8A 1W0TA 4XICA 1GUUA 3WG7H 3ZR8X 2LBFB 3DBHB 2HDCA 3C7JA 2EFNA 4QPQA 1QGPA 2MN3A 1BJAA 1R36A 3MWMA 3TGNA 3W3CA 2JZYA 5FRNA 2TDXA 5AIPA 3A1YA 2YR2A 3KP3A 2DO7A 1ENHA 2F2EA 2B7EA 2EV6A 1R1VA 1J2XA 3HHHA 1DPRA 2HTSA 2KKOA 2IS6A 3DU5A 4KT5C 1FY7A 4LD5A 2JPBA 3ML6A 2EA2A 3C2GA 3QYEA 4RM3A 4XOPA 5DDGA 4A3KJ 5FKKA 2LP0A 3ESWB 1U2WA 4IX7A 2JTVA 4YIIA 1EL6A 1TTYA 1TNSA 2LNBA 1UHWA 4G8XA 5AONA 2R5YB 2ESNA 3I4MJ 3WODF 4RGXA 4L5JA 4L9JA 2AQFA 1HSTA 3BR6A 2BBYA 3WTVC 2GIZA 3BQZA 1OR7C 2F4IA 4LITA 4ESJA 4JQFA 4EVIA 2RQPA 1S7AA 2HDDA 2HJEA 4J01A 2NS8A 2F5EA 2DA1A 1GVJA 1D1CA 2DMQA 2FNPA 3VFZA 2X48A 2E60A 3PUBA 3V7SA 2HZDA 3EYYA 1LKXA 4RGRA 2Y0SA 1ZGAA 1IUYA 2IGMA 4A3MJ 4GO1A 4AIDA 3BR3A 2QSGA 4XRSG 2Z1DA 3CESA 5FKLA 3B6CA 5D4SA 3MCZA 4OIOF 3ZRGA 1JUSA 4D5CA 4F93B 1X19A 3M07A 1YYVA 1GKUB 2CQ7A 3H9QA 3JRFA 2L02A 1ITYA 2CW8A 4ZJZA 3S2WA 4C9YA 2E35A 2ECCA 1LVAA 5A2QK 1B1BA 5CVRA 1B8WA 1Z9CA 1W7PA 4HEA2 5K7ZA 2GXBA 5J4VA 2L5QA 3F0CA 3SZGA 2P7VB 3AFHA 1BR2A 3HOXJ 4BQNA 3CC2I 2M4GA 4CO8A 3DPTA 4RM2A 5M5YJ 3ASNH 4XMYA 3UR3C 2PMUA 1IV8A 3K1PA 4IHWA 3L00A 5D8LB 3HBLA 3F8FA 1JJ8C 2V6CA 3FMSA 3L2RA 1MMNA 1RRJA 2OBPA 2FUG2 2V1XA 2R93J 2PX9A 1B9MA 4HBLA 2MLKA 2V9PA 2CQXA 2VJJA 3H3ZA 2CSOA 3G1OA 4EJUA 1A04A 3BTJA 1JGGA 3FIWA 1TC3C 1AWCA 1Z0XA 2ZMEB 3WTSC 3ELKA 4KIGA 2MYSA 4KICA 1MKMA 2OQRA 4FCYA 2K3FA 4KDPA 2BE5F 4HW0A 3T8TA 1K78B 2JA5J 3H36A 5HDKA 2CQQA 3PNTA 4XLHA 5DD4A 2VE9A 2DOAA 3BPVA 1CF7B 1FTTA 1SH1A 2GIVA 4X6AJ 4IHTA 2IBDA 4ETSA 3FISA 4ENKA 2LKXA 4HAMA 3HJEA 2LH9A 3DLLF 2BEOA 5JFRA 1XD7A 1L0OC 2VBZA 2QKMB 3CUOA 3LSTA 5H6RA 3NRVA 3LAPA 1B72A 1S7OA 4OU0A 3BZ6A 4ZDPA 3VOEA 1HW5A 4KITB 2K2XA 2F48A 1ZRFA 3GTOJ 2VOOA 3CDHA 4M3EA 2YUSA 4PGHA 2GQQA 3HXLA 2YS9A 3FXLA 4D7NA 5HNFA 3TL4X 1RETA 4HSRA 4HF1A 3C30A 3QPSA 3D1NI 1HBXG 1KU2A 2VKVA 4C3JJ 1DUXC 4CCLA 3LSGA 4GYGA 1D8KA 4A5NA 3HIFA 1JE8A 2M8EA 3GX4X 4CCJA 4KA4A 3EYIA 2HZTA 3KCCA 4BU2A 2HYJA 5J1RA 4NB5A 4FHTA 4JX4A 4A3DJ 1ETXA 3CF2A 1IXSB 1XX5A 3HOVJ 1SFEA 2IVMA 3CJQB 1YIOA 1USSA 2HGCA 3DKWA 1PYVA 1S7EA 3JRAA 1MSFC 1VQ6I 2CU7A 3IHUA 3V7RA 2Y2ZA 2M4KA 1IGNA 1GL9B 3R4KA 2DMNA 2CUJA 4IEJA 3D5RC 2Y9YA 1IDZA 2Y48A 2R0QC 5TGTA 3LQQA 2CV0A 1G6NA 4HX8A 2H8RA 2HFHA 4U87A 2NRAC 1KQ0A 3V8KA 4U88A 4W1UA 1R49A 3WU0A 3I4PA 3K4MA 1G59A 3E6CC 1WKMA 3PO2J 1K6OA 1UHMA 2ZC2A 5KCMA 2DBBA 4ZYEA 1ZRCA 3RKXA 1A6QA 3TOAA 5F0FA 3RQ4A 2STTA 1K4TA 1RIOH 4BXUA 3KETA 4NC7A 1CQTA 4A0YA 3H3UA 2RREA 2FA5A 2XAQA 3WG9A 3HOSA 4HV6A 4H0EA 3KP5A 3OOUA 3EQLF 2NVTJ 2EK5A 3KZIC 4DIQA 4Y7NJ 3DU6A 1TP4A 3TKYA 2IGNA 3ZQQA 2R7RA 3I4NJ 4CUGA 1TLHB 1W4MA 2X85A 1TWHJ 1ZG3A 2FOKA 3O3KA 1I3AA 2M87A 4ITVA 4XRFA 2ZNYA 3O2PE 1WPKA 2QQAA 2IT0A 1LE8B 1XSVA 3GF2A 4KT6A 2XGEA 4MGRA 5FD5A 2OPTA 4Q47A 3E3VA 4FQGA 4CICA 5ICCA 3J81Z 1X3UA 5FROA 3FMQA 3EDPA 1T98A 5BQTA 1FOXA 2HDWA 1SMTA 4IO9F 4WK8F 1YS7A 4A3IJ 2PLYA 2W48A 2L01A 4LK1F 1QRYA 2EFPA 2Y0MA 2QLZA 2WTEA 4DZPA 1WWXA 4BXXJ 1QPMA 2OZUA 2WBMA 3HGGA 3W6KB 1HDPA 2KIUA 3DKYA 1BW6A 3KP6A 4YFKF 3JR9A 2K9NA 2Y0SN 2QGUA 3CZ6A 1S6LA 3O8GA 2JN6A 2DYRH 3ZQ7A 1YJNI 2FE3A 1BJZA 4WXCA 1X2NA 1V54H 2MSYA 2K9MA 1D1BA 3OYLA 1ZH5A 3S16J 1WJFA 2DQLA 3QU6A 2A05A 2DTRA 1HCRA 3I9V2 4V2GA 1XCBA 5LLQA 1G3YA 3DLAA 1J7KA 2K86A 3IH2A 3P9CA 2X6YA 4MLOA 5TJJA 2ESHA 3RCOA 1IRGA 3MCXA 2A5YB 5AIQA 5EGOB 4RLFA 3L2CA 2FF4A 4IZZA 3UKGA 4EMSA 4IJAA 2K9LA 3ECOA 2CGPA 3IUOA 5CJ9A 4G6DA 3MQ0A 5HODA 1OCRH 1OYYA 3FX3A 1U78A 1I50J 1JHFA 3GVAA 4NBQA 2R3SA 1MMSA 3SYTA 2W7NA 1FT9A 3IH3A 4UUSA 3LAJA 2HVRA 2FMYA 2EZLA 3GFIA 1MGTA 2DI3A 1FEXA 2LR8A 1UELB 1P4AA 5GPCA 2D5VA 2ME0A 2NOJB 1H8AC 2E2HJ 4EQQA 2XRNA 1IZ1A 2JRMA 1SFUA 2A69F 5D5UB 3K70C 4DQ2A 4BACA 4MEYF 4BYYA 3GMEA 5DEQA 3BG3A 3GTKJ 1MIJA 4ZZLA 1X1AA 2KIQA 1P4XA 2IP2A 3S8PA 1P92A 3ZMSA 2DFEA 4ZZDA 1ZARA 1QVTA 2QA4I 4C2MJ 2DA3A 3GTPJ 3Q0UA 3K4LA 1MNMC 5CPRB 2XSDC 3JCUC 5CQGA 3G1LA 1VQ4I 2DCEA 2ZXWH 3B02A 1EKEA 3AG2H 4IQJA 4XQFA 2VBXA 4YIFA 3VYSB 3T8RA 1PUFB 1U5TC 2OUMA 1GXQA 3ABUA 2BYVE 3J7AO 1A5JA 1FNNA 5HDGA 1MJ9A 1G3WA 3W2WA 4L5EA 3TW6A 3JRIA 1DDNA 1XB4A 3ZMTA 5M5WJ 5IOYA 4F7ZA 3HTSB 2LDUA 2QBYB 1LEAA 4M71A 5KAFC 1QZEA 2R7SA 1OFCX 4C3HJ 5LHHA 1GXPA 3TO6A 2J5PA 1LDJA 5K1YA 1F5TA 3PM1A 4DYRA 5JLWA 2E5ZA 1IRFA 1BDSA 4CZZA 5IYDJ 2E2IJ 2V9KA 1JHHA 2O5RA 5HNHA 1EJ9A 4HDUA 2LF8A 4EM1A 3F21A 2PI0A 2MG4A 2DYSH 3G71I 3CF5F 3GXOA 2VONA 1XMXA 3BG5A 3Q5FA 3VDXA 5HLHA 1Z99A 3LMSB 1H9TA 3PO3J 5FFZA 3SDBA 2ZMEC 3LSRA 4BHPA 3BCBA 3LWFA 1FP2A 2HKOA 3BZKA 4OMYA 4YRVA 4CYDA 1OCPA 3H5NA 4I2OA 3IF4A 1G2HA 4RMNA 2O6GE 2ZCWA 4C2UA 2XSJC 2A07F 2AXLA 2ADUA 3DP7A 3SQNA 3I55I 4E7SA 1I1SA 1G8XA 3SEZA 5HS7A 4D9JA 2KT0A 1J75A 2EZHA 1XTAA 4E4HA 1OLTA 4YFXF 1TBXA 5IOZA 4M9SA 2P5LC 1LUJB 4D5FA 2QSFX 1O4XA 1ZGWA 3S17J 2XGCA 3E6BA 2JVGA 2MW8A 2O61A 3S93A 4KNYA 3DBRB 2AS5F 1E17A 3IH4A 4XIDA 2HJ9C 2IA2A 1P6RA 4MFEA 4XLFA 2DMTA 4Y3OA 5FB2A 2BVLA 4G6TB 2ID3A 3K6GA 3RJPA 3FXKA 3LSKA 3ZPLA 2DA2A 2XF7A 2XUBA 2H1KA 4UV8A 3HOTA 3DPUA 2R7ZJ 4RS8A 1RC9A 2R7VA 5C4XJ 4R1HA 4HF0A 1FX7A 1BN5A 1BM9A 4HSTA 4JBAA 4WXDA 2CW7A 5E20A 2IA0A 3M1EA 5F0CA 5LGTA 1VQ5I 1X58A 2XPWA 4I02A 4IHSA 2QEXI 2MD5A 1T2KA 3RDIA 5FLXK 5EEGA 1JT6A 2DK5A 1EH6A 1LQ1A 2XGXA 1O3TA 4UV9A 3ZMUA 2L4AA 1Z05A 3HOUJ 3U2RA 5FFXA 1I5ZA 5KNLA 2E19A 2JT1A 1E3PA 5CQEA 2M9HA 3J80K 2B63J 2K4BA 2X9DA 5B1BH 2IEKA 3SEQA 5J8CA 4BS9A 4WWCA 1FIAA 5L3EA 2P6SA 5BPIA 1T38A 4NQWB 4E7HA 4G7HF 2V1UA 1Z1DA 4B8XA 4E7JA 1ZREA 3IWFA 3S3OA 3SXYA 1FPQA 2D1HA 2JRTA 3M8JA 3SZTA 4S04A 3KYLA 5DTDA 1YS6A 2LY2A 3OIQA 4MNUA 5HLTA 3JW4A 1ZLJA 3TMOA 2IKEA 1AHLA 2E2JJ 2LMDA 3ZQIA 2HYFA 1OMIA 2WADA 1SVOA 2XIGA 4JX6A 1ON2A 3OYJA 1X1DA 5C4JJ 4GCVA 2G0EA 4OOIA 2A6EF 1Y8RB 3KE2A 4GRIA 1I39A 4LGWA 2EIMH 3MKWB 5F27A 5DYMA 3SFIA 1A36A 3FM5A 4CXFA 5H20A 3CDIA 4HYEA 1APFA 1LPQA 2H94A 2NS7A 3TBIA 4L18B 4YIRX 3H1CA 4FX0A 3TP3A 1HKSA 1U6GA 2Z33A 2Y30A 4PJNA 4LJZF 2L7FP 2F5FA 4D7MA 1RR8C 3OIOA 4II2A 2JQ7A 4Y52J 1TNTA 2V79A 1D0XA 1ZHHB 3PIOF 2CUEA 5DCFA 1YRNB 1FBUA 3QWLA 1FIPA 3QAHA 4A93J 2X4HA 3QRFF 2K3PA 5CKTA 1UB9A 3FZVA 1XGNA 2ISYA 4FASD 3L2WA 2UXXA 3LSMA 1QA6A 3RYRA 1O7LA 4NNJA 3PJRA 2Q2EA 3RIRA 5DUKA 1NK3P 1ZQ3P 3FK6A 5J4YA 5HVQC 2ZKZA 1Z7UA 4UUVA 2HXIA 5D6EA 2DTZA 3HG9A 4JOMA 2AO9A 3BQYA 4WX9A 1ETYA 2CYYA 4YELA 3MMYB 2DT5A 1G3TA 5F04A 3QP6A 1HW2A 2HQAA 1BL0A 1S29A 2R7OA 1R58A 2W57A 3DCFA 3I71A 4XKBA 4U7BA 2DLAA 4HQMA 1T8IA 5FKOA 2XXLA 4G7OF 2PJRA 1XSXA 1WQKA 2M3AA 4HNUA 2RV8A 1A31A 1X3ZB 3HRTA 1Z67A 2NOGA 3CUQA 1XS9A 4R8HA 1AHDP 1T6SA 4EM2A 3AKZA 3JRGA 3BOQA 1XGMA 1XGOA 5GTIC 2H09A 3A0BC 3HGYA 4CYCB 1W7PD 2K85A 2BW3A 2KRFA 3KFWX 2VJIA 4HX4A 1H9GA 2L4MA 3X2QH 4B3AA 3G73A 2JUGA 2AXTC 1Y1VJ 2QCOA 3N4MA 2QF7A 2UXNA 2E34A 3LQRA 1EF4A 4LLGF 1AKHA 2FJ1A 3S3NA 2L7MP 2QSFA 2BV6A 2KMUA 1VZ0A 3QYBA 2MGQA 1H0MA 3Q0WA 5FO5A 3CCLI 2FBIA 4M6XA 3I5UA 1RESA 4BE2A 3OYBA 1IXRC 2R7XA 2BY1A 4ZYHA 2HWVA 2DPDA 2JA8J 3W6JB 2RNJA 5ICGA 4CH7A 2HPMA 1MBFA 2KIFA 2MA3A 4A3EJ 2MH9A 1OCTC 1K83J 2CH0A 2PFBA 2M5WA 3PSIA 3P9KA 5E3LA 2GXAA 2CQKA 6PAXA 5FLXZ 3IRRA 3MZHA 2F5VA 4ZYAA 1V5EA 3PUFA 2VKDA 1UMQA 4HNVA 3HTUA 3H9JA 2FX0A 4PSXA 1HDDC 3LMMA 3LA7A 4RAYA 3AL0C 1DGWY 3PQJA 1ZLHB 2YSRA 1K61A 5E17F 1U5TB 1JKQC 1YX3A 5M5XJ 2CO5A 4Y13A 1IO2A 5DUIA 1TL8A 1SD6A 3WHCA 1HQCA 1K79A 5LD2C 2HOTA 2GOMA 4P5OA 2O9LA 1YQAA 2OTJI 1NHAA 3HHGA 1IN4A 4I0BA 3LSIA 4BUPA 3JSPA 4N9HA 1R4NB 1A35A 4QIWN 2M30A 3VYRB 1FLIA 3ISPA 1ZK8A 3QODA 2X51A 1SD5A 3VSKA 5EZGA 4HOBA 1YLFA 2DFFA 2MFZA 4BEHA 4BGDA 1OISA 2DA4A 2HQNA 1FWZA 3A02A 2HEOA 5GAEJ 3HOZJ 4KMFA 4L5IA 3DTEA 2M0CA 3F8CA 1AOYA 4Z6YA 2OQGA 2XKOA 2BVMA 3WTZA 4PUSA 3GFLA 3CCRI 2EH3A 5F6FA 1DP7P 1MMAA 3EETA 4RLQA 4IOAF 3KEYA 1AA7A 3WTWC 3BG7A 5EZHA 5H6QA 2NNYA 3BY6A 2KDZA 3GZ6A 3KYDB 3KPHA 3L7WA 1ETWA 1J09A 1T0FC 2ELHA 4L9NA 2VQLA 1NH3A 1P7JA 1W7PB 4EJVA 2ZSIB 1Q1HA 5EF6A 4RDUA 5EG0B 2Z9OA 1T95A 2HU9A 4HX7A 3BG9A 1QQIA 4M9ZA 3Q9SA 1MZBA 1XG1A 3CMAI 3PIPF 2ETHA 1Y0UA 2HTJA 2KJBA 4FE7A 1YW9A 5ED4A 4IRGA 1VFCA 3C1DA 4XL9A 4KIFA 2A68F 1MNDA 2YPRA 3JTGA 3SDGA 1V55H 2M0MA 2OCCH 2MLGA 3ASOH 2NVUB 5BPDA 2KQRA 2XF5A 2Z5UA 3BT9A 1W36D 1EH7A 1WCMJ 3RZDJ 2IS2A 5GP9A 2GLOA 4NUBA 2JK3A 1JGSA 3U1KA 1NG7A 2G9WA 2PG4A 3S1NJ 4A3CJ 2GZWA 1VQ7I 4V19K 1TWAJ 3C38A 1S9HA 3DWLE 1P7IA 4L0YB 1FBSA 2DFIA 4A6EA 2XAJA 3BTCA 4UVBA 2VB6A 2G7UA 3COAC 2GA2A 4AYBA 2W84A 3BDDA 5CVVA 2ZO4A 4EJTA 2R92J 1L3LA 4GDFA 2E1OA 4FISA 2Z3YA 4XKVA 5IT9K 1Y0NA 1ETOA 3A01B 1SFOJ 1RUOA 2EQRA 2FD5A 3TDZC 3FXMA 1ORKA 4IHYA 3G6EI 3F9KA 3F8NA 2HS5A 2OTLI 4XN0A 4Q4ZF 2IKDA 1B72B 1I6HJ 1Z6RA 3MKZA 1T08B 3ZMVA 1X2MA 1WI9A 2RKHA 3CP2A 3VYUB 1SC7A 2V26A 1KYZA 3D5SC 4HZFA 3HRMA 5HDNA 4AIJA 1TQIA 1WJAA 1PJRA 2JA6J 2X1DA 1S8NA 2VXDA 2IAIA 2MD0A 2UV1A 4U0WA 3MKLA 4B3XA 1ZKGA 1U8RA 5DM6F 1TQMA 1DGRM 2E36A 2KRCA 2B9SA 2LYCA 3CJNA 3CCYA 2DMUA 1QHGA 3Q9VA 1WSUA 5ILVA 2DFHA 3TEDA 3L9FA 1VQMI 1S3JA 3HPGA 3DXJF 1IDYA 3GW2A 4G6QA 3FXJA 1J9IA 1RZ4A 2W00A 3FF5A 4IVNA 4EJOA 4NC8A 5D5WB 3S2DJ 1UFMA 4J00A 2DN0A 1YFHA 1DP3A 4Z2YA 2J5OA 1VNDA 1YTYA 3HRUA 4JK1X 4MIMA 2KZVA 4MO7A 1GLNA 1TZLA 4FETA 1ZRDA 1GVDA 3LSPA 1YG2A 4XNFA 5A2QZ 4U7DA 3A03A 2EPFA 1XMKA 2FNAA 3ZQHA 1MW7A 4CHUA 3OYIA 3LFUA 5LRSA 3HRSA 1B9NA 3AG3H 4E70A 2KPMA 5L3CA 5FRMA 2XC7A 3HM5A 1VTNC 5L3GA 2HR3A 2WB1A 5GAGJ 3W2AA 5JHFA 5IP7J 2CV1A 1USTA 2W24A 3BZCA 3VODA 1VF9A 4EEFG 1WJCA 2BHZA 2H1LA 2PMZA 4ZDLA 3OYNA 5KVRA 2E1NA 5EJCA 1UHSA 4N9IA 4LB5A 4U0VA 1ZAOA 2MBFA 1YOVB 4CZCA 1Z3YA 4BNCA 3QPHA 4EATA 1UJ8A 3FKIJ 2QZ8A 4M9XA 1IF1A 3JRDA 3ZQFA 2R7QA 5BOXA 1TT0A 3I54A 2M34A 2DMPA 1ZR2A 3OSFA 2R7DA 1HF0A 2GA1A 3OMYA 3S32A 1IV6A 1T56A 3V7CA 1ZELA 3Q0VA 1VQKI 3ZCOA 2A6HF 1TWCJ 3KYCB 1JJ6C 3LFKA 2E5NA 2VQGA 4F52A 2FRHA 2KISA 1B4AA 1APLC 4BXFA 1D5YA 1BI3A 3OS0A 1IAWA 4I99C 4AVZA 4RAFA 4MQ9F 3TO9A 5LBQA 3GTJJ 1BOAA 1FMVA 2CRGA 1N78A 1LDKB 1MJBA 1OR7A 2DDAA 2CJJA 2QWWA 4QLCU 1E2XA 1WJBA 2YU9J 4IHVA 2WC2A 1JTYA 5LHGA 2JPCA 3PFYA 1YW8A 4EGYA 2V1DA 3CJRB 4XKCA 4PSWA 3F6VA 3WGHA 2ZSHB 4ZYGA 1B8IA 2VODA 4ZDOA 5F64A 4E7ZA 5B66C 5EDNA 4H4KC 3L09A 4IHXA 1SHIA 4BE0A 2LK2A 4ZTFA 2TCTA 3RPQA 5M3FJ 1EH8A 3FXRA 5B5EC 3QU3A 4E7LA 4A0ZA 3CCEI 3J7AY 3PNVA 2UZKA 2YX7A 3BWGA 3EUAA 4PDKA 4C3IJ 3IL2A 3CO6C 4G94A 1JKRC 4IKFA 4RBOA 2FMLA 4BAYA 1VQLI 2O0YA 2WWYA 3E0JB 4LK0F 2LRDA 1SFXA 5M3MJ 4A12A 2KP6A 5J1UA 2D2WA 4UUSB 2DT7B 3OR1C 3LA3A 3RPUD 4PJMA 5KAIC 4CA0A 1IN8A 5E3NA 3AL0B 1H5OA 4I98B 4UB6C 3K69A 3PQKA 3A4CA 1S5LC 4A3BJ 1UG2A 2Y9ZA 5DCMA 3MD2A 2ECBA 4ENJA 4KN4X 5HS8A 3DEUA 1WH5A 3EUHA 2DA7A 4V2FA 3PSFA 1Z77A 4A69C 4AYBN 1KU9A 2V6EA 2SH1A 3QYFA 2GXGA 3MFKA 1LFUP 4I6ZA 5JVTA 2I10A 2QQBA 3LNQA 1MBHA 5FGMA 2QSHX 5D8KB 4ENNA 4Y17A 2VI6A 2DU9A 2X1CA 2EFWA 2RQQA 3K9TA 1UG0A 3TO7A 1D3YA 1YIJI 4XOTA 3WTXC 1YJ9I 1RR7A 5IYCJ 2VQHA 4CCMA 3BP8A 3V4GA 4CDGA 1V5FA 2KRHA 1Y39A 2OA4A 4FT8A 3G4SI 1K6YA 5J8FA 1POGA 4ON0A 1MBEA 3OR2C 3M3YJ 1BR4A 2DAOA 3N05A 2ZXHA 4M3BA 4B1RA 2K27A 4KJZA 2NVXJ 3K2ZA 4XSZF 4O3MA 1FMWA 3MZYA 3I56I 1TWFJ 1U0JA 4LFUA 4PFPA 1XGSA 2V7FA 1D0ZA 1R71A 4GYIA 2VE8A 2QM3A 3OYDA 1GDTA 2IS4A 3H3VK 3HOYJ 3RPUA 3RI4A 5JLXA 3JAMK 4M3FA 4P55A 3IP4B 4AUXA 2K9QA 1R5ID 2KL4A 1W5CC 2EWNA 1BIAA 4XBFA 5L3DA 3D0SA 3S2HJ 1ZR4A 1O7FA 3F23A 3GYHX 3K4NA 4L9VA 5CVIA 4DZJA 4IRIA 3K10A 1KZHA 3K4BA 2FQ4A 3CDLA 4BQAA 1V4RA 1SEUA 4DYCA 4LG0A 1RPWA 1B6AA 1R5HA 1J5YA 3VSLA 4C30A 4LLLA 4BJ5C 3WTYC 1HW1A 2BXZA 1WJEA 2JVHA 4F92B 4F55A 3CC4I 2NYXA 2K02A 3I0TA 3P7NA 1ONVA 4UXNA 4W97A 1XSDA 1F4KA 3HSEA 2EJRA 1RNLA 3W2VA 1X1PA 2K9SA 3L2UA 3RKQA 1X3WB 2CUFA 5IP9J 1V5GA 2H6BA 4FE4A 4ZH4F 2UWMA 1WVRA 2P5VA 2WB1N 2M45A 5EEAA 4KFCA 4A3JJ 3ZQCA 2PMZN 4KN7X 2R7FA 1PUEE 3QOEA 4CCKA 2EA4A 5TISC 2MUBA 2TRTA 3FBNB 1Y6IA 4BJTA 4BY7J 1BC8C 3M4OJ 2ZFUA 3H92A 3K4KA 1WI3A 3KLNA 3RQIA 2QKLB 4YG2F 2X1EA 1H89C 2DOEA 1JUMA 1QNTA 2KHMA 1IUFA 3D4UB 2LG4A 2P81A 4ABZA 1Y1WJ 2PEXA 3LSHA 1KQ9A 3OWTA 2XAGA 4J19A 2Q8KA 3GLXA 4D1QA 1E0EA 1ZLIB 3TQNA 3LL7A 4EM0B 3B73A 3E7LA 4I7HA 4BH9A 1QZZA 2XASA 2FQ3A 4GGGA 2RDPA 2XPVA 1MD0A 3I58A 4A6DA 3C2HA 4KIBA 5CYVA 3JRCA 4BY1J 3OY9A 1ETKA 1F43A 3HSFA 3GTGJ 3HUGB 4M6YA 4LB6B 2VXZA 2VBYA 3E6DA 2P7CB 2CV2A 2XVCA 3FXUA 2R5ZA 3BG6A 3DTKA 4XORA 5E1WA 3FHNA 4KYWA 1OKRA 3FHZA 5HOOA 5L3BA 3S1RJ 3B6AA 2YX4A 4WF2A 1QZYA 2Y31A 4B48A 3BROA 1MDMA 4P1WA 3MYVA 1WXNA 1V3FA 3U21A 1R4MB 1MJAA 4AVPA 4XM3A 3VWBA 2JSPA 1LDDA 2XDVA 4OIRF 5F08A 3J7ZI 1W36C 4LMYA 1BC7C 2COMA 2HOEA 2LKPA 3CD6I 3NWTA 1ZHFA 3CCUI 1ZYRF 5F1RA 4A3LJ 1J0RA 2DPUA 4IRHA 2LBFA 4Q48A 1JKOC 1ERDA 1FC3A 2V1NA 3BR5A 1FYMA 2I5UA 2VJ5A 3QP5A 4HG2A 3ABKH 2E71A 2M2EA 2XKPA 4CCNA 2Z16A 2DJNA 3AG1H 4XSXF 2RAEA 2WY7Q 4HNTA 1P2FA 4QTRA 2R7UA 4KMUX 2HNHA 5FLVA 3WE3A 1ZTRA 3WGGA 2EFOA 5JI6A 4OAZA 3CCJI 2D45A 3RKWA 2D1VA 4OWRB 3WU2C 3I59B 2QSHA 1U9NA 4RB2C 3I3LA 2L3DA 3KP7A 2N8GA 4AU7A 1XPXA 4XLAA 4N4NB 1OCZH 3K2AA 2ID6A 1IW7F 3FKJA 4K2EA 1QO0D 1STZA 2IPQX 3A2KA 1TQPA 1W5SA 2DK8A 2E7XA 3GFJA 5GPAA 2R5YA 5JVGF 1RUNA 2BY0A 3F8MA 3U9GA 3HB9A 3OYHA 1PVEA 5ILSA 1LFPA 5DV5A 3OYMA 1YO5C 1D8JA 1WHUA 3DV8A 2NVQJ 2P5KA 1OYWA 1U3EM 1IN5A 3K4JA 3LA2A 4Y15A 4UY8I 4ESFA 3CO7C 2LD5A 3ZQLA 4GFBA 3Q3SA 2Q2EB 1FOKA 3OYKA 2VL8A 5K7FA 2Q0OA 1I6XA 5HLIA 1JKPC 3M8EA 3J7YJ 2VLAA 4XLPF 2ZXJA 1YE9A 1UZCA 1IG7A 3ZN0A 2R4GA 3E5XA 2NAZA 3A0HC 4CGZA 5ERIA 1VQOI 1ZGJA 1SFKA 1IXCA 1U5TA 3KEZA 2PQ8A 2RNGA 3DQVC 3I64A 2OV7A 2PJRB 4YEJA 3G3ZA 2V4JC 3DTIA 3KEOA 3SFZA 5GADJ 4HLXA 1LB2A 1C0WA 2CMPA 3KEQA 2HQ5A 3NEUA 2VPLA 3CUQB 2E1MB 1RI7A 3GFMA 2OU2A 4A3GJ 4NHJA 1OYIA 4IXAA 2E7WA 4OINF 3O8HA 3JREA 2BW3B 3J80Z 3H35A 1TWGJ 5C3EJ 3FM3A 1YI2I 2BY2A 3IKVA 1NK2P 5LFAA 3WGIA 2E1CA 3V42A 3QQAA 2I8DA 5J40A 1GV2A 2IGKA 1LFBA 2DA5A 1W0UA 2AHQA 2EZIA 1HLVA 1AKHB 1QPIA 1BI1A 2QVOA 2KZGA 3NQOA 3CTAA 4NDLA 4A3FJ 3S1MJ 2ZMEA 3BTIA 1E3OC 3H0DA 4S05A 1QU3A 2B9KA 3MAJA 1VI0A 5IPAA 3OYCA 1BOBA 5LEJA 1K78A 2XAHA 3KIOA 3J81K 2EBIA 2VUMJ 4I0AA 2IS1A 3CCQI 2WAFA 1X1BA 4E7KA 2JA7J 1CF7A 4XK4A 1EV7A 1D1AA 1YW7A 2VC1A 3K1MA 4II3A 2DDBA 3ZMDA 1QVUA 1G4DA 1U9OA 5E79C 2P6TA 5F1JA 1R5GA 2G7HA 3OS1A 4KUMA 3M7GA 5EG0A 3DEEA 3IRQA 3FXOA 4AIHA 4PJLA 2DW4A 2A6TA 4Y33A 3ROUA 1REPC 2DA6A 3SHFA 1HKTA 4BQQA 2VQCA 5GAHJ 2WAQA 4AIKA 2DXIA 1VQPI 1ZUFA 2LC2A 2ZNZA 2ME6A 3JRHA 1ULYA 3LOCA 1BI0A 4XRMA 1DU0A 3GTMJ 2EIJH 4BBRJ 2F5DA 2W25A 4XN3A 1MBJA 3EUHC 1XN7A 1F36A 4YIRA 3ABLH 3HZJA 2H6CA 1K4SA 2P8TA 1HSJA 2O7OA 3NARA 5B1AH 2VOPA 3R6SA 4LOCA 3UNGC 4B43A 2JJ7A 4C2TA 3V8LA 1KQ8A 3TOBA 4BEHB 5ICFA 1BW5A 5C44J 2EFQA 3K7AJ 2OZ6A 3T1BA 1R22A 2ZFWA 1D0YA 1FBQA 3ZXSA 1IJWC 4BKXA 4EJWA 1WRJA 1DQUA 3A01A 4BBSJ 1EA3A 2L9VA 1MSEC 2BZTA 2Y75A 3S14J 5FKNA 2LSOA 4PK4A 1LVKA 1R23A 1JTXA 1N77A 5K5OA 4IQ4A 2GWRA 1SVLA 1FYLA 3IAM2 4L9TA 1J59A 1XC5A 2P4WA 3CJTB 1TW2A 2VN2A 1BIBA 1AU7A 3OIPA 4S0HB 3BJOA 4RB3C 1FOWA 2XGDA 3BCAA 4E7IA 1GV5A 1O3SA 4MTEA 2F4MB 4G9YA 2DOFA 4XLEA 1HC8A 2K4JA 4ENMA 5L3FA 2X6OA 3DKXA 2K5CA 3BJ6A 3KP4A 3BJAA 2L0KA 1JXSA 4DW6A 3OOPA 3M9AA 2EINH 2XHKA 3ERMA 2LLKA 1WJ5A 4X1EA 2H9XA 3QPLA 3HPHA 2AQEA 1KU3A 3DEWA 2LY9A 1HKQA 1LJ9A 3OYEA 2JSCA 3ULQB 2RN7A 3MKYB 4MTDA 2OAZA 3S1QJ 2PJPA 1KYWA 4RB0A 4HF2A 3AAFA 2X6XA 2CQNA 1LE8A 4JX5A 2CW0F 1MBGA 3ZMZA 4XLNF 2CWEA 1NTCA 3ZN1A 1Z6TA 2IA1A 2VJ4A 4AC0A 3E5UA 3WTTC 3IAS2 4P96A 3RYPA 4X0GA 2FBKA 5J3LA 3R60A 2ZJRF 2A61A 1R1TA 3ERED 2BOLA 5K5RA 1Y56A 5E1XA 4HQEA 3FBIB 2WA0A 2BXYA 3BC8A 4QWQA 3TW7A 2W4SA 4F91B 5LGNA 3CMYA 4DJAA 3BPXA 3BLYA 2LVSA 2LTPA 3G2BA 5D5XB 2NXNB 4BDYA 3CCSI 2DT6A 3CC7I 3TP0A 2HVSA 2W1OA 3BTLA 3M1CA 3OV8A 3C18A 3RSNA 3D5LA 2RC4A 1FOYA 2MH2A 5DS9A 4M6VA 3ECHA 3C2BA 3CCVI 1X4OA 3REOA 4BL0B 2XAUA 3H9GA 3IWZA 1Z91A 1Q1VA 3K1NA 2KFDA 4A0XA 4OMZA 3JSOA 1WFXA 2EILH 2F5CA 3OYAA 5DM7F 5K7HA 5ICEA 4HLYA 4MHGA 1JI8A 3L2VA 1WZ2A 1IRZA 1MBKA 4DYQA 4BQOA 5EGOA 3L1PA 4BDZA 4DNCA 2XROA 4XLCA 3S15J 5IT3A 4PGGA 5IY5H 2XB5A 1O3QA 3CQZJ 4RAGA 4RGUA 3OYGA 1N25A 2COBA 3ZOBA 3P9IA 4PFOA 2HOSA 1FP1D 2HXOA 2IRFG 1ZN2A 1D5VA 4PZJA 1HXDA 4TV7A 1RKWA 2ZB9A 2YU3A 2V9VA 1F9NA 3FXQA 5EYRA 3TDUC 3E1SA 4P9FA 1BI2A 4AM3A 4N0BA 4B09A 2FU4A 1A6IA 4M3DA 1CGPA 4WXHA 3L2QA 4IOCF 2XB0X 1MNEA 1S72I 2LFBA 3OSGA 2JWTA 2KIMA 3ABTA 4D0PA 2RVCA 1OQYA 1R6RA 3GBGA 2VC0A 2ZXIA 4I09A 2Y69H 2QQ9A 3I53A 1IRXA 4LIUA 3IKTA 3RKYA 3DBLB 3ZQGA 2KDOA 4PJ0C 1PP8F 2O8XA 3ABMH 2HI3A 2DQRA 1UAAA 1M1EB 3EUKL 4CSWA 4OIPF 4ZYDA 3RTRA 4O5VA 2ELKA 5E3OA 1PUFA 2XV4S 2MC4A 1PDNC 2WAQN 4M3GA 3JRBA 5CLSA 2W85A 1MMGA 2CS3A 1JUPA 1KU7A 3R0JA 2ZJQF 3VB2A 2QBYA 5IYBJ 4AD9A 1YHQI 3GUDA 2VIXA 5E3MA 3CUQC 2E1MC 1O3RA 2IXSA 2NNNA 4ESBA 4XRSA 4KISA 2GM4A 1XCVA 3MZ8A 4UUTA 3F6OA 2L9NA 4L0ZB 2M8GX 4ZTJA 1HA8A 1HOMA 5K5QA 5BMZA 2H8WA 1XDUA 5LGUA 5IT9Z 3IV5A 3F72A 1PP7U 1ODDA 3RZOJ 4U0YA 2GAUA 4M73A 2OC6A 3QOPA 4B4CA 4ANJA 1Y8QB 1R9TJ 1JT0A 5JR3A 1VQNI 4QSHA 3HKZA 4F3QA 2OF7A 2FBHA 4HPQA 4P9UA 2DJIA 5E8GA 4JYKA 1IC8A 1KA8A 1FYKA 4G12A 1DPUA 2X6WA 5J1YA 9ANTA 1BBYA 3KLOA 4O6JA 3NWSA 5HS9A 4RAZA 2ZBKA 2BY3A 2GOXB 2M7AA 3KP2A 5EEHA 1WH7A 5LHIA 3W6VA 1B8IB 2ELJA
chains in the Genus database with same CATH topology
3BG6A 3DTKA 2MABA 2IGNA 4XORA 3ZQQA 2Z2SB 3FHNA 4XR6A 2R7RA 3VYRB 3QODA 2X51A 4CUGA 5HOOA 2VKHA 3VSKA 2X85A 2MFZA 3HC7A 4BEHA 4ITVA 4BGDA 1ATXA 4B48A 4P1WA 3MYVA 1WXNA 3U21A 4KT6A 3DTEA 4XM3A 3VWBA 2JSPA 5FROA 2BVMA 4DBRA 2XDVA 4PUSA 2HPIA 1W36C 3ONQA 2HDWA 3NWTA 1X1CA 1MMAA 4RLQA 1D6BA 2L2OA 3KEYA 1AA7A 3BG7A 3PL8A 2LBFA 2CUZA 1ERDA 2V1NA 1Z3XA 2WBMA 2VJ5A 4HG2A 5KHDA 4CCNA 2Z16A 1J09A 3OL4A 3DKYA 1T0FC 2HVQA 2VQLA 2KLOA 2WY7Q 3PNYA 2ZSIB 4HNTA 2R7UA 3CZ6A 2HNHA 1X4PA 2A5WA 3H5AA 4GV5A 2BDSA 1T95A 2HU9A 4OAZA 4OWRB 2QSHA 2XF6A 2K9MA 1D1BA 3I3LA 4BE1A 3OYLA 2ELJA 1WJFA 1P9QC 3VYTB 4XLAA 4AU7A 4XONA 4N4NB 3I9V2 3FKJA 4XL9A 3A2KA 3DLAA 1MNDA 2X6YA 4R79A 4MLOA 3OYFA 2M0MA 3RCOA 3MCXA 3OYHA 2KQRA 1LFPA 2XF5A 4RLFA 3OYMA 4IZZA 1W36D 2WAEA 2K9LA 3OS2A 2IS2A 4NUBA 1QHHD 3K4JA 1NG7A 1KONA 2M7BA 3IUOA 2Q2EB 1S9HA 3DWLE 3OYKA 3C38A 2VL8A 3LSIA 4ZC3A 3SYTA 2W7NA 2VB6A 2HVRA 2L9SA 2VLAA 2JA2A 4DOZA 1YE9A 1UELB 4AYBA 2R4GA 2NOJB 4XKVA 1SFKA 2LOOA 3KEZA 2RNGA 3DQVC 3K70C 4BACA 2OV7A 2PJRB 4YEJA 3F9KA 2V4JC 3DTIA 4QPOA 4E6KG 4XN0A 2IKDA 3KX2A 1X1AA 3MKZA 2CMPA 3S8PA 3CP2A 2VPLA 3VYUB 2E1MB 2V26A 1SAUA 3D5SC 1ZUEA 1WJAA 4HRIA 1PJRA 3K4LA 2X1DA 4B44A 2VXDA 2UV1A 2MD0A 5CPRB 2BW3B 4B3XA 2L7KA 3EPZA 3H35A 1DGRM 5CQGA 2JR3A 2DCEA 4IQJA 2KRCA 4XQFA 5LFAA 3VYSB 1Z21A 3V42A 2LYCA 4DGWB 1MMDA 2OUMA 3HL2A 2I8DA 1QHGA 2IGKA 2P0WA 2W82A 3W2WA 4B47A 3HPGA 2LREA 1N75A 1WJDA 3OL3A 2R7SA 2W00A 3H0DA 1QU3A 2B9KA 4NC8A 3K70D 3OYCA 4Y4RA 1BOBA 4J00A 3K4CA 4OAYA 2IS1A 1DP3A 2E5ZA 2IGOA 1BDSA 2WAFA 1X1BA 4DBQA 4E7KA 2CFOA 2V9KA 1D1AA 3DPLC 4II3A 2O5RA 2KZVA 5HNHA 1BR1A 2F6CA 3OS1A 2JTOA 1GLNA 1TZLA 3CP8A 4FETA 3DEEA 3FDYA 4PJLA 4XNFA 2UUZA 3CMMA 1MW7A 2A6TA 4Y33A 3LFUA 3OYIA 1Z7LA 3VDXA 1Z99A 3LMSB 2KPMA 4BQQA 2VQCA 3SDBA 5FRMA 2R7TA 2XC7A 2WAQA 3BCBA 2DXIA 2VASA 2WB1A 2WY8Q 1ZUFA 4N4OB 4YRVA 3W2AA 5JHFA 2LC2A 3H5NA 2CV1A 4BJ6C 1WJCA 2PMZA 3H5RA 4XN3A 4ZDLA 4RMNA 3OYNA 2R7WA 4CCOA 2LY1A 4C2UA 2XSJC 4XKWA 3EUHC 4YIRA 3ZGKA 4E7SA 4CZCA 1G8XA 3SEZA 1Z3YA 3UNGC 4B43A 4D9JA 4E4HA 1OLTA 2Q1ZB 4EATA 4C2TA 1NG6A 4BEHB 4LG3A 2R7QA 1TT0A 2JVGA 3S3MA 3S93A 1D0YA 4PJJA 3ZXSA 3OMYA 3S32A 2HJ9C 1YX5A 1DQUA 1ZELA 1EA3A 4XLFA 3ZCOA 4Y3OA 4LIVA 2BVLA 4G6TB 4PK4A 3K6GA 1LVKA 2E5NA 2VQGA 4F52A 1N77A 3LSKA 4IQ4A 3ZR8X 2LBFB 2XF7A 4BXFA 3IAM2 4QPQA 2MN3A 3HOTA 3DPUA 2R7VA 3OS0A 3W3CA 4AVZA 5FRNA 4HSTA 1FMVA 3A1YA 3OIPA 2CW7A 1N78A 1LDKB 3BCAA 4E7IA 4XLEA 1WJBA 2IS6A 3DU5A 3DKXA 2K5CA 3PFYA 4RM3A 3C2GA 3QYEA 4XOPA 4IX7A 5KNLA 3CJRB 1WJ5A 5CQEA 4XKCA 2H9XA 4PSWA 3HPHA 3SEQA 4BS9A 2AQEA 2ZSHB 4ZDOA 3OYEA 4E7ZA 3MKYB 4NQWB 2AQFA 4H4KC 4E7HA 4E7JA 1SHIA 4BE0A 4ZTFA 3S3OA 3M8JA 2X6XA 4E7LA 3J7AY 1OR7C 2F4IA 3PNVA 4LITA 3KYLA 4JQFA 3EUAA 2HJEA 2LY2A 4J01A 3OIQA 4IKFA 5HLTA 1D1CA 3TMOA 2IKEA 2E60A 3PUBA 2VJ4A 1AHLA 3E0JB 2HZDA 2LRDA 3IAS2 4X0GA 2KP6A 1LKXA 2DT7B 3OR1C 2WADA 2Y0SA 2BOLA 2IGMA 3OYJA 1X1DA 1Y56A 4PJMA 3RPUD 3FBIB 4CA0A 3AL0B 2WA0A 2Z1DA 3CESA 2QSGA 1H5OA 3ZRGA 3BC8A 3A4CA 4GRIA 2W4SA 4F91B 4F93B 1X19A 4DJAA 3H9QA 3BLYA 3MKWB 3MD2A 3G2BA 2CW8A 4ZJZA 4C9YA 4BDYA 1B8WA 2DT6A 4HEA2 2HVSA 2L5QA 2W1OA 3M1CA 3RSNA 1APFA 3SZGA 3PSFA 3D5LA 2V6EA 2SH1A 3AFHA 3QYFA 3TBIA 1BR2A 4BQNA 2M4GA 1X4OA 3DPTA 4RM2A 4BL0B 2XAUA 4XMYA 3UR3C 4PJNA 3H9GA 2X1CA 2RQQA 1UG0A 1WFXA 4XOTA 4II2A 3OYAA 2VQHA 4CCMA 1JI8A 3L2VA 1V5FA 1D0XA 1MMNA 2KRHA 3L2RA 4BQOA 1ZHHB 2FUG2 1K6YA 4BDZA 4XLCA 3OR2C 1BR4A 2VJJA 3N05A 2ZXHA 4KJZA 2K3PA 5CKTA 4FASD 3L2WA 3LSMA 2MYSA 1FMWA 3PJRA 4NNJA 3OYGA 1U0JA 4PFPA 4PFOA 2V7FA 1D0ZA 3OYDA 2IS4A 5HVQC 3PNTA 4XLHA 2DOAA 3IP4B 1SH1A 3HG9A 4JOMA 2KL4A 4YELA 3MMYB 3E1SA 2HQAA 3K4NA 2R7OA 2DLAA 2LH9A 3K10A 4XKBA 4U7BA 3K4BA 3L2QA 2XXLA 2PJRA 2QKMB 1MNEA 1WQKA 2M3AA 4BUPA 4HNUA 4ZDPA 1R6RA 3GBGA 2ZXIA 2K2XA 4KITB 4LIUA 1IRXA 4C30A 3VSLA 4BJ5C 3AKZA 4F92B 1WJEA 2JVHA 2KDOA 4F55A 3HXLA 5HNFA 3TL4X 4HSRA 2BW3A 3C30A 1UAAA 2VJIA 3EUKL 4CSWA 4CCLA 3W2VA 3LSGA 2JUGA 3L2UA 3RTRA 1V5GA 2UWMA 2MC4A 4CCJA 1MMGA 4BU2A 2CS3A 3CF2A 3S3NA 3CJQB 3QOEA 4CCKA 2QSFA 1PYVA 2KMUA 2VIXA 1VZ0A 3QYBA 2MUBA 2E1MC 2IXSA 1Y6IA 3FBNB 4BJTA 2M4KA 2ZFUA 3OYBA 4BE2A 4KISA 3K4KA 2CUJA 2QKLB 2R7XA 2X1EA 3D5RC 2L9NA 4ZTJA 1HA8A 4CH7A 2KHMA 2HPMA 5TGTA 2LG4A 3D4UB 2CV0A 2CH0A 3PSIA 3LSHA 3OWTA 2F5VA 4ZYAA 4D1QA 1V5EA 4U87A 2OC6A 2VKDA 1E0EA 1ZLIB 4ANJA 1G59A 3K4MA 3H9JA 3LL7A 3HKZA 4F3QA 4PSXA 3LMMA 4HPQA 3AL0C 1DGWY 5KCMA 1ZLHB 2DJIA 1YX3A 3RQ4A 2X6WA 4NC7A 3C2HA 2RREA 3OY9A 3NWSA 3HOSA 3OOUA 5LD2C 2GOMA 2GOXB 2M7AA 3HUGB 4P5OA 2VXZA 4DIQA 2CV2A 3DU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MN3 A;  1Z99 A;  2K2X A;  3LMS B;  1H5O A;  1ZUE A;  2MUB A;  1ZLH B;  1ZUF A;  1ATX A;  1SHI A;  1SH1 A;  1BDS A;  1WXN A;  2RNG A;  1B8W A;  4GV5 A;  1APF A;  2JTO A;  2BDS A;  3D4U B;  2SH1 A;  1AHL A;  1WQK A;  1D6B A;  1ZLI B;  2H9X A; 
#chains in the Genus database with same CATH topology
 2CFX A;  5BNG A;  2MAB A;  5D6F A;  3E5Q A;  2Z2S B;  3VEP A;  3P5J A;  4XR6 A;  5GTH C;  3G1M A;  1T0F A;  2HQR A;  2MC3 A;  2VKH A;  2IW5 A;  4MQV A;  3HC7 A;  2ISZ A;  1ATX A;  2DOD A;  4AWX B;  1U8B A;  5KK1 A;  1FSH A;  2LF7 A;  3H0G J;  1FTZ A;  4UVC A;  5CVU A;  5ILU A;  3HDD A;  1I27 A;  4DBR A;  2VBW A;  2HPI A;  3ONQ A;  1QBJ A;  3VPR A;  4YFN F;  1ZLK A;  1X1C A;  1D6B A;  2L2O A;  4IL6 C;  4JP0 A;  2VT2 A;  3K0L A;  3PL8 A;  2NVY J;  2CUZ A;  2EB7 A;  2RGV A;  1Z3X A;  2A3S A;  5KHD A;  2XAF A;  3R61 A;  1SD7 A;  5DCM B;  3OL4 A;  5CVJ A;  2HVQ A;  4MEX F;  3HEF A;  2KLO A;  2H27 A;  3PNY A;  2HOA A;  3FMR A;  1OPC A;  3F8B A;  2QEN A;  1X4P A;  2A5W A;  2B0L A;  2VT3 A;  3H5A A;  4GV5 A;  3T5X A;  4UB8 C;  4RGS A;  4EV0 A;  3M8F A;  1ZG5 A;  2BDS A;  3MEX A;  2ACJ A;  2XF6 A;  5D4R A;  1I1G A;  3IC7 A;  4BE1 A;  1ACI A;  3NAU A;  2ZJP F;  3GTQ J;  4A2U A;  1P9Q C;  3VYT B;  4XON A;  2EV5 A;  3HYI A;  1SVM A;  5JHU A;  1YIT I;  1K7A A;  3GZ5 A;  5D5V B;  3GCM A;  4R79 A;  5DD8 A;  3C3W A;  3OYF A;  3GEZ A;  1SD4 A;  1WQ2 A;  5LRR A;  4NQW A;  4EGZ A;  2WAE A;  3OS2 A;  2JUC A;  1QHH D;  5IP6 A;  3CCM I;  3GZN B;  1KON A;  2BGC A;  2M7B A;  3KZZ A;  1T39 A;  4RB1 A;  3CLQ A;  3QPT A;  1TT5 B;  2L7Z A;  4IF4 A;  3JTH A;  1GHC A;  4ZC3 A;  1YJW I;  1TW3 A;  2STW A;  4RA2 A;  2L9S A;  2HKX A;  2JA2 A;  1B59 A;  3BR2 A;  4DOZ A;  2QSG X;  1ZG1 A;  1MH4 A;  3WHB A;  2BHY A;  5HLG A;  1FZP B;  1RKT A;  4MFD A;  2LOO A;  2PBI A;  3GLL A;  1OCO H;  5B3S H;  4FX4 A;  2FOW A;  2PN6 A;  1P4W A;  4WCG A;  4G7Z F;  3WU1 B;  1VQ8 I;  1I3Q J;  4QPO A;  1SAX A;  1GT0 C;  3MVP A;  4E6K G;  3KX2 A;  2LKS A;  3HUG A;  3MN2 A;  2EZK A;  4LG0 B;  1DU6 A;  5BS6 A;  1SAU A;  2K7L A;  2QQ8 A;  2ZJ2 A;  4ASN A;  1T33 A;  1ZUE A;  4HRI A;  3R0A A;  4B44 A;  2GBY A;  4PCQ A;  5FLM J;  2OJE D;  2L9R A;  2JMW A;  2L7K A;  3EPZ A;  4HDV A;  3ZP5 A;  3DFG A;  1ETV A;  2DLL A;  2WV0 A;  4BHC A;  3BR0 A;  3WE2 A;  1ON1 A;  3T0Y A;  2JR3 A;  1E3H A;  4M74 A;  3F22 A;  2IJL A;  5H2F C;  1Z21 A;  4DGW B;  1MMD A;  2O3F A;  3HL2 A;  1IN6 A;  4IPA A;  2P0W A;  2W82 A;  1YRN A;  4UVA A;  1G3S A;  3O6B B;  4B47 A;  3DF8 A;  3KZY A;  2O8K A;  3HSR A;  1LNW A;  5J47 A;  2LRE A;  1R00 A;  1N75 A;  2OD5 A;  1WJD A;  3OL3 A;  1MH3 A;  1O57 A;  2FSW A;  5FD6 A;  1KGS A;  4I01 A;  3V8J A;  2HYG D;  2O03 A;  4HV5 A;  4I76 A;  3K70 D;  2QUF A;  3LSJ A;  4Y4R A;  3WTU C;  2CG4 A;  4Q5S F;  3FWE A;  2XPU A;  1FSE A;  3K4C A;  4A5M A;  4OAY A;  5E18 F;  2IGO A;  4DBQ A;  3N97 A;  4M72 A;  2CFO A;  5E1Z B;  2L54 A;  2FEZ A;  3DPL C;  4LLN A;  4UNO A;  1BR1 A;  2F6C A;  2OCE A;  4BHB A;  1W1W E;  4GXO A;  2JTO A;  3CP8 A;  3GTL J;  2C6Y A;  3FK7 A;  2X0L A;  3FDY A;  1LEB A;  3U1D A;  2VKE A;  2UUZ A;  3I59 A;  2WV1 A;  3CMM A;  1W5T A;  5FKM A;  1R1U A;  3CLO A;  5TRD A;  1Z7L A;  1VQ9 I;  3GWZ A;  3E6M A;  2KJC A;  2R7T A;  2M1B A;  4UHT A;  3CME I;  2K40 A;  2VAS A;  2WY8 Q;  4N4O B;  5FJ8 J;  2PMH A;  2F4O B;  3F3X A;  2QYO A;  2EV0 A;  3AG4 H;  2ICW G;  4BJ6 C;  2NS0 A;  1OCC H;  3H5R A;  4CYC A;  2R7W A;  1XMA A;  3GO5 A;  4CCO A;  2LY1 A;  4NC6 A;  4XKW A;  3HKZ N;  3PFI A;  3E97 A;  5E8I A;  2XRL A;  1XDS A;  2EIK H;  3ZGK A;  2FXA A;  2R5Z B;  3BR1 A;  1OJL A;  1H88 C;  3HOW J;  1F1Z A;  2VPR A;  2Q1Z B;  1WGX A;  4FTH A;  1ETQ A;  1SMY F;  1NG6 A;  3SZP A;  4LG3 A;  3SJM A;  1R7J A;  1MDM B;  3S3M A;  4PJJ A;  1FJL A;  1SAN A;  1UCR A;  5J6X A;  1BA5 A;  1YX5 A;  5LEK A;  1IN7 A;  4OIQ F;  3JAM Z;  2Z99 A;  5F0H A;  4LIV A;  4HA8 A;  1W0T A;  4XIC A;  1GUU A;  3WG7 H;  3ZR8 X;  2LBF B;  3DBH B;  2HDC A;  3C7J A;  2EFN A;  4QPQ A;  1QGP A;  2MN3 A;  1BJA A;  1R36 A;  3MWM A;  3TGN A;  3W3C A;  2JZY A;  5FRN A;  2TDX A;  5AIP A;  3A1Y A;  2YR2 A;  3KP3 A;  2DO7 A;  1ENH A;  2F2E A;  2B7E A;  2EV6 A;  1R1V A;  1J2X A;  3HHH A;  1DPR A;  2HTS A;  2KKO A;  2IS6 A;  3DU5 A;  4KT5 C;  1FY7 A;  4LD5 A;  2JPB A;  3ML6 A;  2EA2 A;  3C2G A;  3QYE A;  4RM3 A;  4XOP A;  5DDG A;  4A3K J;  5FKK A;  2LP0 A;  3ESW B;  1U2W A;  4IX7 A;  2JTV A;  4YII A;  1EL6 A;  1TTY A;  1TNS A;  2LNB A;  1UHW A;  4G8X A;  5AON A;  2R5Y B;  2ESN A;  3I4M J;  3WOD F;  4RGX A;  4L5J A;  4L9J A;  2AQF A;  1HST A;  3BR6 A;  2BBY A;  3WTV C;  2GIZ A;  3BQZ A;  1OR7 C;  2F4I A;  4LIT A;  4ESJ A;  4JQF A;  4EVI A;  2RQP A;  1S7A A;  2HDD A;  2HJE A;  4J01 A;  2NS8 A;  2F5E A;  2DA1 A;  1GVJ A;  1D1C A;  2DMQ A;  2FNP A;  3VFZ A;  2X48 A;  2E60 A;  3PUB A;  3V7S A;  2HZD A;  3EYY A;  1LKX A;  4RGR A;  2Y0S A;  1ZGA A;  1IUY A;  2IGM A;  4A3M J;  4GO1 A;  4AID A;  3BR3 A;  2QSG A;  4XRS G;  2Z1D A;  3CES A;  5FKL A;  3B6C A;  5D4S A;  3MCZ A;  4OIO F;  3ZRG A;  1JUS A;  4D5C A;  4F93 B;  1X19 A;  3M07 A;  1YYV A;  1GKU B;  2CQ7 A;  3H9Q A;  3JRF A;  2L02 A;  1ITY A;  2CW8 A;  4ZJZ A;  3S2W A;  4C9Y A;  2E35 A;  2ECC A;  1LVA A;  5A2Q K;  1B1B A;  5CVR A;  1B8W A;  1Z9C A;  1W7P A;  4HEA 2;  5K7Z A;  2GXB A;  5J4V A;  2L5Q A;  3F0C A;  3SZG A;  2P7V B;  3AFH A;  1BR2 A;  3HOX J;  4BQN A;  3CC2 I;  2M4G A;  4CO8 A;  3DPT A;  4RM2 A;  5M5Y J;  3ASN H;  4XMY A;  3UR3 C;  2PMU A;  1IV8 A;  3K1P A;  4IHW A;  3L00 A;  5D8L B;  3HBL A;  3F8F A;  1JJ8 C;  2V6C A;  3FMS A;  3L2R A;  1MMN A;  1RRJ A;  2OBP A;  2FUG 2;  2V1X A;  2R93 J;  2PX9 A;  1B9M A;  4HBL A;  2MLK A;  2V9P A;  2CQX A;  2VJJ A;  3H3Z A;  2CSO A;  3G1O A;  4EJU A;  1A04 A;  3BTJ A;  1JGG A;  3FIW A;  1TC3 C;  1AWC A;  1Z0X A;  2ZME B;  3WTS C;  3ELK A;  4KIG A;  2MYS A;  4KIC A;  1MKM A;  2OQR A;  4FCY A;  2K3F A;  4KDP A;  2BE5 F;  4HW0 A;  3T8T A;  1K78 B;  2JA5 J;  3H36 A;  5HDK A;  2CQQ A;  3PNT A;  4XLH A;  5DD4 A;  2VE9 A;  2DOA A;  3BPV A;  1CF7 B;  1FTT A;  1SH1 A;  2GIV A;  4X6A J;  4IHT A;  2IBD A;  4ETS A;  3FIS A;  4ENK A;  2LKX A;  4HAM A;  3HJE A;  2LH9 A;  3DLL F;  2BEO A;  5JFR A;  1XD7 A;  1L0O C;  2VBZ A;  2QKM B;  3CUO A;  3LST A;  5H6R A;  3NRV A;  3LAP A;  1B72 A;  1S7O A;  4OU0 A;  3BZ6 A;  4ZDP A;  3VOE A;  1HW5 A;  4KIT B;  2K2X A;  2F48 A;  1ZRF A;  3GTO J;  2VOO A;  3CDH A;  4M3E A;  2YUS A;  4PGH A;  2GQQ A;  3HXL A;  2YS9 A;  3FXL A;  4D7N A;  5HNF A;  3TL4 X;  1RET A;  4HSR A;  4HF1 A;  3C30 A;  3QPS A;  3D1N I;  1HBX G;  1KU2 A;  2VKV A;  4C3J J;  1DUX C;  4CCL A;  3LSG A;  4GYG A;  1D8K A;  4A5N A;  3HIF A;  1JE8 A;  2M8E A;  3GX4 X;  4CCJ A;  4KA4 A;  3EYI A;  2HZT A;  3KCC A;  4BU2 A;  2HYJ A;  5J1R A;  4NB5 A;  4FHT A;  4JX4 A;  4A3D J;  1ETX A;  3CF2 A;  1IXS B;  1XX5 A;  3HOV J;  1SFE A;  2IVM A;  3CJQ B;  1YIO A;  1USS A;  2HGC A;  3DKW A;  1PYV A;  1S7E A;  3JRA A;  1MSF C;  1VQ6 I;  2CU7 A;  3IHU A;  3V7R A;  2Y2Z A;  2M4K A;  1IGN A;  1GL9 B;  3R4K A;  2DMN A;  2CUJ A;  4IEJ A;  3D5R C;  2Y9Y A;  1IDZ A;  2Y48 A;  2R0Q C;  5TGT A;  3LQQ A;  2CV0 A;  1G6N A;  4HX8 A;  2H8R A;  2HFH A;  4U87 A;  2NRA C;  1KQ0 A;  3V8K A;  4U88 A;  4W1U A;  1R49 A;  3WU0 A;  3I4P A;  3K4M A;  1G59 A;  3E6C C;  1WKM A;  3PO2 J;  1K6O A;  1UHM A;  2ZC2 A;  5KCM A;  2DBB A;  4ZYE A;  1ZRC A;  3RKX A;  1A6Q A;  3TOA A;  5F0F A;  3RQ4 A;  2STT A;  1K4T A;  1RIO H;  4BXU A;  3KET A;  4NC7 A;  1CQT A;  4A0Y A;  3H3U A;  2RRE A;  2FA5 A;  2XAQ A;  3WG9 A;  3HOS A;  4HV6 A;  4H0E A;  3KP5 A;  3OOU A;  3EQL F;  2NVT J;  2EK5 A;  3KZI C;  4DIQ A;  4Y7N J;  3DU6 A;  1TP4 A;  3TKY A;  2IGN A;  3ZQQ A;  2R7R A;  3I4N J;  4CUG A;  1TLH B;  1W4M A;  2X85 A;  1TWH J;  1ZG3 A;  2FOK A;  3O3K A;  1I3A A;  2M87 A;  4ITV A;  4XRF A;  2ZNY A;  3O2P E;  1WPK A;  2QQA A;  2IT0 A;  1LE8 B;  1XSV A;  3GF2 A;  4KT6 A;  2XGE A;  4MGR A;  5FD5 A;  2OPT A;  4Q47 A;  3E3V A;  4FQG A;  4CIC A;  5ICC A;  3J81 Z;  1X3U A;  5FRO A;  3FMQ A;  3EDP A;  1T98 A;  5BQT A;  1FOX A;  2HDW A;  1SMT A;  4IO9 F;  4WK8 F;  1YS7 A;  4A3I J;  2PLY A;  2W48 A;  2L01 A;  4LK1 F;  1QRY A;  2EFP A;  2Y0M A;  2QLZ A;  2WTE A;  4DZP A;  1WWX A;  4BXX J;  1QPM A;  2OZU A;  2WBM A;  3HGG A;  3W6K B;  1HDP A;  2KIU A;  3DKY A;  1BW6 A;  3KP6 A;  4YFK F;  3JR9 A;  2K9N A;  2Y0S N;  2QGU A;  3CZ6 A;  1S6L A;  3O8G A;  2JN6 A;  2DYR H;  3ZQ7 A;  1YJN I;  2FE3 A;  1BJZ A;  4WXC A;  1X2N A;  1V54 H;  2MSY A;  2K9M A;  1D1B A;  3OYL A;  1ZH5 A;  3S16 J;  1WJF A;  2DQL A;  3QU6 A;  2A05 A;  2DTR A;  1HCR A;  3I9V 2;  4V2G A;  1XCB A;  5LLQ A;  1G3Y A;  3DLA A;  1J7K A;  2K86 A;  3IH2 A;  3P9C A;  2X6Y A;  4MLO A;  5TJJ A;  2ESH A;  3RCO A;  1IRG A;  3MCX A;  2A5Y B;  5AIQ A;  5EGO B;  4RLF A;  3L2C A;  2FF4 A;  4IZZ A;  3UKG A;  4EMS A;  4IJA A;  2K9L A;  3ECO A;  2CGP A;  3IUO A;  5CJ9 A;  4G6D A;  3MQ0 A;  5HOD A;  1OCR H;  1OYY A;  3FX3 A;  1U78 A;  1I50 J;  1JHF A;  3GVA A;  4NBQ A;  2R3S A;  1MMS A;  3SYT A;  2W7N A;  1FT9 A;  3IH3 A;  4UUS A;  3LAJ A;  2HVR A;  2FMY A;  2EZL A;  3GFI A;  1MGT A;  2DI3 A;  1FEX A;  2LR8 A;  1UEL B;  1P4A A;  5GPC A;  2D5V A;  2ME0 A;  2NOJ B;  1H8A C;  2E2H J;  4EQQ A;  2XRN A;  1IZ1 A;  2JRM A;  1SFU A;  2A69 F;  5D5U B;  3K70 C;  4DQ2 A;  4BAC A;  4MEY F;  4BYY A;  3GME A;  5DEQ A;  3BG3 A;  3GTK J;  1MIJ A;  4ZZL A;  1X1A A;  2KIQ A;  1P4X A;  2IP2 A;  3S8P A;  1P92 A;  3ZMS A;  2DFE A;  4ZZD A;  1ZAR A;  1QVT A;  2QA4 I;  4C2M J;  2DA3 A;  3GTP J;  3Q0U A;  3K4L A;  1MNM C;  5CPR B;  2XSD C;  3JCU C;  5CQG A;  3G1L A;  1VQ4 I;  2DCE A;  2ZXW H;  3B02 A;  1EKE A;  3AG2 H;  4IQJ A;  4XQF A;  2VBX A;  4YIF A;  3VYS B;  3T8R A;  1PUF B;  1U5T C;  2OUM A;  1GXQ A;  3ABU A;  2BYV E;  3J7A O;  1A5J A;  1FNN A;  5HDG A;  1MJ9 A;  1G3W A;  3W2W A;  4L5E A;  3TW6 A;  3JRI A;  1DDN A;  1XB4 A;  3ZMT A;  5M5W J;  5IOY A;  4F7Z A;  3HTS B;  2LDU A;  2QBY B;  1LEA A;  4M71 A;  5KAF C;  1QZE A;  2R7S A;  1OFC X;  4C3H J;  5LHH A;  1GXP A;  3TO6 A;  2J5P A;  1LDJ A;  5K1Y A;  1F5T A;  3PM1 A;  4DYR A;  5JLW A;  2E5Z A;  1IRF A;  1BDS A;  4CZZ A;  5IYD J;  2E2I J;  2V9K A;  1JHH A;  2O5R A;  5HNH A;  1EJ9 A;  4HDU A;  2LF8 A;  4EM1 A;  3F21 A;  2PI0 A;  2MG4 A;  2DYS H;  3G71 I;  3CF5 F;  3GXO A;  2VON A;  1XMX A;  3BG5 A;  3Q5F A;  3VDX A;  5HLH A;  1Z99 A;  3LMS B;  1H9T A;  3PO3 J;  5FFZ A;  3SDB A;  2ZME C;  3LSR A;  4BHP A;  3BCB A;  3LWF A;  1FP2 A;  2HKO A;  3BZK A;  4OMY A;  4YRV A;  4CYD A;  1OCP A;  3H5N A;  4I2O A;  3IF4 A;  1G2H A;  4RMN A;  2O6G E;  2ZCW A;  4C2U A;  2XSJ C;  2A07 F;  2AXL A;  2ADU A;  3DP7 A;  3SQN A;  3I55 I;  4E7S A;  1I1S A;  1G8X A;  3SEZ A;  5HS7 A;  4D9J A;  2KT0 A;  1J75 A;  2EZH A;  1XTA A;  4E4H A;  1OLT A;  4YFX F;  1TBX A;  5IOZ A;  4M9S A;  2P5L C;  1LUJ B;  4D5F A;  2QSF X;  1O4X A;  1ZGW A;  3S17 J;  2XGC A;  3E6B A;  2JVG A;  2MW8 A;  2O61 A;  3S93 A;  4KNY A;  3DBR B;  2AS5 F;  1E17 A;  3IH4 A;  4XID A;  2HJ9 C;  2IA2 A;  1P6R A;  4MFE A;  4XLF A;  2DMT A;  4Y3O A;  5FB2 A;  2BVL A;  4G6T B;  2ID3 A;  3K6G A;  3RJP A;  3FXK A;  3LSK A;  3ZPL A;  2DA2 A;  2XF7 A;  2XUB A;  2H1K A;  4UV8 A;  3HOT A;  3DPU A;  2R7Z J;  4RS8 A;  1RC9 A;  2R7V A;  5C4X J;  4R1H A;  4HF0 A;  1FX7 A;  1BN5 A;  1BM9 A;  4HST A;  4JBA A;  4WXD A;  2CW7 A;  5E20 A;  2IA0 A;  3M1E A;  5F0C A;  5LGT A;  1VQ5 I;  1X58 A;  2XPW A;  4I02 A;  4IHS A;  2QEX I;  2MD5 A;  1T2K A;  3RDI A;  5FLX K;  5EEG A;  1JT6 A;  2DK5 A;  1EH6 A;  1LQ1 A;  2XGX A;  1O3T A;  4UV9 A;  3ZMU A;  2L4A A;  1Z05 A;  3HOU J;  3U2R A;  5FFX A;  1I5Z A;  5KNL A;  2E19 A;  2JT1 A;  1E3P A;  5CQE A;  2M9H A;  3J80 K;  2B63 J;  2K4B A;  2X9D A;  5B1B H;  2IEK A;  3SEQ A;  5J8C A;  4BS9 A;  4WWC A;  1FIA A;  5L3E A;  2P6S A;  5BPI A;  1T38 A;  4NQW B;  4E7H A;  4G7H F;  2V1U A;  1Z1D A;  4B8X A;  4E7J A;  1ZRE A;  3IWF A;  3S3O A;  3SXY A;  1FPQ A;  2D1H A;  2JRT A;  3M8J A;  3SZT A;  4S04 A;  3KYL A;  5DTD A;  1YS6 A;  2LY2 A;  3OIQ A;  4MNU A;  5HLT A;  3JW4 A;  1ZLJ A;  3TMO A;  2IKE A;  1AHL A;  2E2J J;  2LMD A;  3ZQI A;  2HYF A;  1OMI A;  2WAD A;  1SVO A;  2XIG A;  4JX6 A;  1ON2 A;  3OYJ A;  1X1D A;  5C4J J;  4GCV A;  2G0E A;  4OOI A;  2A6E F;  1Y8R B;  3KE2 A;  4GRI A;  1I39 A;  4LGW A;  2EIM H;  3MKW B;  5F27 A;  5DYM A;  3SFI A;  1A36 A;  3FM5 A;  4CXF A;  5H20 A;  3CDI A;  4HYE A;  1APF A;  1LPQ A;  2H94 A;  2NS7 A;  3TBI A;  4L18 B;  4YIR X;  3H1C A;  4FX0 A;  3TP3 A;  1HKS A;  1U6G A;  2Z33 A;  2Y30 A;  4PJN A;  4LJZ F;  2L7F P;  2F5F A;  4D7M A;  1RR8 C;  3OIO A;  4II2 A;  2JQ7 A;  4Y52 J;  1TNT A;  2V79 A;  1D0X A;  1ZHH B;  3PIO F;  2CUE A;  5DCF A;  1YRN B;  1FBU A;  3QWL A;  1FIP A;  3QAH A;  4A93 J;  2X4H A;  3QRF F;  2K3P A;  5CKT A;  1UB9 A;  3FZV A;  1XGN A;  2ISY A;  4FAS D;  3L2W A;  2UXX A;  3LSM A;  1QA6 A;  3RYR A;  1O7L A;  4NNJ A;  3PJR A;  2Q2E A;  3RIR A;  5DUK A;  1NK3 P;  1ZQ3 P;  3FK6 A;  5J4Y A;  5HVQ C;  2ZKZ A;  1Z7U A;  4UUV A;  2HXI A;  5D6E A;  2DTZ A;  3HG9 A;  4JOM A;  2AO9 A;  3BQY A;  4WX9 A;  1ETY A;  2CYY A;  4YEL A;  3MMY B;  2DT5 A;  1G3T A;  5F04 A;  3QP6 A;  1HW2 A;  2HQA A;  1BL0 A;  1S29 A;  2R7O A;  1R58 A;  2W57 A;  3DCF A;  3I71 A;  4XKB A;  4U7B A;  2DLA A;  4HQM A;  1T8I A;  5FKO A;  2XXL A;  4G7O F;  2PJR A;  1XSX A;  1WQK A;  2M3A A;  4HNU A;  2RV8 A;  1A31 A;  1X3Z B;  3HRT A;  1Z67 A;  2NOG A;  3CUQ A;  1XS9 A;  4R8H A;  1AHD P;  1T6S A;  4EM2 A;  3AKZ A;  3JRG A;  3BOQ A;  1XGM A;  1XGO A;  5GTI C;  2H09 A;  3A0B C;  3HGY A;  4CYC B;  1W7P D;  2K85 A;  2BW3 A;  2KRF A;  3KFW X;  2VJI A;  4HX4 A;  1H9G A;  2L4M A;  3X2Q H;  4B3A A;  3G73 A;  2JUG A;  2AXT C;  1Y1V J;  2QCO A;  3N4M A;  2QF7 A;  2UXN A;  2E34 A;  3LQR A;  1EF4 A;  4LLG F;  1AKH A;  2FJ1 A;  3S3N A;  2L7M P;  2QSF A;  2BV6 A;  2KMU A;  1VZ0 A;  3QYB A;  2MGQ A;  1H0M A;  3Q0W A;  5FO5 A;  3CCL I;  2FBI A;  4M6X A;  3I5U A;  1RES A;  4BE2 A;  3OYB A;  1IXR C;  2R7X A;  2BY1 A;  4ZYH A;  2HWV A;  2DPD A;  2JA8 J;  3W6J B;  2RNJ A;  5ICG A;  4CH7 A;  2HPM A;  1MBF A;  2KIF A;  2MA3 A;  4A3E J;  2MH9 A;  1OCT C;  1K83 J;  2CH0 A;  2PFB A;  2M5W A;  3PSI A;  3P9K A;  5E3L A;  2GXA A;  2CQK A;  6PAX A;  5FLX Z;  3IRR A;  3MZH A;  2F5V A;  4ZYA A;  1V5E A;  3PUF A;  2VKD A;  1UMQ A;  4HNV A;  3HTU A;  3H9J A;  2FX0 A;  4PSX A;  1HDD C;  3LMM A;  3LA7 A;  4RAY A;  3AL0 C;  1DGW Y;  3PQJ A;  1ZLH B;  2YSR A;  1K61 A;  5E17 F;  1U5T B;  1JKQ C;  1YX3 A;  5M5X J;  2CO5 A;  4Y13 A;  1IO2 A;  5DUI A;  1TL8 A;  1SD6 A;  3WHC A;  1HQC A;  1K79 A;  5LD2 C;  2HOT A;  2GOM A;  4P5O A;  2O9L A;  1YQA A;  2OTJ I;  1NHA A;  3HHG A;  1IN4 A;  4I0B A;  3LSI A;  4BUP A;  3JSP A;  4N9H A;  1R4N B;  1A35 A;  4QIW N;  2M30 A;  3VYR B;  1FLI A;  3ISP A;  1ZK8 A;  3QOD A;  2X51 A;  1SD5 A;  3VSK A;  5EZG A;  4HOB A;  1YLF A;  2DFF A;  2MFZ A;  4BEH A;  4BGD A;  1OIS A;  2DA4 A;  2HQN A;  1FWZ A;  3A02 A;  2HEO A;  5GAE J;  3HOZ J;  4KMF A;  4L5I A;  3DTE A;  2M0C A;  3F8C A;  1AOY A;  4Z6Y A;  2OQG A;  2XKO A;  2BVM A;  3WTZ A;  4PUS A;  3GFL A;  3CCR I;  2EH3 A;  5F6F A;  1DP7 P;  1MMA A;  3EET A;  4RLQ A;  4IOA F;  3KEY A;  1AA7 A;  3WTW C;  3BG7 A;  5EZH A;  5H6Q A;  2NNY A;  3BY6 A;  2KDZ A;  3GZ6 A;  3KYD B;  3KPH A;  3L7W A;  1ETW A;  1J09 A;  1T0F C;  2ELH A;  4L9N A;  2VQL A;  1NH3 A;  1P7J A;  1W7P B;  4EJV A;  2ZSI B;  1Q1H A;  5EF6 A;  4RDU A;  5EG0 B;  2Z9O A;  1T95 A;  2HU9 A;  4HX7 A;  3BG9 A;  1QQI A;  4M9Z A;  3Q9S A;  1MZB A;  1XG1 A;  3CMA I;  3PIP F;  2ETH A;  1Y0U A;  2HTJ A;  2KJB A;  4FE7 A;  1YW9 A;  5ED4 A;  4IRG A;  1VFC A;  3C1D A;  4XL9 A;  4KIF A;  2A68 F;  1MND A;  2YPR A;  3JTG A;  3SDG A;  1V55 H;  2M0M A;  2OCC H;  2MLG A;  3ASO H;  2NVU B;  5BPD A;  2KQR A;  2XF5 A;  2Z5U A;  3BT9 A;  1W36 D;  1EH7 A;  1WCM J;  3RZD J;  2IS2 A;  5GP9 A;  2GLO A;  4NUB A;  2JK3 A;  1JGS A;  3U1K A;  1NG7 A;  2G9W A;  2PG4 A;  3S1N J;  4A3C J;  2GZW A;  1VQ7 I;  4V19 K;  1TWA J;  3C38 A;  1S9H A;  3DWL E;  1P7I A;  4L0Y B;  1FBS A;  2DFI A;  4A6E A;  2XAJ A;  3BTC A;  4UVB A;  2VB6 A;  2G7U A;  3COA C;  2GA2 A;  4AYB A;  2W84 A;  3BDD A;  5CVV A;  2ZO4 A;  4EJT A;  2R92 J;  1L3L A;  4GDF A;  2E1O A;  4FIS A;  2Z3Y A;  4XKV A;  5IT9 K;  1Y0N A;  1ETO A;  3A01 B;  1SFO J;  1RUO A;  2EQR A;  2FD5 A;  3TDZ C;  3FXM A;  1ORK A;  4IHY A;  3G6E I;  3F9K A;  3F8N A;  2HS5 A;  2OTL I;  4XN0 A;  4Q4Z F;  2IKD A;  1B72 B;  1I6H J;  1Z6R A;  3MKZ A;  1T08 B;  3ZMV A;  1X2M A;  1WI9 A;  2RKH A;  3CP2 A;  3VYU B;  1SC7 A;  2V26 A;  1KYZ A;  3D5S C;  4HZF A;  3HRM A;  5HDN A;  4AIJ A;  1TQI A;  1WJA A;  1PJR A;  2JA6 J;  2X1D A;  1S8N A;  2VXD A;  2IAI A;  2MD0 A;  2UV1 A;  4U0W A;  3MKL A;  4B3X A;  1ZKG A;  1U8R A;  5DM6 F;  1TQM A;  1DGR M;  2E36 A;  2KRC A;  2B9S A;  2LYC A;  3CJN A;  3CCY A;  2DMU A;  1QHG A;  3Q9V A;  1WSU A;  5ILV A;  2DFH A;  3TED A;  3L9F A;  1VQM I;  1S3J A;  3HPG A;  3DXJ F;  1IDY A;  3GW2 A;  4G6Q A;  3FXJ A;  1J9I A;  1RZ4 A;  2W00 A;  3FF5 A;  4IVN A;  4EJO A;  4NC8 A;  5D5W B;  3S2D J;  1UFM A;  4J00 A;  2DN0 A;  1YFH A;  1DP3 A;  4Z2Y A;  2J5O A;  1VND A;  1YTY A;  3HRU A;  4JK1 X;  4MIM A;  2KZV A;  4MO7 A;  1GLN A;  1TZL A;  4FET A;  1ZRD A;  1GVD A;  3LSP A;  1YG2 A;  4XNF A;  5A2Q Z;  4U7D A;  3A03 A;  2EPF A;  1XMK A;  2FNA A;  3ZQH A;  1MW7 A;  4CHU A;  3OYI A;  3LFU A;  5LRS A;  3HRS A;  1B9N A;  3AG3 H;  4E70 A;  2KPM A;  5L3C A;  5FRM A;  2XC7 A;  3HM5 A;  1VTN C;  5L3G A;  2HR3 A;  2WB1 A;  5GAG J;  3W2A A;  5JHF A;  5IP7 J;  2CV1 A;  1UST A;  2W24 A;  3BZC A;  3VOD A;  1VF9 A;  4EEF G;  1WJC A;  2BHZ A;  2H1L A;  2PMZ A;  4ZDL A;  3OYN A;  5KVR A;  2E1N A;  5EJC A;  1UHS A;  4N9I A;  4LB5 A;  4U0V A;  1ZAO A;  2MBF A;  1YOV B;  4CZC A;  1Z3Y A;  4BNC A;  3QPH A;  4EAT A;  1UJ8 A;  3FKI J;  2QZ8 A;  4M9X A;  1IF1 A;  3JRD A;  3ZQF A;  2R7Q A;  5BOX A;  1TT0 A;  3I54 A;  2M34 A;  2DMP A;  1ZR2 A;  3OSF A;  2R7D A;  1HF0 A;  2GA1 A;  3OMY A;  3S32 A;  1IV6 A;  1T56 A;  3V7C A;  1ZEL A;  3Q0V A;  1VQK I;  3ZCO A;  2A6H F;  1TWC J;  3KYC B;  1JJ6 C;  3LFK A;  2E5N A;  2VQG A;  4F52 A;  2FRH A;  2KIS A;  1B4A A;  1APL C;  4BXF A;  1D5Y A;  1BI3 A;  3OS0 A;  1IAW A;  4I99 C;  4AVZ A;  4RAF A;  4MQ9 F;  3TO9 A;  5LBQ A;  3GTJ J;  1BOA A;  1FMV A;  2CRG A;  1N78 A;  1LDK B;  1MJB A;  1OR7 A;  2DDA A;  2CJJ A;  2QWW A;  4QLC U;  1E2X A;  1WJB A;  2YU9 J;  4IHV A;  2WC2 A;  1JTY A;  5LHG A;  2JPC A;  3PFY A;  1YW8 A;  4EGY A;  2V1D A;  3CJR B;  4XKC A;  4PSW A;  3F6V A;  3WGH A;  2ZSH B;  4ZYG A;  1B8I A;  2VOD A;  4ZDO A;  5F64 A;  4E7Z A;  5B66 C;  5EDN A;  4H4K C;  3L09 A;  4IHX A;  1SHI A;  4BE0 A;  2LK2 A;  4ZTF A;  2TCT A;  3RPQ A;  5M3F J;  1EH8 A;  3FXR A;  5B5E C;  3QU3 A;  4E7L A;  4A0Z A;  3CCE I;  3J7A Y;  3PNV A;  2UZK A;  2YX7 A;  3BWG A;  3EUA A;  4PDK A;  4C3I J;  3IL2 A;  3CO6 C;  4G94 A;  1JKR C;  4IKF A;  4RBO A;  2FML A;  4BAY A;  1VQL I;  2O0Y A;  2WWY A;  3E0J B;  4LK0 F;  2LRD A;  1SFX A;  5M3M J;  4A12 A;  2KP6 A;  5J1U A;  2D2W A;  4UUS B;  2DT7 B;  3OR1 C;  3LA3 A;  3RPU D;  4PJM A;  5KAI C;  4CA0 A;  1IN8 A;  5E3N A;  3AL0 B;  1H5O A;  4I98 B;  4UB6 C;  3K69 A;  3PQK A;  3A4C A;  1S5L C;  4A3B J;  1UG2 A;  2Y9Z A;  5DCM A;  3MD2 A;  2ECB A;  4ENJ A;  4KN4 X;  5HS8 A;  3DEU A;  1WH5 A;  3EUH A;  2DA7 A;  4V2F A;  3PSF A;  1Z77 A;  4A69 C;  4AYB N;  1KU9 A;  2V6E A;  2SH1 A;  3QYF A;  2GXG A;  3MFK A;  1LFU P;  4I6Z A;  5JVT A;  2I10 A;  2QQB A;  3LNQ A;  1MBH A;  5FGM A;  2QSH X;  5D8K B;  4ENN A;  4Y17 A;  2VI6 A;  2DU9 A;  2X1C A;  2EFW A;  2RQQ A;  3K9T A;  1UG0 A;  3TO7 A;  1D3Y A;  1YIJ I;  4XOT A;  3WTX C;  1YJ9 I;  1RR7 A;  5IYC J;  2VQH A;  4CCM A;  3BP8 A;  3V4G A;  4CDG A;  1V5F A;  2KRH A;  1Y39 A;  2OA4 A;  4FT8 A;  3G4S I;  1K6Y A;  5J8F A;  1POG A;  4ON0 A;  1MBE A;  3OR2 C;  3M3Y J;  1BR4 A;  2DAO A;  3N05 A;  2ZXH A;  4M3B A;  4B1R A;  2K27 A;  4KJZ A;  2NVX J;  3K2Z A;  4XSZ F;  4O3M A;  1FMW A;  3MZY A;  3I56 I;  1TWF J;  1U0J A;  4LFU A;  4PFP A;  1XGS A;  2V7F A;  1D0Z A;  1R71 A;  4GYI A;  2VE8 A;  2QM3 A;  3OYD A;  1GDT A;  2IS4 A;  3H3V K;  3HOY J;  3RPU A;  3RI4 A;  5JLX A;  3JAM K;  4M3F A;  4P55 A;  3IP4 B;  4AUX A;  2K9Q A;  1R5I D;  2KL4 A;  1W5C C;  2EWN A;  1BIA A;  4XBF A;  5L3D A;  3D0S A;  3S2H J;  1ZR4 A;  1O7F A;  3F23 A;  3GYH X;  3K4N A;  4L9V A;  5CVI A;  4DZJ A;  4IRI A;  3K10 A;  1KZH A;  3K4B A;  2FQ4 A;  3CDL A;  4BQA A;  1V4R A;  1SEU A;  4DYC A;  4LG0 A;  1RPW A;  1B6A A;  1R5H A;  1J5Y A;  3VSL A;  4C30 A;  4LLL A;  4BJ5 C;  3WTY C;  1HW1 A;  2BXZ A;  1WJE A;  2JVH A;  4F92 B;  4F55 A;  3CC4 I;  2NYX A;  2K02 A;  3I0T A;  3P7N A;  1ONV A;  4UXN A;  4W97 A;  1XSD A;  1F4K A;  3HSE A;  2EJR A;  1RNL A;  3W2V A;  1X1P A;  2K9S A;  3L2U A;  3RKQ A;  1X3W B;  2CUF A;  5IP9 J;  1V5G A;  2H6B A;  4FE4 A;  4ZH4 F;  2UWM A;  1WVR A;  2P5V A;  2WB1 N;  2M45 A;  5EEA A;  4KFC A;  4A3J J;  3ZQC A;  2PMZ N;  4KN7 X;  2R7F A;  1PUE E;  3QOE A;  4CCK A;  2EA4 A;  5TIS C;  2MUB A;  2TRT A;  3FBN B;  1Y6I A;  4BJT A;  4BY7 J;  1BC8 C;  3M4O J;  2ZFU A;  3H92 A;  3K4K A;  1WI3 A;  3KLN A;  3RQI A;  2QKL B;  4YG2 F;  2X1E A;  1H89 C;  2DOE A;  1JUM A;  1QNT A;  2KHM A;  1IUF A;  3D4U B;  2LG4 A;  2P81 A;  4ABZ A;  1Y1W J;  2PEX A;  3LSH A;  1KQ9 A;  3OWT A;  2XAG A;  4J19 A;  2Q8K A;  3GLX A;  4D1Q A;  1E0E A;  1ZLI B;  3TQN A;  3LL7 A;  4EM0 B;  3B73 A;  3E7L A;  4I7H A;  4BH9 A;  1QZZ A;  2XAS A;  2FQ3 A;  4GGG A;  2RDP A;  2XPV A;  1MD0 A;  3I58 A;  4A6D A;  3C2H A;  4KIB A;  5CYV A;  3JRC A;  4BY1 J;  3OY9 A;  1ETK A;  1F43 A;  3HSF A;  3GTG J;  3HUG B;  4M6Y A;  4LB6 B;  2VXZ A;  2VBY A;  3E6D A;  2P7C B;  2CV2 A;  2XVC A;  3FXU A;  2R5Z A;  3BG6 A;  3DTK A;  4XOR A;  5E1W A;  3FHN A;  4KYW A;  1OKR A;  3FHZ A;  5HOO A;  5L3B A;  3S1R J;  3B6A A;  2YX4 A;  4WF2 A;  1QZY A;  2Y31 A;  4B48 A;  3BRO A;  1MDM A;  4P1W A;  3MYV A;  1WXN A;  1V3F A;  3U21 A;  1R4M B;  1MJA A;  4AVP A;  4XM3 A;  3VWB A;  2JSP A;  1LDD A;  2XDV A;  4OIR F;  5F08 A;  3J7Z I;  1W36 C;  4LMY A;  1BC7 C;  2COM A;  2HOE A;  2LKP A;  3CD6 I;  3NWT A;  1ZHF A;  3CCU I;  1ZYR F;  5F1R A;  4A3L J;  1J0R A;  2DPU A;  4IRH A;  2LBF A;  4Q48 A;  1JKO C;  1ERD A;  1FC3 A;  2V1N A;  3BR5 A;  1FYM A;  2I5U A;  2VJ5 A;  3QP5 A;  4HG2 A;  3ABK H;  2E71 A;  2M2E A;  2XKP A;  4CCN A;  2Z16 A;  2DJN A;  3AG1 H;  4XSX F;  2RAE A;  2WY7 Q;  4HNT A;  1P2F A;  4QTR A;  2R7U A;  4KMU X;  2HNH A;  5FLV A;  3WE3 A;  1ZTR A;  3WGG A;  2EFO A;  5JI6 A;  4OAZ A;  3CCJ I;  2D45 A;  3RKW A;  2D1V A;  4OWR B;  3WU2 C;  3I59 B;  2QSH A;  1U9N A;  4RB2 C;  3I3L A;  2L3D A;  3KP7 A;  2N8G A;  4AU7 A;  1XPX A;  4XLA A;  4N4N B;  1OCZ H;  3K2A A;  2ID6 A;  1IW7 F;  3FKJ A;  4K2E A;  1QO0 D;  1STZ A;  2IPQ X;  3A2K A;  1TQP A;  1W5S A;  2DK8 A;  2E7X A;  3GFJ A;  5GPA A;  2R5Y A;  5JVG F;  1RUN A;  2BY0 A;  3F8M A;  3U9G A;  3HB9 A;  3OYH A;  1PVE A;  5ILS A;  1LFP A;  5DV5 A;  3OYM A;  1YO5 C;  1D8J A;  1WHU A;  3DV8 A;  2NVQ J;  2P5K A;  1OYW A;  1U3E M;  1IN5 A;  3K4J A;  3LA2 A;  4Y15 A;  4UY8 I;  4ESF A;  3CO7 C;  2LD5 A;  3ZQL A;  4GFB A;  3Q3S A;  2Q2E B;  1FOK A;  3OYK A;  2VL8 A;  5K7F A;  2Q0O A;  1I6X A;  5HLI A;  1JKP C;  3M8E A;  3J7Y J;  2VLA A;  4XLP F;  2ZXJ A;  1YE9 A;  1UZC A;  1IG7 A;  3ZN0 A;  2R4G A;  3E5X A;  2NAZ A;  3A0H C;  4CGZ A;  5ERI A;  1VQO I;  1ZGJ A;  1SFK A;  1IXC A;  1U5T A;  3KEZ A;  2PQ8 A;  2RNG A;  3DQV C;  3I64 A;  2OV7 A;  2PJR B;  4YEJ A;  3G3Z A;  2V4J C;  3DTI A;  3KEO A;  3SFZ A;  5GAD J;  4HLX A;  1LB2 A;  1C0W A;  2CMP A;  3KEQ A;  2HQ5 A;  3NEU A;  2VPL A;  3CUQ B;  2E1M B;  1RI7 A;  3GFM A;  2OU2 A;  4A3G J;  4NHJ A;  1OYI A;  4IXA A;  2E7W A;  4OIN F;  3O8H A;  3JRE A;  2BW3 B;  3J80 Z;  3H35 A;  1TWG J;  5C3E J;  3FM3 A;  1YI2 I;  2BY2 A;  3IKV A;  1NK2 P;  5LFA A;  3WGI A;  2E1C A;  3V42 A;  3QQA A;  2I8D A;  5J40 A;  1GV2 A;  2IGK A;  1LFB A;  2DA5 A;  1W0U A;  2AHQ A;  2EZI A;  1HLV A;  1AKH B;  1QPI A;  1BI1 A;  2QVO A;  2KZG A;  3NQO A;  3CTA A;  4NDL A;  4A3F J;  3S1M J;  2ZME A;  3BTI A;  1E3O C;  3H0D A;  4S05 A;  1QU3 A;  2B9K A;  3MAJ A;  1VI0 A;  5IPA A;  3OYC A;  1BOB A;  5LEJ A;  1K78 A;  2XAH A;  3KIO A;  3J81 K;  2EBI A;  2VUM J;  4I0A A;  2IS1 A;  3CCQ I;  2WAF A;  1X1B A;  4E7K A;  2JA7 J;  1CF7 A;  4XK4 A;  1EV7 A;  1D1A A;  1YW7 A;  2VC1 A;  3K1M A;  4II3 A;  2DDB A;  3ZMD A;  1QVU A;  1G4D A;  1U9O A;  5E79 C;  2P6T A;  5F1J A;  1R5G A;  2G7H A;  3OS1 A;  4KUM A;  3M7G A;  5EG0 A;  3DEE A;  3IRQ A;  3FXO A;  4AIH A;  4PJL A;  2DW4 A;  2A6T A;  4Y33 A;  3ROU A;  1REP C;  2DA6 A;  3SHF A;  1HKT A;  4BQQ A;  2VQC A;  5GAH J;  2WAQ A;  4AIK A;  2DXI A;  1VQP I;  1ZUF A;  2LC2 A;  2ZNZ A;  2ME6 A;  3JRH A;  1ULY A;  3LOC A;  1BI0 A;  4XRM A;  1DU0 A;  3GTM J;  2EIJ H;  4BBR J;  2F5D A;  2W25 A;  4XN3 A;  1MBJ A;  3EUH C;  1XN7 A;  1F36 A;  4YIR A;  3ABL H;  3HZJ A;  2H6C A;  1K4S A;  2P8T A;  1HSJ A;  2O7O A;  3NAR A;  5B1A H;  2VOP A;  3R6S A;  4LOC A;  3UNG C;  4B43 A;  2JJ7 A;  4C2T A;  3V8L A;  1KQ8 A;  3TOB A;  4BEH B;  5ICF A;  1BW5 A;  5C44 J;  2EFQ A;  3K7A J;  2OZ6 A;  3T1B A;  1R22 A;  2ZFW A;  1D0Y A;  1FBQ A;  3ZXS A;  1IJW C;  4BKX A;  4EJW A;  1WRJ A;  1DQU A;  3A01 A;  4BBS J;  1EA3 A;  2L9V A;  1MSE C;  2BZT A;  2Y75 A;  3S14 J;  5FKN A;  2LSO A;  4PK4 A;  1LVK A;  1R23 A;  1JTX A;  1N77 A;  5K5O A;  4IQ4 A;  2GWR A;  1SVL A;  1FYL A;  3IAM 2;  4L9T A;  1J59 A;  1XC5 A;  2P4W A;  3CJT B;  1TW2 A;  2VN2 A;  1BIB A;  1AU7 A;  3OIP A;  4S0H B;  3BJO A;  4RB3 C;  1FOW A;  2XGD A;  3BCA A;  4E7I A;  1GV5 A;  1O3S A;  4MTE A;  2F4M B;  4G9Y A;  2DOF A;  4XLE A;  1HC8 A;  2K4J A;  4ENM A;  5L3F A;  2X6O A;  3DKX A;  2K5C A;  3BJ6 A;  3KP4 A;  3BJA A;  2L0K A;  1JXS A;  4DW6 A;  3OOP A;  3M9A A;  2EIN H;  2XHK A;  3ERM A;  2LLK A;  1WJ5 A;  4X1E A;  2H9X A;  3QPL A;  3HPH A;  2AQE A;  1KU3 A;  3DEW A;  2LY9 A;  1HKQ A;  1LJ9 A;  3OYE A;  2JSC A;  3ULQ B;  2RN7 A;  3MKY B;  4MTD A;  2OAZ A;  3S1Q J;  2PJP A;  1KYW A;  4RB0 A;  4HF2 A;  3AAF A;  2X6X A;  2CQN A;  1LE8 A;  4JX5 A;  2CW0 F;  1MBG A;  3ZMZ A;  4XLN F;  2CWE A;  1NTC A;  3ZN1 A;  1Z6T A;  2IA1 A;  2VJ4 A;  4AC0 A;  3E5U A;  3WTT C;  3IAS 2;  4P96 A;  3RYP A;  4X0G A;  2FBK A;  5J3L A;  3R60 A;  2ZJR F;  2A61 A;  1R1T A;  3ERE D;  2BOL A;  5K5R A;  1Y56 A;  5E1X A;  4HQE A;  3FBI B;  2WA0 A;  2BXY A;  3BC8 A;  4QWQ A;  3TW7 A;  2W4S A;  4F91 B;  5LGN A;  3CMY A;  4DJA A;  3BPX A;  3BLY A;  2LVS A;  2LTP A;  3G2B A;  5D5X B;  2NXN B;  4BDY A;  3CCS I;  2DT6 A;  3CC7 I;  3TP0 A;  2HVS A;  2W1O A;  3BTL A;  3M1C A;  3OV8 A;  3C18 A;  3RSN A;  3D5L A;  2RC4 A;  1FOY A;  2MH2 A;  5DS9 A;  4M6V A;  3ECH A;  3C2B A;  3CCV I;  1X4O A;  3REO A;  4BL0 B;  2XAU A;  3H9G A;  3IWZ A;  1Z91 A;  1Q1V A;  3K1N A;  2KFD A;  4A0X A;  4OMZ A;  3JSO A;  1WFX A;  2EIL H;  2F5C A;  3OYA A;  5DM7 F;  5K7H A;  5ICE A;  4HLY A;  4MHG A;  1JI8 A;  3L2V A;  1WZ2 A;  1IRZ A;  1MBK A;  4DYQ A;  4BQO A;  5EGO A;  3L1P A;  4BDZ A;  4DNC A;  2XRO A;  4XLC A;  3S15 J;  5IT3 A;  4PGG A;  5IY5 H;  2XB5 A;  1O3Q A;  3CQZ J;  4RAG A;  4RGU A;  3OYG A;  1N25 A;  2COB A;  3ZOB A;  3P9I A;  4PFO A;  2HOS A;  1FP1 D;  2HXO A;  2IRF G;  1ZN2 A;  1D5V A;  4PZJ A;  1HXD A;  4TV7 A;  1RKW A;  2ZB9 A;  2YU3 A;  2V9V A;  1F9N A;  3FXQ A;  5EYR A;  3TDU C;  3E1S A;  4P9F A;  1BI2 A;  4AM3 A;  4N0B A;  4B09 A;  2FU4 A;  1A6I A;  4M3D A;  1CGP A;  4WXH A;  3L2Q A;  4IOC F;  2XB0 X;  1MNE A;  1S72 I;  2LFB A;  3OSG A;  2JWT A;  2KIM A;  3ABT A;  4D0P A;  2RVC A;  1OQY A;  1R6R A;  3GBG A;  2VC0 A;  2ZXI A;  4I09 A;  2Y69 H;  2QQ9 A;  3I53 A;  1IRX A;  4LIU A;  3IKT A;  3RKY A;  3DBL B;  3ZQG A;  2KDO A;  4PJ0 C;  1PP8 F;  2O8X A;  3ABM H;  2HI3 A;  2DQR A;  1UAA A;  1M1E B;  3EUK L;  4CSW A;  4OIP F;  4ZYD A;  3RTR A;  4O5V A;  2ELK A;  5E3O A;  1PUF A;  2XV4 S;  2MC4 A;  1PDN C;  2WAQ N;  4M3G A;  3JRB A;  5CLS A;  2W85 A;  1MMG A;  2CS3 A;  1JUP A;  1KU7 A;  3R0J A;  2ZJQ F;  3VB2 A;  2QBY A;  5IYB J;  4AD9 A;  1YHQ I;  3GUD A;  2VIX A;  5E3M A;  3CUQ C;  2E1M C;  1O3R A;  2IXS A;  2NNN A;  4ESB A;  4XRS A;  4KIS A;  2GM4 A;  1XCV A;  3MZ8 A;  4UUT A;  3F6O A;  2L9N A;  4L0Z B;  2M8G X;  4ZTJ A;  1HA8 A;  1HOM A;  5K5Q A;  5BMZ A;  2H8W A;  1XDU A;  5LGU A;  5IT9 Z;  3IV5 A;  3F72 A;  1PP7 U;  1ODD A;  3RZO J;  4U0Y A;  2GAU A;  4M73 A;  2OC6 A;  3QOP A;  4B4C A;  4ANJ A;  1Y8Q B;  1R9T J;  1JT0 A;  5JR3 A;  1VQN I;  4QSH A;  3HKZ A;  4F3Q A;  2OF7 A;  2FBH A;  4HPQ A;  4P9U A;  2DJI A;  5E8G A;  4JYK A;  1IC8 A;  1KA8 A;  1FYK A;  4G12 A;  1DPU A;  2X6W A;  5J1Y A;  9ANT A;  1BBY A;  3KLO A;  4O6J A;  3NWS A;  5HS9 A;  4RAZ A;  2ZBK A;  2BY3 A;  2GOX B;  2M7A A;  3KP2 A;  5EEH A;  1WH7 A;  5LHI A;  3W6V A;  1B8I B;  2ELJ A; 
#chains in the Genus database with same CATH homology
 3BG6 A;  3DTK A;  2MAB A;  2IGN A;  4XOR A;  3ZQQ A;  2Z2S B;  3FHN A;  4XR6 A;  2R7R A;  3VYR B;  3QOD A;  2X51 A;  4CUG A;  5HOO A;  2VKH A;  3VSK A;  2X85 A;  2MFZ A;  3HC7 A;  4BEH A;  4ITV A;  4BGD A;  1ATX A;  4B48 A;  4P1W A;  3MYV A;  1WXN A;  3U21 A;  4KT6 A;  3DTE A;  4XM3 A;  3VWB A;  2JSP A;  5FRO A;  2BVM A;  4DBR A;  2XDV A;  4PUS A;  2HPI A;  1W36 C;  3ONQ A;  2HDW A;  3NWT A;  1X1C A;  1MMA A;  4RLQ A;  1D6B A;  2L2O A;  3KEY A;  1AA7 A;  3BG7 A;  3PL8 A;  2LBF A;  2CUZ A;  1ERD A;  2V1N A;  1Z3X A;  2WBM A;  2VJ5 A;  4HG2 A;  5KHD A;  4CCN A;  2Z16 A;  1J09 A;  3OL4 A;  3DKY A;  1T0F C;  2HVQ A;  2VQL A;  2KLO A;  2WY7 Q;  3PNY A;  2ZSI B;  4HNT A;  2R7U A;  3CZ6 A;  2HNH A;  1X4P A;  2A5W A;  3H5A A;  4GV5 A;  2BDS A;  1T95 A;  2HU9 A;  4OAZ A;  4OWR B;  2QSH A;  2XF6 A;  2K9M A;  1D1B A;  3I3L A;  4BE1 A;  3OYL A;  2ELJ A;  1WJF A;  1P9Q C;  3VYT B;  4XLA A;  4AU7 A;  4XON A;  4N4N B;  3I9V 2;  3FKJ A;  4XL9 A;  3A2K A;  3DLA A;  1MND A;  2X6Y A;  4R79 A;  4MLO A;  3OYF A;  2M0M A;  3RCO A;  3MCX A;  3OYH A;  2KQR A;  1LFP A;  2XF5 A;  4RLF A;  3OYM A;  4IZZ A;  1W36 D;  2WAE A;  2K9L A;  3OS2 A;  2IS2 A;  4NUB A;  1QHH D;  3K4J A;  1NG7 A;  1KON A;  2M7B A;  3IUO A;  2Q2E B;  1S9H A;  3DWL E;  3OYK A;  3C38 A;  2VL8 A;  3LSI A;  4ZC3 A;  3SYT A;  2W7N A;  2VB6 A;  2HVR A;  2L9S A;  2VLA A;  2JA2 A;  4DOZ A;  1YE9 A;  1UEL B;  4AYB A;  2R4G A;  2NOJ B;  4XKV A;  1SFK A;  2LOO A;  3KEZ A;  2RNG A;  3DQV C;  3K70 C;  4BAC A;  2OV7 A;  2PJR B;  4YEJ A;  3F9K A;  2V4J C;  3DTI A;  4QPO A;  4E6K G;  4XN0 A;  2IKD A;  3KX2 A;  1X1A A;  3MKZ A;  2CMP A;  3S8P A;  3CP2 A;  2VPL A;  3VYU B;  2E1M B;  2V26 A;  1SAU A;  3D5S C;  1ZUE A;  1WJA A;  4HRI A;  1PJR A;  3K4L A;  2X1D A;  4B44 A;  2VXD A;  2UV1 A;  2MD0 A;  5CPR B;  2BW3 B;  4B3X A;  2L7K A;  3EPZ A;  3H35 A;  1DGR M;  5CQG A;  2JR3 A;  2DCE A;  4IQJ A;  2KRC A;  4XQF A;  5LFA A;  3VYS B;  1Z21 A;  3V42 A;  2LYC A;  4DGW B;  1MMD A;  2OUM A;  3HL2 A;  2I8D A;  1QHG A;  2IGK A;  2P0W A;  2W82 A;  3W2W A;  4B47 A;  3HPG A;  2LRE A;  1N75 A;  1WJD A;  3OL3 A;  2R7S A;  2W00 A;  3H0D A;  1QU3 A;  2B9K A;  4NC8 A;  3K70 D;  3OYC A;  4Y4R A;  1BOB A;  4J00 A;  3K4C A;  4OAY A;  2IS1 A;  1DP3 A;  2E5Z A;  2IGO A;  1BDS A;  2WAF A;  1X1B A;  4DBQ A;  4E7K A;  2CFO A;  2V9K A;  1D1A A;  3DPL C;  4II3 A;  2O5R A;  2KZV A;  5HNH A;  1BR1 A;  2F6C A;  3OS1 A;  2JTO A;  1GLN A;  1TZL A;  3CP8 A;  4FET A;  3DEE A;  3FDY A;  4PJL A;  4XNF A;  2UUZ A;  3CMM A;  1MW7 A;  2A6T A;  4Y33 A;  3LFU A;  3OYI A;  1Z7L A;  3VDX A;  1Z99 A;  3LMS B;  2KPM A;  4BQQ A;  2VQC A;  3SDB A;  5FRM A;  2R7T A;  2XC7 A;  2WAQ A;  3BCB A;  2DXI A;  2VAS A;  2WB1 A;  2WY8 Q;  1ZUF A;  4N4O B;  4YRV A;  3W2A A;  5JHF A;  2LC2 A;  3H5N A;  2CV1 A;  4BJ6 C;  1WJC A;  2PMZ A;  3H5R A;  4XN3 A;  4ZDL A;  4RMN A;  3OYN A;  2R7W A;  4CCO A;  2LY1 A;  4C2U A;  2XSJ C;  4XKW A;  3EUH C;  4YIR A;  3ZGK A;  4E7S A;  4CZC A;  1G8X A;  3SEZ A;  1Z3Y A;  3UNG C;  4B43 A;  4D9J A;  4E4H A;  1OLT A;  2Q1Z B;  4EAT A;  4C2T A;  1NG6 A;  4BEH B;  4LG3 A;  2R7Q A;  1TT0 A;  2JVG A;  3S3M A;  3S93 A;  1D0Y A;  4PJJ A;  3ZXS A;  3OMY A;  3S32 A;  2HJ9 C;  1YX5 A;  1DQU A;  1ZEL A;  1EA3 A;  4XLF A;  3ZCO A;  4Y3O A;  4LIV A;  2BVL A;  4G6T B;  4PK4 A;  3K6G A;  1LVK A;  2E5N A;  2VQG A;  4F52 A;  1N77 A;  3LSK A;  4IQ4 A;  3ZR8 X;  2LBF B;  2XF7 A;  4BXF A;  3IAM 2;  4QPQ A;  2MN3 A;  3HOT A;  3DPU A;  2R7V A;  3OS0 A;  3W3C A;  4AVZ A;  5FRN A;  4HST A;  1FMV A;  3A1Y A;  3OIP A;  2CW7 A;  1N78 A;  1LDK B;  3BCA A;  4E7I A;  4XLE A;  1WJB A;  2IS6 A;  3DU5 A;  3DKX A;  2K5C A;  3PFY A;  4RM3 A;  3C2G A;  3QYE A;  4XOP A;  4IX7 A;  5KNL A;  3CJR B;  1WJ5 A;  5CQE A;  4XKC A;  2H9X A;  4PSW A;  3HPH A;  3SEQ A;  4BS9 A;  2AQE A;  2ZSH B;  4ZDO A;  3OYE A;  4E7Z A;  3MKY B;  4NQW B;  2AQF A;  4H4K C;  4E7H A;  4E7J A;  1SHI A;  4BE0 A;  4ZTF A;  3S3O A;  3M8J A;  2X6X A;  4E7L A;  3J7A Y;  1OR7 C;  2F4I A;  3PNV A;  4LIT A;  3KYL A;  4JQF A;  3EUA A;  2HJE A;  2LY2 A;  4J01 A;  3OIQ A;  4IKF A;  5HLT A;  1D1C A;  3TMO A;  2IKE A;  2E60 A;  3PUB A;  2VJ4 A;  1AHL A;  3E0J B;  2HZD A;  2LRD A;  3IAS 2;  4X0G A;  2KP6 A;  1LKX A;  2DT7 B;  3OR1 C;  2WAD A;  2Y0S A;  2BOL A;  2IGM A;  3OYJ A;  1X1D A;  1Y56 A;  4PJM A;  3RPU D;  3FBI B;  4CA0 A;  3AL0 B;  2WA0 A;  2Z1D A;  3CES A;  2QSG A;  1H5O A;  3ZRG A;  3BC8 A;  3A4C A;  4GRI A;  2W4S A;  4F91 B;  4F93 B;  1X19 A;  4DJA A;  3H9Q A;  3BLY A;  3MKW B;  3MD2 A;  3G2B A;  2CW8 A;  4ZJZ A;  4C9Y A;  4BDY A;  1B8W A;  2DT6 A;  4HEA 2;  2HVS A;  2L5Q A;  2W1O A;  3M1C A;  3RSN A;  1APF A;  3SZG A;  3PSF A;  3D5L A;  2V6E A;  2SH1 A;  3AFH A;  3QYF A;  3TBI A;  1BR2 A;  4BQN A;  2M4G A;  1X4O A;  3DPT A;  4RM2 A;  4BL0 B;  2XAU A;  4XMY A;  3UR3 C;  4PJN A;  3H9G A;  2X1C A;  2RQQ A;  1UG0 A;  1WFX A;  4XOT A;  4II2 A;  3OYA A;  2VQH A;  4CCM A;  1JI8 A;  3L2V A;  1V5F A;  1D0X A;  1MMN A;  2KRH A;  3L2R A;  4BQO A;  1ZHH B;  2FUG 2;  1K6Y A;  4BDZ A;  4XLC A;  3OR2 C;  1BR4 A;  2VJJ A;  3N05 A;  2ZXH A;  4KJZ A;  2K3P A;  5CKT A;  4FAS D;  3L2W A;  3LSM A;  2MYS A;  1FMW A;  3PJR A;  4NNJ A;  3OYG A;  1U0J A;  4PFP A;  4PFO A;  2V7F A;  1D0Z A;  3OYD A;  2IS4 A;  5HVQ C;  3PNT A;  4XLH A;  2DOA A;  3IP4 B;  1SH1 A;  3HG9 A;  4JOM A;  2KL4 A;  4YEL A;  3MMY B;  3E1S A;  2HQA A;  3K4N A;  2R7O A;  2DLA A;  2LH9 A;  3K10 A;  4XKB A;  4U7B A;  3K4B A;  3L2Q A;  2XXL A;  2PJR A;  2QKM B;  1MNE A;  1WQK A;  2M3A A;  4BUP A;  4HNU A;  4ZDP A;  1R6R A;  3GBG A;  2ZXI A;  2K2X A;  4KIT B;  4LIU A;  1IRX A;  4C30 A;  3VSL A;  4BJ5 C;  3AKZ A;  4F92 B;  1WJE A;  2JVH A;  2KDO A;  4F55 A;  3HXL A;  5HNF A;  3TL4 X;  4HSR A;  2BW3 A;  3C30 A;  1UAA A;  2VJI A;  3EUK L;  4CSW A;  4CCL A;  3W2V A;  3LSG A;  2JUG A;  3L2U A;  3RTR A;  1V5G A;  2UWM A;  2MC4 A;  4CCJ A;  1MMG A;  4BU2 A;  2CS3 A;  3CF2 A;  3S3N A;  3CJQ B;  3QOE A;  4CCK A;  2QSF A;  1PYV A;  2KMU A;  2VIX A;  1VZ0 A;  3QYB A;  2MUB A;  2E1M C;  2IXS A;  1Y6I A;  3FBN B;  4BJT A;  2M4K A;  2ZFU A;  3OYB A;  4BE2 A;  4KIS A;  3K4K A;  2CUJ A;  2QKL B;  2R7X A;  2X1E A;  3D5R C;  2L9N A;  4ZTJ A;  1HA8 A;  4CH7 A;  2KHM A;  2HPM A;  5TGT A;  2LG4 A;  3D4U B;  2CV0 A;  2CH0 A;  3PSI A;  3LSH A;  3OWT A;  2F5V A;  4ZYA A;  4D1Q A;  1V5E A;  4U87 A;  2OC6 A;  2VKD A;  1E0E A;  1ZLI B;  4ANJ A;  1G59 A;  3K4M A;  3H9J A;  3LL7 A;  3HKZ A;  4F3Q A;  4PSX A;  3LMM A;  4HPQ A;  3AL0 C;  1DGW Y;  5KCM A;  1ZLH B;  2DJI A;  1YX3 A;  3RQ4 A;  2X6W A;  4NC7 A;  3C2H A;  2RRE A;  3OY9 A;  3NWS A;  3HOS A;  3OOU A;  5LD2 C;  2GOM A;  2GOX B;  2M7A A;  3HUG B;  4P5O A;  2VXZ A;  4DIQ A;  2CV2 A;  3DU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...