3KEZA

Crystal structure of putative sugar binding protein (yp_001299726.1) from bacteroides vulgatus atcc 8482 at 1.90 a resolution
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
447
structure length
447
Chain Sequence
ETSINVLSDIEFTLNGIYSTMQSSDAYSGRLVYYGDVTGDDMQAVSSTKRTGNYYRFNFTKDNGPSSHWSYLYSIIQNCNLILMNVDKLSIDEDETEYKNDLKGQALAIRGMALFDLTRIFGYPYLKDNGASLGVPIVKELSTIDSKPARNTVAECYTEIISDLKNSTELLSGDFNKGKVNRWAAMTLLSRVYLYKGEYNEALTMAENAIKGAEKEGYALWTNEEYPTAWGNDASASNPGEILFEIVNLTTDSPGKESMGYLNSYNGYDDMCITCSFYQLLKKDPKDVRLKILSFDKKYYAYVNKYQPQQGENITDANIPLIRLSEAYLNAAEAAVQTGDNAKAVKYLNSIVQRANPENSVEGKTLTLENVLDERRKELVAEGHRMYDVIRNGMTVKRIDVKDSDINKTKHNTAYMEYDWNFHKILLPIPKKEMDANPNMKQNPGYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative sugar binding protein
publication title Crystal structure of Putative sugar binding protein (YP_001299726.1) from Bacteroides vulgatus ATCC 8482 at 1.90 A resolution
rcsb
source organism Bacteroides vulgatus atcc 8482
molecule tags Sugar binding protein
total genus 155
structure length 447
sequence length 447
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07980 SusD_RagB SusD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3kezA01
1.25.40.900 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3kezA03
2.20.20.130 Mainly Beta Single Sheet Anthopleurin-A Anthopleurin-A 3kezA02
3EHNA 3OTNA 3SGHA 3MX3A 3IHVA 3MYVA 3SNXA 3MCXA 3EHMA 3L22A 3KEZA 4MRUA 5T4YA 4Q69A 3GZSA 3CGHA 3NQPA 5FQ7A 3CK8A 4F53A 4F7AA 4LERA 3CKBA 3CKCA 3JQ0A 3QNKA 4PUCA 3P1UA 4L7TA 5T3RA 3FDHA 5FQ6A 3JYSA 3LEWA 5FQ4A 5FQ8A 3I4GA 3IV0A 5E76A 3CK9A 5J90A 3HDXA 3JQ1A 3CK7A 5LX8A 5E75A 3EJNA
chains in the Genus database with same CATH superfamily
3KD7A 3B7BA 4J0UA 1SZ9A 1RZ4A 3TGOA 1S0PA 2NXPA 2FO1E 2IJGX 3FU3A 2MUBA 4J8FA 3SBSA 3GYZA 2KZTA 4C9BB 4HVBA 4APOA 5BW8C 2XZDG 1HH8A 4EZJA 1OXJA 5AARA 4Y6WA 2QYJA 2RFMA 4GCNA 3EU9A 4YDYA 4XKBA 3JXIA 5A23A 3FUDA 3Q15A 2XS1A 3CQGB 3WG7E 4GA1A 3WXXA 3D3MA 4A63B 3APFA 3D4UB 3D9JA 2AW6A 3LS8A 4WWNA 1JUQA 1N54A 4GMRA 4N5CA 4OYSA 5D0OD 3E37A 3QARA 2XXLA 4M7CA 1H5OA 3CHMA 1IXVA 3TWWA 2WPVA 1Z99A 2EILE 2VGXB 3D9IA 1WXNA 2DBAA 3ESLA 3Q7AA 2J4DA 5AJDA 3PZ2A 4G8KA 2OCCE 3NQPA 5EDSA 2IKEA 2CHZA 3UIPC 4GTMA 2I1JA 4CRWA 4O1PA 2IU1A 2VGYA 3CHSA 5G05C 1SW6A 4R7LA 4YVQC 4B89A 3ZUVB 5AENA 2J09A 2WQ6A 3PE3A 4HRLA 4G1TA 1SA4A 2AWIA 4BT9A 1Z5SC 4OAVB 2PQRA 4UWFA 1UJJA 5CECB 4AXHA 1E7VA 3DXMG 2X6HA 4I17A 3B7SA 5FT9A 5B1AE 4U7EB 3Q79A 4F7AA 2HR2A 1FCHA 4L9PA 2R02A 1LTXA 3NOCD 1WY6A 5BXOA 3L54A 1N95A 1TN6A 3TJPA 5LP0A 3FUIA 4ABNA 1KT0A 5HRYA 1X5BA 3MV2B 3KEZA 3CVNA 2FO7A 3CK8A 3IXEA 2WQHA 2WXOA 4G23A 3UI2A 4RG6A 2ZISA 1D6BA 3PREA 1H6OA 1UN8A 3ONLA 1S70B 5BXUA 2WXLA 1BLXB 2ZXWE 3EHQA 5FWQA 4GZ6A 5D0QD 2UY1A 4WWPA 3FU0A 4JEUA 3QC1A 1SQMA 4WAFA 3CVYA 5H7PA 3W9GA 1DC2A 3D9NA 3S7BA 2F8XK 1QQEA 1JCQA 2QC9A 2WXIA 3MJWA 3P1UA 2PM6A 1YCSB 2I6HA 2WB2A 4JZYA 3HYMB 3CHPA 4GPMA 2C0MA 3SGHA 1DCQA 3HRAA 1JCSA 2QSFA 1H6PA 1GW6A 3AG2E 4JXTA 3PNTB 1N4QA 2P58C 4DI4A 4HI8A 3ULEG 1TR4A 3MEKA 4A1GA 2WQ7A 3ASFA 3SD5A 1N52A 3BEEA 3W9FA 2KATA 3I3NA 4GTQA 3Q73A 2IY0C 3C3RA 3EU5A 3Q9NC 5KJNA 2LSUA 3EUVA 1QYMA 1EYHA 5AIJA 4AY6A 2E0IA 1JWFA 3R9MA 1OT8A 3MV3B 3EHNA 3B7RL 4IULA 1NP7A 2NSZA 3L22A 2OEWA 2AXZA 3LKUA 3OXFA 3NZSA 1YA0A 1ZUEA 5A7DB 2QSGA 4JB8P 1D8DA 3DEPA 5FTPA 4XE0A 2IO2C 1ELKA 3D9HA 1TNUA 4L2YA 1HXIA 3DSXA 3D9OA 1JPLA 4GA0A 4TXPA 4B0ZA 4GYYA 2WXJA 4OVUA 2RNGA 3E33A 1GL9B 5KJKA 2KCKA 2OV8A 2XHEA 2MRIA 3DWLG 4L23A 2V8SE 3AG4E 1ELWA 1S64A 3C5RA 2CFZA 3G2UA 2IQCA 4QQIA 3R7RA 2WXRA 1D8EA 3I4GA 5B3SE 5CEDB 5HS0A 4FULA 4B93B 3N71A 3QKYA 4GAAA 4HOQA 3L82A 3C3QA 2H6GA 4HNAD 2OEVA 4N3CA 2F0YA 1OWOA 5JJTA 4UI9C 3Q7FA 3ZXSA 2VSYA 3CQCB 3L08A 3G2VA 1BI7B 1N4PA 2WVIA 4BX9A 5ENRD 1TJCA 1LD7A 3O48A 1ATXA 3T9KA 1XNFA 3LYAA 1W3BA 4HS2A 4ILHB 3FFLA 4Q96A 3LMSB 3DPYA 1IHGA 2P9UG 2LO6A 5JJ7A 2VQ2A 1ZU2A 1NA0A 1U2VG 4HLLA 1NI1A 4F3VA 5KBAA 2JEKA 5EIBE 1BPOA 4JA7A 4DLOA 3U64A 3CK7A 4U95D 1IYGA 2FEZA 2YHCA 2XGOA 3SO8A 4FADA 3F6QA 2H9XA 4UWGA 4KVOA 4ANVA 1TNZA 4B94A 5CMWA 3NAWA 1HZ4A 2XQ0A 3ASDA 2XPIA 1BI8B 1TN8A 2X6FA 2EQXA 1N4RA 3FTWA 4NURA 2V4HC 1N94A 5CRUA 1UW4B 4GZ3A 3FUJA 1N9AA 4AV7A 3AU5A 3APCA 1E8WA 1EF1C 3HG0D 3U9WA 2XEHA 3KSLA 3SF4A 3HXCA 2JTOA 4PS3A 3TWTA 3ZFWA 4U8VD 5ENPD 4OAUC 4LCTA 2A5EA 4HLEA 4C0EA 2KBXA 1HG2A 5FINA 5G55A 3LVRE 3LY8A 2IOLA 4K5BA 3LEWA 3VLDA 1NA3A 3IHYA 3OAWA 2I1KA 4ATZD 3RKVA 4BSZB 4PS8A 3LPZA 3UTMA 2DCPA 3OXGA 3ZHEA 4EPZA 2YHEA 3JQ1A 3TXNA 5LOZA 3ABLE 3AU4A 3V2OA 4HOTA 1HS6A 3URZA 4N5QA 2HJ9C 2GRQB 5ENSD 4G8LA 5CRVA 4BY6A 4WNEA 2WXFA 2WXQA 2ZGDA 3FH8A 2XPYA 2L0IA 1KZPA 1VDYA 4I43A 3GZ1A 3ASGA 3ABME 4G25A 3G2TA 5G04J 3DRAA 5LCWC 2DYRE 2KC7A 1BD8A 4RSYA 4G11A 5FZRA 4G26A 3HHMA 4CT4A 3PUJA 1BDSA 3T8MA 5AQ9A 4H7YA 4UI9K 1K1BA 2H6FA 5KJLA 4WUYA 2CFUA 3UM2A 2ETBA 2DVWA 3UKRG 4UWKA 2E2EA 1MHQA 4AVXA 4YVOA 3NZUA 3SQVA 5EN5D 4BFRA 3ASOE 2RD0A 5FJYA 4JC8A 2V5FA 4N2SA 2WMOA 4BEPA 2IKDA 3HVEB 4JPSA 4QFVA 2DWZA 5E75A 3S7JA 3T5XA 3UM3A 2QSHA 5HI7A 2VTBB 3L13A 3SFZA 4I1AA 4CGWA 4UQZA 5ENOD 3U4TA 3TWUA 3PEVB 5ANRA 3B7TA 3G2WA 4MBGA 5ARGA 2LNIA 3FWVA 3T8KA 1HU3A 4G24A 3RRUA 2RKKA 3CR3A 3FUMA 3X2QE 3PZ1A 3MZLB 4I6GA 1U3CA 1Z6TA 1TEZA 5ITZF 4LUNU 1KPSB 4I2WA 2VGXA 3G2SA 1JWGA 5CBNA 4XI0A 1N11A 3MKRA 5AJLA 1OWMA 3PRZA 1SVXA 3C72A 4CDNA 1H0AA 3SFXA 4LRZA 5EIDA 5EILA 4L7TA 3TG4A 1IKND 2Y3AA 4LNGA 1H6KA 2BUGA 2PNNA 2RG8A 3ZNGA 1QZ2A 2BEDA 3EHMA 3FUKA 5CCLA 2L6BA 3Q78A 3EIQC 4GA2A 2HYZA 3LJ3A 4I1OB 2ETAA 2PM7A 3EHRA 3R7QA 1QBQA 5BT1A 3CSFA 3QWPA 4I1MA 4UI9J 3RJVA 4AIFA 4IYPA 3V31A 2AXVA 2V0PA 5AQAA 3HXFA 2JR3A 3CGHA 5JA4D 5CCMA 3E34A 2P9KG 1A17A 3UX4A 1H2UA 3Q5MA 2LXMA 3ZN3A 3Q49B 5HQ8A 2R03A 3DXKG 3PZ3A 1U3DA 4HRNA 1ELRA 4MKTA 3RO3A 3MYVA 1UOHA 3ZPJA 2EINE 5FZSA 1E8ZA 1FVHA 3P2BA 2Y4UA 3FEYA 4AJWA 4AOFA 1LF8A 4BTAA 1MZCA 3Q4AB 4K0RA 5D66A 4EZKA 2A5UA 4B8CB 1Z3XA 3J5QB 2H6IA 5B1BE 4EECA 3IF4A 1INZA 5M72A 4NACA 5EKQD 5JMND 4GTRA 1ZLIB 4Q94A 4XKCA 2CG2A 3MCXA 3Q47B 4FJZA 4WNFA 4ACLA 2WMNA 2F37A 4L1BA 3AAAC 3BU8A 3UM0A 1PC2A 3ZVVA 2GRRB 3RSEG 2VSNA 3CVPA 1HF8A 4CEMA 4Z68A 3ZW3A 5ARFA 3B95A 4KT6B 3DSVA 4KZCA 2KCLA 3CKCA 1H2TC 5AQBA 1RW2A 4HOUA 1KT1A 3JXJA 4U8HA 3O4ZA 4DX6D 3UT7A 2ZGGA 3ML9A 5LX8A 3OTNA 4GTVA 1KZOA 1FT2A 4C0MA 1Z3YA 3APDA 3SHFA 3PH0C 4J6IA 1WQKA 1PY1A 3B13A 3QNKA 2C2LA 1Y8MA 4RLYA 1H2VC 3ZEFA 3DSSA 2FF4A 3FDHA 3TWXA 5ENTD 4HB5A 2Y1LE 3MKQA 3SZ7A 4BT8A 5EX0A 3ABKE 4KMOA 4DLQA 5IY5E 1HFAA 4M3OA 3QB2A 1SA5A 1LD8A 4J8EA 1X81A 3DBSA 5CERB 3UQ3A 3CIAA 5LCWJ 4OVVA 1S63A 3B7UX 4YIRA 1OCCE 3CSTA 3TWRA 3PS6A 1WM5A 3FTSA 5T3RA 3UM1A 5J08A 4I6EA 4GU5A 3KS2A 3UT8A 3U3WA 3RRNB 1FT1A 2WXPA 4RVBA 4TV3A 1N0RA 5FQ7A 3RU0A 2IFUA 2OVFA 2J4BA 3JCKC 4G2VA 4A55A 1APFA 2ILRA 4CDRA 3D9MA 3I5PA 2WXGA 3OXLA 2XEVA 4HORA 3LY9A 1WAO1 5CHEE 3VLEA 4N3AA 4BX8A 3I4RB 1QNFA 3FEXA 2KCVA 5A6CA 4AM9A 3ZXPA 1TYQG 2QY7A 4J8YA 3UPVA 5CBOA 2B6CA 2DZNA 3D9KA 3CVQA 4J8SA 5G05J 4DUIA 3CK9A 3BQOA 3ASNE 4GZDA 5KWDA 2XCBA 2ETCA 1OUVA 4KVMA 2X38A 2HJEA 1AHLA 4GYOA 2I9CA 2GRNB 3IBEA 2FULA 2XGSA 1Q2ZA 4FHJA 4LNBA 2XEEA 4HOSA 4CGVA 1N4SA 2CHWA 2LSVA 3C98A 2BTDA 3FUNA 5FZQA 3QDNA 4XI9A 3U66A 2L0TB 2XPZA 2LUHA 4O1OA 4CCAA 3DPDA 3FHEA 3PDNA 3TXMA 2B0OE 3D9PA 1SHIA 2GROB 4GTSA 5JJ6A 4WNDA 3ZYLA 2Y0BG 1B89A 1MX2A 1OWLA 3Q75A 1ZBPA 5DIZA 4J8DA 4JA9A 3L9TA 2BKGA 3UUXA 3SBTB 5FQ4A 4P29A 5G2NA 4LEUA 3C30A 1YYHA 3EIJA 3LJNA 1O1RA 4I9EA 3TWSA 4FLHA 3CKBA 2KZTB 1UN9A 2X6IA 2XRZA 3J5PA 2HM8A 4GB9A 1TNBA 3S2AA 1V54E 1H19A 2MOWA 3NF1A 4HRMB 3CHOA 3ONKA 3VTXA 4LNUD 1D9SA 3AS5A 2F8YA 2MYOA 4E85A 3HXBA 2XGMA 5T4YA 3GZSA 2YNQA 2QYUA 3Q9UC 3C3OA 2WM9A 3RIBA 1FPPA 4HQDA 2RFAA 4EHMA 4KXKB 2K2XA 2R2LA 3NOGD 2PZIA 2V4LA 3SI5A 2P2CP 4LSZE 3TWQA 2IF4A 4GYWA 3C38A 1E90A 2VGEA 1B8WA 3D9LA 1G3NB 3DSUA 4ME2A 3CVXA 3QWWA 5ANLA 3RK6A 4JHKA 5BV0A 3TL5A 1AP7A 1NZNA 1TNYA 2Y69E 3CVWA 2VSXE 2XENA 1OCRE 4N3BA 5E76A 2A4ZA 3K9IA 3PVLA 4FP7A 4E6HA 5JHBA 2M63A 4CT0A 3NB2A 4N39A 2C0LA 4FJYA 3ULQA 4U07A 2HO1A 3FTZA 4CZ2D 2XZTG 4ZFHA 4K5AB 4XIFA 2P9NG 4ANXA 3ZYMA 5ENNA 2GRMA 4D10C 1E8XA 4MS6A 5LFAA 1ZUFA 2OOEA 1O1TA 2IEJA 3SY2A 4KZ0A 1IQRA 2GRPB 4I6JA 3ESKA 5C2YA 2BKKB 4NIKA 4GMJA 3FU5A 1IQUA 2BF0X 4U8YD 3EJNA 3HVEA 5DBKA 3EDTB 1YMPA 4XEIG 1HX8A 4CYMD 5BPPA 3PNLB 2DIWA 4UWLA 1E8YA 4X8QA 4BETA 5KJMA 2VTBA 4GCOA 2VSOE 3L6AA 1Y6IA 4O6FA 4MLPA 4GTTA 1N0QA 4DK5A 2PL2A 3FU6A 2R5SA 2IOSA 4UWHA 3V2XA 3LY7A 3PZ4A 4ACKA 3ZYQA 2B9KA 2UY1B 3JUIA 3DSTA 4AY5A 1E7UA 4YDEA 2GGFA 3TAXA 3ENEA 5FQ6A 5JHAA 3LXUX 2ZU6B 3FH7A 1MQSA 3ZKJA 1O1SA 4JL0A 3FTUA 2VYIA 4KYOB 1MYOA 1TNOA 2KXPC 1UG3A 3UKUG 4TRQA 1AWCB 4ILIA 4EZLA 4HXIA 4I2ZA 5BNWA 1OWNA 4C48B 2PQNA 4DX5D 4EQFA 3FUFA 5C1DA 2AVPA 1XGWA 1O5MA 4YDWA 2IONA 1L5JA 5AN8A 2EIKE 4A3VA 5AQ7A 3GZ2A 1A5EA 3L16A 2P9IG 4MRUA 1E96B 1EPUA 2P9PG 2AJAA 4BESA 3TWVA 2LAHA 2J49A 2NYJA 4I9CA 2L9BA 1V55E 3FH5A 4EBAA 3ML8A 4JD2G 3AS8A 3QAQA 1FVFA 3JUEA 4ANUA 2BDSA 4KBQA 4TXQA 2CHXA 1KLXA 3IHVA 3BUAA 5G04C 3V79K 2I2OA 3E30A 4J7WA 2P9SG 2R17C 4Y6CA 3ZGQA 3ASHA 2SH1A 4GTOA 4FLBA 3MGBA 5J90A 4UQYA 4U63A 4PS7A 2V5QC 3FP3A 2YQ8A 3QJZA 3FULA 1NFIE 3HXEA 1MJ0A 4ATGA 4LERA 1MX6A 3S7DA 4JHJA 2LXLA 1P5QA 1UJKA 3FY4A 3UIOC 4XX5A 2J07A 3UMVA 1HO8A 3MKQB 1OWPA 1ZB1A 4GMLA 2X6JA 4A3TA 2ZIRA 2EIJE 1OY3D 3RO2A 5KNGA 4APFA 2JABA 5ENQD 3IKOB 4F1PA 2DYSE 4BWRA 4F6RD 2UWJG 3CVUA 2CG3A 4YNDA 4B8AA 3KAEA 3AG1E 3CV0A 4BTBA 1ZLHB 2IO3C 2HE0A 4W9RA 3ZU7B 5EYLA 1MX4A 3HIZA 1WDYA 1K8KG 4JHRA 4DX1A 4IRUA 4JW1A 2KM4A 4RQIA 1DNPA 3FTVA 2DZOA 1HE8A 2MHKA 5T8IA 4DPRA 3KSQA 4YDOA 3R9AB 1SZAA 3BG1B 5KNHD 4TUUA 3IV0A 1DVPA 3ZRHA 2J9QA 3CHRA 3FUEA 4GTPA 4BERA 3PZDA 2X3MA 4Q69A 2GW1A 2OVBA 3ULYA 4PDXA 4WWOA 1ZHHB 3MA5A 4GZCA 3LDZA 4GZ5A 3DEOA 3L17A 3FTYA 3CVVA 4FU3A 3QOUA 2L6JA 4DI3A 2FBNA 2P9LG 3CLJA 3GW4A 2DLAA 2JLBA 4NRHB 3TG5A 4CDMA 3E32A 4A1SA 3PE4A 4HBDA 1DCEA 4BSXA 5EYPF 1HG5A 1K3ZD 1JCRA 3VTYA 4GPKA 1IHBA 2MN3A 2WXKA 3CEQA 4K03A 4HFGA 2XCCA 4JVSA 3UINC 5FIOA 5HKPA 2XRYA 1NL4A 4H7XA 4U0SA 4WNGA 4K5CA 1TN7A 4AEZC 3HDXA 3JQ0A 3QK0A 4JEHA 3MX3A 2WXNA 2J8SD 2J08A 2WXHA 2EIME 3SNXA 3FTXA 3SFYA 1SH1A 5EX3A 3VLFA 4TXRA 4DRXE 3AJIA 5D2MC 5AAOA 4F1SA 2X6KA 1K1AA 3RRMB 5FQ8A 1TJFA 3CHQA 2Y4TA 3ISMC 4AP2A 1BU9A 2VJ8A 4ILGA 1EL6A 3UXGA 3UT4A 5BV1A 3BG0B 2ONDA 4PUCA 5CMYA 3CVLA 4V3IA 3AG3E 3AS4A 3LCAA 4DJAA 4ANWA 3JYSA 3PEUB 4LG6A 3NBNB 3RAUA 3S7FA 4URKA 1OCZE 4U96D 3ZIMA 4F53A 4HI9A 2XS8A 3E4BA 3ZHEB 2FI7A 2QFCA 4O60A 5CEAA 1GKUB 4DX7D 4ZHBA 4FC8A 2WXMA 2R05A 1EDUA 3FUHA 4U0UA 3ZYKA 2YINA 3T5VA 2QZAA 4FHKA 2LAIA 3V30A 4XZ4A 4UQXA 4FA6A 2NC9A 3KEAA 3QWVA 4UUCA 4PH4B 5KCMA 1WG0A 4DX2A 4TUMA 4U0ZA 2AXUA 4L2LA 4N2QA 4EBAG 4RG9A 4IN3B 5AYWD 2Q7FA 4NQ0A 2GRLA 3PUKA 1OCOE 3DSWA 5BUZA 3HXDA 3IEGA 3LVQE 2R59A 2H6HA 4GV5A 1PAQA 4U04A
chains in the Genus database with same CATH topology
5JJ7A 1IHGA 3KD7A 2LO6A 4DK5A 2PL2A 3FU6A 2VSNA 2R5SA 3CVPA 2IOSA 4J0UA 4UWHA 1SZ9A 2VQ2A 1ZU2A 1HF8A 3TGOA 4CEMA 1S0PA 3LY7A 2NXPA 1NA0A 4ACKA 3ZW3A 5ARFA 3ZYQA 4F3VA 2IJGX 4KT6B 2B9KA 4KZCA 3FU3A 2UY1B 3JUIA 2KCLA 3CKCA 2MUBA 1H2TC 4J8FA 4AY5A 2JEKA 4HOUA 1KT1A 1BPOA 1E7UA 2KZTA 3GYZA 3O4ZA 4U8HA 3SBSA 4C9BB 4HVBA 4APOA 2GGFA 4JA7A 5BW8C 3ENEA 1HH8A 3TAXA 5FQ6A 4DLOA 5JHAA 4EZJA 3LXUX 2ZU6B 3UT7A 3U64A 3FH7A 3CK7A 3ML9A 5LX8A 1IYGA 2FEZA 2YHCA 2XGOA 3OTNA 4Y6WA 1MQSA 4GCNA 4C0MA 1Z3YA 4FADA 2H9XA 3APDA 3SHFA 4JL0A 4UWGA 3PH0C 4XKBA 4KVOA 3FTUA 4ANVA 5A23A 2VYIA 3FUDA 4J6IA 3Q15A 4KYOB 1WQKA 1PY1A 3B13A 3CQGB 3QNKA 2C2LA 4B94A 1UG3A 1Y8MA 1H2VC 4TRQA 4GA1A 5CMWA 3ZEFA 1HZ4A 3WXXA 2XQ0A 2FF4A 3FDHA 4ILIA 3D3MA 3ASDA 3APFA 3D4UB 4EZLA 3D9JA 2AW6A 2XPIA 3MKQA 3SZ7A 3LS8A 4BT8A 5EX0A 4HXIA 4I2ZA 4WWNA 1JUQA 1N54A 1OWNA 2EQXA 2X6FA 4KMOA 4N5CA 4OYSA 5D0OD 3FTWA 4DLQA 2PQNA 1HFAA 4NURA 4M3OA 3QB2A 4J8EA 3QARA 2XXLA 4EQFA 3DBSA 1H5OA 3FUFA 1UW4B 4GZ3A 3CHMA 5C1DA 3FUJA 2AVPA 4AV7A 1XGWA 2WPVA 3AU5A 3APCA 3UQ3A 1E8WA 1Z99A 3CIAA 5LCWJ 1EF1C 2VGXB 3U9WA 3SF4A 2JTOA 3D9IA 1WXNA 4PS3A 2IONA 4OVVA 3ZFWA 1L5JA 2DBAA 3ESLA 3B7UX 4YIRA 4A3VA 2J4DA 5AJDA 3GZ2A 4LCTA 3L16A 4HLEA 3CSTA 4MRUA 4C0EA 3PS6A 1E96B 1EPUA 3NQPA 5EDSA 2IKEA 1HG2A 1WM5A 5G55A 2CHZA 3LVRE 2LAHA 2J49A 3FTSA 3LY8A 4I9CA 2L9BA 2I1JA 3FH5A 2IOLA 4EBAA 5T3RA 4CRWA 3ML8A 3AS8A 5J08A 3QAQA 1FVFA 2IU1A 2VGYA 3LEWA 2BDSA 4ANUA 4KBQA 4I6EA 4GU5A 3KS2A 2CHXA 3VLDA 1KLXA 3CHSA 3UT8A 3RRNB 5G05C 3U3WA 4R7LA 2WXPA 3IHVA 1NA3A 4RVBA 5G04C 2I2OA 3IHYA 4YVQC 4B89A 3OAWA 5AENA 2J09A 4TV3A 5FQ7A 2R17C 2I1KA 4Y6CA 3RU0A 3ZGQA 2IFUA 2OVFA 2WQ6A 3RKVA 2J4BA 4PS8A 3JCKC 3ASHA 3LPZA 4G2VA 4A55A 1APFA 2DCPA 3PE3A 2ILRA 4G1TA 3OXGA 2AWIA 3ZHEA 4BT9A 4CDRA 3D9MA 2SH1A 3I5PA 2WXGA 4FLBA 3MGBA 3OXLA 2PQRA 2XEVA 4EPZA 5J90A 2YHEA 3JQ1A 4HORA 4UWFA 3LY9A 1UJJA 4UQYA 1WAO1 5CHEE 1E7VA 5LOZA 3TXNA 3AU4A 2X6HA 4AXHA 4HOTA 1HS6A 4I17A 4U63A 4PS7A 3URZA 4N3AA 3B7SA 3VLEA 5FT9A 3FP3A 2HJ9C 2YQ8A 4BX8A 3QJZA 3FULA 3I4RB 4BY6A 1QNFA 4F7AA 4WNEA 2WXFA 2HR2A 4ATGA 4LERA 1FCHA 2WXQA 3FEXA 3S7DA 3FH8A 2KCVA 5A6CA 4JHJA 4AM9A 2XPYA 1P5QA 2L0IA 2QY7A 1UJKA 3FY4A 1VDYA 4I43A 4XX5A 3UPVA 1WY6A 2J07A 3UMVA 1HO8A 3D9KA 3MKQB 3CVQA 1OWPA 3GZ1A 3L54A 4J8SA 5G05J 3CK9A 4GMLA 3ASGA 4G25A 3TJPA 3G2TA 5G04J 5LP0A 2X6JA 5LCWC 4A3TA 3FUIA 4ABNA 2KC7A 1KT0A 4GZDA 1X5BA 3RO2A 3MV2B 3KEZA 4RSYA 3CVNA 2XCBA 4APFA 4G11A 5FZRA 4G26A 1OUVA 3IKOB 2FO7A 3CK8A 3HHMA 4KVMA 2X38A 2HJEA 1AHLA 4GYOA 4CT4A 2I9CA 2WQHA 4BWRA 2WXOA 3IBEA 3PUJA 1BDSA 2UWJG 3T8MA 2CG3A 4YNDA 3CVUA 2FULA 4G23A 3KAEA 4H7YA 4UI9K 4B8AA 2XGSA 4RG6A 3CV0A 4BTBA 5KJLA 4FHJA 4WUYA 1ZLHB 2CFUA 4W9RA 4HOSA 1D6BA 3HIZA 4CGVA 3PREA 4UWKA 2CHWA 2E2EA 2LSVA 1UN8A 4JHRA 4IRUA 3ONLA 1MHQA 3C98A 2BTDA 3FUNA 4JW1A 3QDNA 5FZQA 2KM4A 4AVXA 2WXLA 4YVOA 4XI9A 3NZUA 1DNPA 3U66A 2L0TB 2XPZA 3FTVA 5FWQA 4CCAA 4GZ6A 4BFRA 3DPDA 1HE8A 2MHKA 2RD0A 5FJYA 5T8IA 3FHEA 4DPRA 3PDNA 4JC8A 5D0QD 2UY1A 2V5FA 4N2SA 2WMOA 3TXMA 3D9PA 3R9AB 4WWPA 1SHIA 1SZAA 5JJ6A 3BG1B 3HVEB 4WNDA 3ZYLA 4TUUA 3IV0A 2IKDA 3FU0A 4JPSA 4QFVA 3S7JA 4JEUA 1DVPA 5E75A 3T5XA 3ZRHA 2QSHA 3QC1A 1SQMA 4WAFA 3CVYA 1B89A 2J9QA 1OWLA 3CHRA 3FUEA 5HI7A 3PZDA 2X3MA 3D9NA 4Q69A 2VTBB 2GW1A 3S7BA 3L13A 2OVBA 3SFZA 4I1AA 1QQEA 4PDXA 4CGWA 1ZBPA 4UQZA 5DIZA 2WXIA 4J8DA 3MJWA 3P1UA 4WWOA 1ZHHB 2PM6A 4JA9A 3MA5A 3UUXA 3U4TA 2WB2A 2I6HA 4GZCA 3LDZA 3HYMB 4JZYA 3SBTB 5FQ4A 3PEVB 4GZ5A 3L17A 4P29A 5ANRA 3B7TA 3CHPA 5G2NA 3G2WA 2C0MA 3FTYA 4LEUA 3SGHA 3CVVA 5ARGA 2LNIA 3FWVA 4FU3A 3C30A 3EIJA 3QOUA 2L6JA 4DI3A 2QSFA 2FBNA 1HU3A 4G24A 3CLJA 1GW6A 4JXTA 3PNTB 3RRUA 4I9EA 2P58C 4FLHA 3CKBA 3GW4A 2KZTB 1UN9A 2X6IA 4DI4A 3CR3A 2XRZA 2DLAA 3FUMA 2HM8A 2JLBA 4GB9A 3MZLB 4NRHB 3TG5A 3MEKA 4CDMA 4A1GA 3S2AA 4I6GA 2WQ7A 1U3CA 1Z6TA 3ASFA 1H19A 2MOWA 3NF1A 4A1SA 1TEZA 3PE4A 3SD5A 3CHOA 1N52A 4LUNU 3ONKA 4I2WA 3BEEA 2VGXA 3G2SA 2KATA 3I3NA 4BSXA 1JWGA 3VTXA 1HG5A 4XI0A 3AS5A 3LMSB 3MKRA 3VTYA 4GPKA 4E85A 5AJLA 1OWMA 2XGMA 5T4YA 5BNWA 2MN3A 3GZSA 3PRZA 2YNQA 2WXKA 5KJNA 3CEQA 4K03A 4CDNA 4HFGA 2LSUA 1H0AA 2XCCA 4JVSA 4LRZA 2XRYA 4H7XA 4L7TA 3TG4A 4U0SA 1EYHA 5AIJA 4WNGA 4AY6A 2E0IA 1JWFA 2WM9A 3RIBA 4AEZC 3MV3B 2Y3AA 3HDXA 3JQ0A 1H6KA 2BUGA 3QK0A 4JEHA 3EHNA 3B7RL 3MX3A 2RG8A 2WXNA 2J08A 1NP7A 1QZ2A 2NSZA 2WXHA 4IULA 3SNXA 3EHMA 3L22A 3FTXA 4KXKB 2K2XA 1SH1A 3FUKA 5CCLA 5EX3A 3VLFA 2AXZA 3LKUA 3OXFA 3EIQC 4GA2A 3NZSA 2HYZA 4F1SA 3LJ3A 2PZIA 2V4LA 3SI5A 4I1OB 2PM7A 2X6KA 3R7QA 1YA0A 1ZUEA 5BT1A 3CSFA 3QWPA 5A7DB 2QSGA 2IF4A 3RRMB 4GYWA 4I1MA 4UI9J 5FQ8A 5FTPA 3RJVA 4AIFA 1E90A 4IYPA 1TJFA 3C38A 3CHQA 2Y4TA 4XE0A 2AXVA 1B8WA 2V0PA 4AP2A 3D9LA 3CVXA 4ME2A 1ELKA 3QWWA 2VJ8A 4ILGA 4L2YA 5ANLA 2JR3A 3RK6A 3UT4A 3CGHA 5CCMA 4JHKA 5BV1A 3BG0B 1A17A 1HXIA 2ONDA 3UX4A 5BV0A 1H2UA 4PUCA 5CMYA 3CVLA 3Q5MA 3D9OA 1JPLA 3TL5A 4GA0A 4V3IA 1NZNA 3ZN3A 4B0ZA 3Q49B 4GYYA 2WXJA 4OVUA 3AS4A 5HQ8A 2RNGA 3LCAA 4DJAA 3CVWA 4ANWA 3JYSA 2VSXE 4N3BA 5E76A 5KJKA 2A4ZA 1U3DA 3K9IA 3PEUB 2KCKA 3PVLA 2OV8A 2XHEA 4FP7A 1ELRA 4E6HA 4MKTA 5JHBA 2M63A 3RO3A 3MYVA 2MRIA 4CT0A 3S7FA 4L23A 2V8SE 4URKA 4N39A 3ZPJA 1ELWA 2C0LA 5FZSA 3ZIMA 4F53A 1E8ZA 1FVHA 4FJYA 3P2BA 3ULQA 2Y4UA 3E4BA 3ZHEB 2CFZA 2FI7A 3G2UA 2QFCA 4U07A 2IQCA 3FEYA 2HO1A 3R7RA 3FTZA 2WXRA 4AJWA 3I4GA 4FC8A 2WXMA 4XIFA 4AOFA 4ANXA 1LF8A 3ZYMA 5ENNA 1EDUA 4BTAA 3FUHA 3Q4AB 2GRMA 4U0UA 4D10C 4K0RA 1E8XA 4EZKA 4MS6A 2A5UA 4B8CB 3ZYKA 2YINA 1Z3XA 3T5VA 5LFAA 1ZUFA 2OOEA 4FHKA 2LAIA 4FULA 3N71A 4XZ4A 3QKYA 4GAAA 4EECA 4KZ0A 1IQRA 4HOQA 4I6JA 4UQXA 1INZA 4FA6A 5M72A 3ESKA 5C2YA 4NACA 2NC9A 3QWVA 5EKQD 4GMJA 3FU5A 1ZLIB 1IQUA 4PH4B 2BF0X 5KCMA 4N3CA 4Q94A 3EJNA 3HVEA 5DBKA 1OWOA 4XKCA 3EDTB 4UI9C 5JJTA 3ZXSA 2VSYA 4U0ZA 2CG2A 3CQCB 1HX8A 2AXUA 4L2LA 3MCXA 3Q47B 4EBAG 4N2QA 4RG9A 5BPPA 3L08A 3G2VA 4FJZA 3PNLB 4IN3B 4WNFA 5AYWD 2Q7FA 2DIWA 4ACLA 4NQ0A 2WVIA 2GRLA 3PUKA 4UWLA 2WMNA 1E8YA 4BX9A 4L1BA 5KJMA 2VTBA 4GCOA 2VSOE 5BUZA 1TJCA 3IEGA 3O48A 3L6AA 3LVQE 1ATXA 1Y6IA 4O6FA 1XNFA 3LYAA 1W3BA 4HS2A 2R59A 4ILHB 3FFLA 4MLPA 1PC2A 4GV5A 4Q96A 3ZVVA 1PAQA 4U04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHN A;  3OTN A;  3SGH A;  3MX3 A;  3IHV A;  3MYV A;  3SNX A;  3MCX A;  3EHM A;  3L22 A;  3KEZ A;  4MRU A;  5T4Y A;  4Q69 A;  3GZS A;  3CGH A;  3NQP A;  5FQ7 A;  3CK8 A;  4F53 A;  4F7A A;  4LER A;  3CKB A;  3CKC A;  3JQ0 A;  3QNK A;  4PUC A;  3P1U A;  4L7T A;  5T3R A;  3FDH A;  5FQ6 A;  3JYS A;  3LEW A;  5FQ4 A;  5FQ8 A;  3I4G A;  3IV0 A;  5E76 A;  3CK9 A;  5J90 A;  3HDX A;  3JQ1 A;  3CK7 A;  5LX8 A;  5E75 A;  3EJN A; 
#chains in the Genus database with same CATH topology
 3KD7 A;  3B7B A;  4J0U A;  1SZ9 A;  1RZ4 A;  3TGO A;  1S0P A;  2NXP A;  2FO1 E;  2IJG X;  3FU3 A;  2MUB A;  4J8F A;  3SBS A;  3GYZ A;  2KZT A;  4C9B B;  4HVB A;  4APO A;  5BW8 C;  2XZD G;  1HH8 A;  4EZJ A;  1OXJ A;  5AAR A;  4Y6W A;  2QYJ A;  2RFM A;  4GCN A;  3EU9 A;  4YDY A;  4XKB A;  3JXI A;  5A23 A;  3FUD A;  3Q15 A;  2XS1 A;  3CQG B;  3WG7 E;  4GA1 A;  3WXX A;  3D3M A;  4A63 B;  3APF A;  3D4U B;  3D9J A;  2AW6 A;  3LS8 A;  4WWN A;  1JUQ A;  1N54 A;  4GMR A;  4N5C A;  4OYS A;  5D0O D;  3E37 A;  3QAR A;  2XXL A;  4M7C A;  1H5O A;  3CHM A;  1IXV A;  3TWW A;  2WPV A;  1Z99 A;  2EIL E;  2VGX B;  3D9I A;  1WXN A;  2DBA A;  3ESL A;  3Q7A A;  2J4D A;  5AJD A;  3PZ2 A;  4G8K A;  2OCC E;  3NQP A;  5EDS A;  2IKE A;  2CHZ A;  3UIP C;  4GTM A;  2I1J A;  4CRW A;  4O1P A;  2IU1 A;  2VGY A;  3CHS A;  5G05 C;  1SW6 A;  4R7L A;  4YVQ C;  4B89 A;  3ZUV B;  5AEN A;  2J09 A;  2WQ6 A;  3PE3 A;  4HRL A;  4G1T A;  1SA4 A;  2AWI A;  4BT9 A;  1Z5S C;  4OAV B;  2PQR A;  4UWF A;  1UJJ A;  5CEC B;  4AXH A;  1E7V A;  3DXM G;  2X6H A;  4I17 A;  3B7S A;  5FT9 A;  5B1A E;  4U7E B;  3Q79 A;  4F7A A;  2HR2 A;  1FCH A;  4L9P A;  2R02 A;  1LTX A;  3NOC D;  1WY6 A;  5BXO A;  3L54 A;  1N95 A;  1TN6 A;  3TJP A;  5LP0 A;  3FUI A;  4ABN A;  1KT0 A;  5HRY A;  1X5B A;  3MV2 B;  3KEZ A;  3CVN A;  2FO7 A;  3CK8 A;  3IXE A;  2WQH A;  2WXO A;  4G23 A;  3UI2 A;  4RG6 A;  2ZIS A;  1D6B A;  3PRE A;  1H6O A;  1UN8 A;  3ONL A;  1S70 B;  5BXU A;  2WXL A;  1BLX B;  2ZXW E;  3EHQ A;  5FWQ A;  4GZ6 A;  5D0Q D;  2UY1 A;  4WWP A;  3FU0 A;  4JEU A;  3QC1 A;  1SQM A;  4WAF A;  3CVY A;  5H7P A;  3W9G A;  1DC2 A;  3D9N A;  3S7B A;  2F8X K;  1QQE A;  1JCQ A;  2QC9 A;  2WXI A;  3MJW A;  3P1U A;  2PM6 A;  1YCS B;  2I6H A;  2WB2 A;  4JZY A;  3HYM B;  3CHP A;  4GPM A;  2C0M A;  3SGH A;  1DCQ A;  3HRA A;  1JCS A;  2QSF A;  1H6P A;  1GW6 A;  3AG2 E;  4JXT A;  3PNT B;  1N4Q A;  2P58 C;  4DI4 A;  4HI8 A;  3ULE G;  1TR4 A;  3MEK A;  4A1G A;  2WQ7 A;  3ASF A;  3SD5 A;  1N52 A;  3BEE A;  3W9F A;  2KAT A;  3I3N A;  4GTQ A;  3Q73 A;  2IY0 C;  3C3R A;  3EU5 A;  3Q9N C;  5KJN A;  2LSU A;  3EUV A;  1QYM A;  1EYH A;  5AIJ A;  4AY6 A;  2E0I A;  1JWF A;  3R9M A;  1OT8 A;  3MV3 B;  3EHN A;  3B7R L;  4IUL A;  1NP7 A;  2NSZ A;  3L22 A;  2OEW A;  2AXZ A;  3LKU A;  3OXF A;  3NZS A;  1YA0 A;  1ZUE A;  5A7D B;  2QSG A;  4JB8 P;  1D8D A;  3DEP A;  5FTP A;  4XE0 A;  2IO2 C;  1ELK A;  3D9H A;  1TNU A;  4L2Y A;  1HXI A;  3DSX A;  3D9O A;  1JPL A;  4GA0 A;  4TXP A;  4B0Z A;  4GYY A;  2WXJ A;  4OVU A;  2RNG A;  3E33 A;  1GL9 B;  5KJK A;  2KCK A;  2OV8 A;  2XHE A;  2MRI A;  3DWL G;  4L23 A;  2V8S E;  3AG4 E;  1ELW A;  1S64 A;  3C5R A;  2CFZ A;  3G2U A;  2IQC A;  4QQI A;  3R7R A;  2WXR A;  1D8E A;  3I4G A;  5B3S E;  5CED B;  5HS0 A;  4FUL A;  4B93 B;  3N71 A;  3QKY A;  4GAA A;  4HOQ A;  3L82 A;  3C3Q A;  2H6G A;  4HNA D;  2OEV A;  4N3C A;  2F0Y A;  1OWO A;  5JJT A;  4UI9 C;  3Q7F A;  3ZXS A;  2VSY A;  3CQC B;  3L08 A;  3G2V A;  1BI7 B;  1N4P A;  2WVI A;  4BX9 A;  5ENR D;  1TJC A;  1LD7 A;  3O48 A;  1ATX A;  3T9K A;  1XNF A;  3LYA A;  1W3B A;  4HS2 A;  4ILH B;  3FFL A;  4Q96 A;  3LMS B;  3DPY A;  1IHG A;  2P9U G;  2LO6 A;  5JJ7 A;  2VQ2 A;  1ZU2 A;  1NA0 A;  1U2V G;  4HLL A;  1NI1 A;  4F3V A;  5KBA A;  2JEK A;  5EIB E;  1BPO A;  4JA7 A;  4DLO A;  3U64 A;  3CK7 A;  4U95 D;  1IYG A;  2FEZ A;  2YHC A;  2XGO A;  3SO8 A;  4FAD A;  3F6Q A;  2H9X A;  4UWG A;  4KVO A;  4ANV A;  1TNZ A;  4B94 A;  5CMW A;  3NAW A;  1HZ4 A;  2XQ0 A;  3ASD A;  2XPI A;  1BI8 B;  1TN8 A;  2X6F A;  2EQX A;  1N4R A;  3FTW A;  4NUR A;  2V4H C;  1N94 A;  5CRU A;  1UW4 B;  4GZ3 A;  3FUJ A;  1N9A A;  4AV7 A;  3AU5 A;  3APC A;  1E8W A;  1EF1 C;  3HG0 D;  3U9W A;  2XEH A;  3KSL A;  3SF4 A;  3HXC A;  2JTO A;  4PS3 A;  3TWT A;  3ZFW A;  4U8V D;  5ENP D;  4OAU C;  4LCT A;  2A5E A;  4HLE A;  4C0E A;  2KBX A;  1HG2 A;  5FIN A;  5G55 A;  3LVR E;  3LY8 A;  2IOL A;  4K5B A;  3LEW A;  3VLD A;  1NA3 A;  3IHY A;  3OAW A;  2I1K A;  4ATZ D;  3RKV A;  4BSZ B;  4PS8 A;  3LPZ A;  3UTM A;  2DCP A;  3OXG A;  3ZHE A;  4EPZ A;  2YHE A;  3JQ1 A;  3TXN A;  5LOZ A;  3ABL E;  3AU4 A;  3V2O A;  4HOT A;  1HS6 A;  3URZ A;  4N5Q A;  2HJ9 C;  2GRQ B;  5ENS D;  4G8L A;  5CRV A;  4BY6 A;  4WNE A;  2WXF A;  2WXQ A;  2ZGD A;  3FH8 A;  2XPY A;  2L0I A;  1KZP A;  1VDY A;  4I43 A;  3GZ1 A;  3ASG A;  3ABM E;  4G25 A;  3G2T A;  5G04 J;  3DRA A;  5LCW C;  2DYR E;  2KC7 A;  1BD8 A;  4RSY A;  4G11 A;  5FZR A;  4G26 A;  3HHM A;  4CT4 A;  3PUJ A;  1BDS A;  3T8M A;  5AQ9 A;  4H7Y A;  4UI9 K;  1K1B A;  2H6F A;  5KJL A;  4WUY A;  2CFU A;  3UM2 A;  2ETB A;  2DVW A;  3UKR G;  4UWK A;  2E2E A;  1MHQ A;  4AVX A;  4YVO A;  3NZU A;  3SQV A;  5EN5 D;  4BFR A;  3ASO E;  2RD0 A;  5FJY A;  4JC8 A;  2V5F A;  4N2S A;  2WMO A;  4BEP A;  2IKD A;  3HVE B;  4JPS A;  4QFV A;  2DWZ A;  5E75 A;  3S7J A;  3T5X A;  3UM3 A;  2QSH A;  5HI7 A;  2VTB B;  3L13 A;  3SFZ A;  4I1A A;  4CGW A;  4UQZ A;  5ENO D;  3U4T A;  3TWU A;  3PEV B;  5ANR A;  3B7T A;  3G2W A;  4MBG A;  5ARG A;  2LNI A;  3FWV A;  3T8K A;  1HU3 A;  4G24 A;  3RRU A;  2RKK A;  3CR3 A;  3FUM A;  3X2Q E;  3PZ1 A;  3MZL B;  4I6G A;  1U3C A;  1Z6T A;  1TEZ A;  5ITZ F;  4LUN U;  1KPS B;  4I2W A;  2VGX A;  3G2S A;  1JWG A;  5CBN A;  4XI0 A;  1N11 A;  3MKR A;  5AJL A;  1OWM A;  3PRZ A;  1SVX A;  3C72 A;  4CDN A;  1H0A A;  3SFX A;  4LRZ A;  5EID A;  5EIL A;  4L7T A;  3TG4 A;  1IKN D;  2Y3A A;  4LNG A;  1H6K A;  2BUG A;  2PNN A;  2RG8 A;  3ZNG A;  1QZ2 A;  2BED A;  3EHM A;  3FUK A;  5CCL A;  2L6B A;  3Q78 A;  3EIQ C;  4GA2 A;  2HYZ A;  3LJ3 A;  4I1O B;  2ETA A;  2PM7 A;  3EHR A;  3R7Q A;  1QBQ A;  5BT1 A;  3CSF A;  3QWP A;  4I1M A;  4UI9 J;  3RJV A;  4AIF A;  4IYP A;  3V31 A;  2AXV A;  2V0P A;  5AQA A;  3HXF A;  2JR3 A;  3CGH A;  5JA4 D;  5CCM A;  3E34 A;  2P9K G;  1A17 A;  3UX4 A;  1H2U A;  3Q5M A;  2LXM A;  3ZN3 A;  3Q49 B;  5HQ8 A;  2R03 A;  3DXK G;  3PZ3 A;  1U3D A;  4HRN A;  1ELR A;  4MKT A;  3RO3 A;  3MYV A;  1UOH A;  3ZPJ A;  2EIN E;  5FZS A;  1E8Z A;  1FVH A;  3P2B A;  2Y4U A;  3FEY A;  4AJW A;  4AOF A;  1LF8 A;  4BTA A;  1MZC A;  3Q4A B;  4K0R A;  5D66 A;  4EZK A;  2A5U A;  4B8C B;  1Z3X A;  3J5Q B;  2H6I A;  5B1B E;  4EEC A;  3IF4 A;  1INZ A;  5M72 A;  4NAC A;  5EKQ D;  5JMN D;  4GTR A;  1ZLI B;  4Q94 A;  4XKC A;  2CG2 A;  3MCX A;  3Q47 B;  4FJZ A;  4WNF A;  4ACL A;  2WMN A;  2F37 A;  4L1B A;  3AAA C;  3BU8 A;  3UM0 A;  1PC2 A;  3ZVV A;  2GRR B;  3RSE G;  2VSN A;  3CVP A;  1HF8 A;  4CEM A;  4Z68 A;  3ZW3 A;  5ARF A;  3B95 A;  4KT6 B;  3DSV A;  4KZC A;  2KCL A;  3CKC A;  1H2T C;  5AQB A;  1RW2 A;  4HOU A;  1KT1 A;  3JXJ A;  4U8H A;  3O4Z A;  4DX6 D;  3UT7 A;  2ZGG A;  3ML9 A;  5LX8 A;  3OTN A;  4GTV A;  1KZO A;  1FT2 A;  4C0M A;  1Z3Y A;  3APD A;  3SHF A;  3PH0 C;  4J6I A;  1WQK A;  1PY1 A;  3B13 A;  3QNK A;  2C2L A;  1Y8M A;  4RLY A;  1H2V C;  3ZEF A;  3DSS A;  2FF4 A;  3FDH A;  3TWX A;  5ENT D;  4HB5 A;  2Y1L E;  3MKQ A;  3SZ7 A;  4BT8 A;  5EX0 A;  3ABK E;  4KMO A;  4DLQ A;  5IY5 E;  1HFA A;  4M3O A;  3QB2 A;  1SA5 A;  1LD8 A;  4J8E A;  1X81 A;  3DBS A;  5CER B;  3UQ3 A;  3CIA A;  5LCW J;  4OVV A;  1S63 A;  3B7U X;  4YIR A;  1OCC E;  3CST A;  3TWR A;  3PS6 A;  1WM5 A;  3FTS A;  5T3R A;  3UM1 A;  5J08 A;  4I6E A;  4GU5 A;  3KS2 A;  3UT8 A;  3U3W A;  3RRN B;  1FT1 A;  2WXP A;  4RVB A;  4TV3 A;  1N0R A;  5FQ7 A;  3RU0 A;  2IFU A;  2OVF A;  2J4B A;  3JCK C;  4G2V A;  4A55 A;  1APF A;  2ILR A;  4CDR A;  3D9M A;  3I5P A;  2WXG A;  3OXL A;  2XEV A;  4HOR A;  3LY9 A;  1WAO 1;  5CHE E;  3VLE A;  4N3A A;  4BX8 A;  3I4R B;  1QNF A;  3FEX A;  2KCV A;  5A6C A;  4AM9 A;  3ZXP A;  1TYQ G;  2QY7 A;  4J8Y A;  3UPV A;  5CBO A;  2B6C A;  2DZN A;  3D9K A;  3CVQ A;  4J8S A;  5G05 J;  4DUI A;  3CK9 A;  3BQO A;  3ASN E;  4GZD A;  5KWD A;  2XCB A;  2ETC A;  1OUV A;  4KVM A;  2X38 A;  2HJE A;  1AHL A;  4GYO A;  2I9C A;  2GRN B;  3IBE A;  2FUL A;  2XGS A;  1Q2Z A;  4FHJ A;  4LNB A;  2XEE A;  4HOS A;  4CGV A;  1N4S A;  2CHW A;  2LSV A;  3C98 A;  2BTD A;  3FUN A;  5FZQ A;  3QDN A;  4XI9 A;  3U66 A;  2L0T B;  2XPZ A;  2LUH A;  4O1O A;  4CCA A;  3DPD A;  3FHE A;  3PDN A;  3TXM A;  2B0O E;  3D9P A;  1SHI A;  2GRO B;  4GTS A;  5JJ6 A;  4WND A;  3ZYL A;  2Y0B G;  1B89 A;  1MX2 A;  1OWL A;  3Q75 A;  1ZBP A;  5DIZ A;  4J8D A;  4JA9 A;  3L9T A;  2BKG A;  3UUX A;  3SBT B;  5FQ4 A;  4P29 A;  5G2N A;  4LEU A;  3C30 A;  1YYH A;  3EIJ A;  3LJN A;  1O1R A;  4I9E A;  3TWS A;  4FLH A;  3CKB A;  2KZT B;  1UN9 A;  2X6I A;  2XRZ A;  3J5P A;  2HM8 A;  4GB9 A;  1TNB A;  3S2A A;  1V54 E;  1H19 A;  2MOW A;  3NF1 A;  4HRM B;  3CHO A;  3ONK A;  3VTX A;  4LNU D;  1D9S A;  3AS5 A;  2F8Y A;  2MYO A;  4E85 A;  3HXB A;  2XGM A;  5T4Y A;  3GZS A;  2YNQ A;  2QYU A;  3Q9U C;  3C3O A;  2WM9 A;  3RIB A;  1FPP A;  4HQD A;  2RFA A;  4EHM A;  4KXK B;  2K2X A;  2R2L A;  3NOG D;  2PZI A;  2V4L A;  3SI5 A;  2P2C P;  4LSZ E;  3TWQ A;  2IF4 A;  4GYW A;  3C38 A;  1E90 A;  2VGE A;  1B8W A;  3D9L A;  1G3N B;  3DSU A;  4ME2 A;  3CVX A;  3QWW A;  5ANL A;  3RK6 A;  4JHK A;  5BV0 A;  3TL5 A;  1AP7 A;  1NZN A;  1TNY A;  2Y69 E;  3CVW A;  2VSX E;  2XEN A;  1OCR E;  4N3B A;  5E76 A;  2A4Z A;  3K9I A;  3PVL A;  4FP7 A;  4E6H A;  5JHB A;  2M63 A;  4CT0 A;  3NB2 A;  4N39 A;  2C0L A;  4FJY A;  3ULQ A;  4U07 A;  2HO1 A;  3FTZ A;  4CZ2 D;  2XZT G;  4ZFH A;  4K5A B;  4XIF A;  2P9N G;  4ANX A;  3ZYM A;  5ENN A;  2GRM A;  4D10 C;  1E8X A;  4MS6 A;  5LFA A;  1ZUF A;  2OOE A;  1O1T A;  2IEJ A;  3SY2 A;  4KZ0 A;  1IQR A;  2GRP B;  4I6J A;  3ESK A;  5C2Y A;  2BKK B;  4NIK A;  4GMJ A;  3FU5 A;  1IQU A;  2BF0 X;  4U8Y D;  3EJN A;  3HVE A;  5DBK A;  3EDT B;  1YMP A;  4XEI G;  1HX8 A;  4CYM D;  5BPP A;  3PNL B;  2DIW A;  4UWL A;  1E8Y A;  4X8Q A;  4BET A;  5KJM A;  2VTB A;  4GCO A;  2VSO E;  3L6A A;  1Y6I A;  4O6F A;  4MLP A;  4GTT A;  1N0Q A;  4DK5 A;  2PL2 A;  3FU6 A;  2R5S A;  2IOS A;  4UWH A;  3V2X A;  3LY7 A;  3PZ4 A;  4ACK A;  3ZYQ A;  2B9K A;  2UY1 B;  3JUI A;  3DST A;  4AY5 A;  1E7U A;  4YDE A;  2GGF A;  3TAX A;  3ENE A;  5FQ6 A;  5JHA A;  3LXU X;  2ZU6 B;  3FH7 A;  1MQS A;  3ZKJ A;  1O1S A;  4JL0 A;  3FTU A;  2VYI A;  4KYO B;  1MYO A;  1TNO A;  2KXP C;  1UG3 A;  3UKU G;  4TRQ A;  1AWC B;  4ILI A;  4EZL A;  4HXI A;  4I2Z A;  5BNW A;  1OWN A;  4C48 B;  2PQN A;  4DX5 D;  4EQF A;  3FUF A;  5C1D A;  2AVP A;  1XGW A;  1O5M A;  4YDW A;  2ION A;  1L5J A;  5AN8 A;  2EIK E;  4A3V A;  5AQ7 A;  3GZ2 A;  1A5E A;  3L16 A;  2P9I G;  4MRU A;  1E96 B;  1EPU A;  2P9P G;  2AJA A;  4BES A;  3TWV A;  2LAH A;  2J49 A;  2NYJ A;  4I9C A;  2L9B A;  1V55 E;  3FH5 A;  4EBA A;  3ML8 A;  4JD2 G;  3AS8 A;  3QAQ A;  1FVF A;  3JUE A;  4ANU A;  2BDS A;  4KBQ A;  4TXQ A;  2CHX A;  1KLX A;  3IHV A;  3BUA A;  5G04 C;  3V79 K;  2I2O A;  3E30 A;  4J7W A;  2P9S G;  2R17 C;  4Y6C A;  3ZGQ A;  3ASH A;  2SH1 A;  4GTO A;  4FLB A;  3MGB A;  5J90 A;  4UQY A;  4U63 A;  4PS7 A;  2V5Q C;  3FP3 A;  2YQ8 A;  3QJZ A;  3FUL A;  1NFI E;  3HXE A;  1MJ0 A;  4ATG A;  4LER A;  1MX6 A;  3S7D A;  4JHJ A;  2LXL A;  1P5Q A;  1UJK A;  3FY4 A;  3UIO C;  4XX5 A;  2J07 A;  3UMV A;  1HO8 A;  3MKQ B;  1OWP A;  1ZB1 A;  4GML A;  2X6J A;  4A3T A;  2ZIR A;  2EIJ E;  1OY3 D;  3RO2 A;  5KNG A;  4APF A;  2JAB A;  5ENQ D;  3IKO B;  4F1P A;  2DYS E;  4BWR A;  4F6R D;  2UWJ G;  3CVU A;  2CG3 A;  4YND A;  4B8A A;  3KAE A;  3AG1 E;  3CV0 A;  4BTB A;  1ZLH B;  2IO3 C;  2HE0 A;  4W9R A;  3ZU7 B;  5EYL A;  1MX4 A;  3HIZ A;  1WDY A;  1K8K G;  4JHR A;  4DX1 A;  4IRU A;  4JW1 A;  2KM4 A;  4RQI A;  1DNP A;  3FTV A;  2DZO A;  1HE8 A;  2MHK A;  5T8I A;  4DPR A;  3KSQ A;  4YDO A;  3R9A B;  1SZA A;  3BG1 B;  5KNH D;  4TUU A;  3IV0 A;  1DVP A;  3ZRH A;  2J9Q A;  3CHR A;  3FUE A;  4GTP A;  4BER A;  3PZD A;  2X3M A;  4Q69 A;  2GW1 A;  2OVB A;  3ULY A;  4PDX A;  4WWO A;  1ZHH B;  3MA5 A;  4GZC A;  3LDZ A;  4GZ5 A;  3DEO A;  3L17 A;  3FTY A;  3CVV A;  4FU3 A;  3QOU A;  2L6J A;  4DI3 A;  2FBN A;  2P9L G;  3CLJ A;  3GW4 A;  2DLA A;  2JLB A;  4NRH B;  3TG5 A;  4CDM A;  3E32 A;  4A1S A;  3PE4 A;  4HBD A;  1DCE A;  4BSX A;  5EYP F;  1HG5 A;  1K3Z D;  1JCR A;  3VTY A;  4GPK A;  1IHB A;  2MN3 A;  2WXK A;  3CEQ A;  4K03 A;  4HFG A;  2XCC A;  4JVS A;  3UIN C;  5FIO A;  5HKP A;  2XRY A;  1NL4 A;  4H7X A;  4U0S A;  4WNG A;  4K5C A;  1TN7 A;  4AEZ C;  3HDX A;  3JQ0 A;  3QK0 A;  4JEH A;  3MX3 A;  2WXN A;  2J8S D;  2J08 A;  2WXH A;  2EIM E;  3SNX A;  3FTX A;  3SFY A;  1SH1 A;  5EX3 A;  3VLF A;  4TXR A;  4DRX E;  3AJI A;  5D2M C;  5AAO A;  4F1S A;  2X6K A;  1K1A A;  3RRM B;  5FQ8 A;  1TJF A;  3CHQ A;  2Y4T A;  3ISM C;  4AP2 A;  1BU9 A;  2VJ8 A;  4ILG A;  1EL6 A;  3UXG A;  3UT4 A;  5BV1 A;  3BG0 B;  2OND A;  4PUC A;  5CMY A;  3CVL A;  4V3I A;  3AG3 E;  3AS4 A;  3LCA A;  4DJA A;  4ANW A;  3JYS A;  3PEU B;  4LG6 A;  3NBN B;  3RAU A;  3S7F A;  4URK A;  1OCZ E;  4U96 D;  3ZIM A;  4F53 A;  4HI9 A;  2XS8 A;  3E4B A;  3ZHE B;  2FI7 A;  2QFC A;  4O60 A;  5CEA A;  1GKU B;  4DX7 D;  4ZHB A;  4FC8 A;  2WXM A;  2R05 A;  1EDU A;  3FUH A;  4U0U A;  3ZYK A;  2YIN A;  3T5V A;  2QZA A;  4FHK A;  2LAI A;  3V30 A;  4XZ4 A;  4UQX A;  4FA6 A;  2NC9 A;  3KEA A;  3QWV A;  4UUC A;  4PH4 B;  5KCM A;  1WG0 A;  4DX2 A;  4TUM A;  4U0Z A;  2AXU A;  4L2L A;  4N2Q A;  4EBA G;  4RG9 A;  4IN3 B;  5AYW D;  2Q7F A;  4NQ0 A;  2GRL A;  3PUK A;  1OCO E;  3DSW A;  5BUZ A;  3HXD A;  3IEG A;  3LVQ E;  2R59 A;  2H6H A;  4GV5 A;  1PAQ A;  4U04 A; 
#chains in the Genus database with same CATH homology
 5JJ7 A;  1IHG A;  3KD7 A;  2LO6 A;  4DK5 A;  2PL2 A;  3FU6 A;  2VSN A;  2R5S A;  3CVP A;  2IOS A;  4J0U A;  4UWH A;  1SZ9 A;  2VQ2 A;  1ZU2 A;  1HF8 A;  3TGO A;  4CEM A;  1S0P A;  3LY7 A;  2NXP A;  1NA0 A;  4ACK A;  3ZW3 A;  5ARF A;  3ZYQ A;  4F3V A;  2IJG X;  4KT6 B;  2B9K A;  4KZC A;  3FU3 A;  2UY1 B;  3JUI A;  2KCL A;  3CKC A;  2MUB A;  1H2T C;  4J8F A;  4AY5 A;  2JEK A;  4HOU A;  1KT1 A;  1BPO A;  1E7U A;  2KZT A;  3GYZ A;  3O4Z A;  4U8H A;  3SBS A;  4C9B B;  4HVB A;  4APO A;  2GGF A;  4JA7 A;  5BW8 C;  3ENE A;  1HH8 A;  3TAX A;  5FQ6 A;  4DLO A;  5JHA A;  4EZJ A;  3LXU X;  2ZU6 B;  3UT7 A;  3U64 A;  3FH7 A;  3CK7 A;  3ML9 A;  5LX8 A;  1IYG A;  2FEZ A;  2YHC A;  2XGO A;  3OTN A;  4Y6W A;  1MQS A;  4GCN A;  4C0M A;  1Z3Y A;  4FAD A;  2H9X A;  3APD A;  3SHF A;  4JL0 A;  4UWG A;  3PH0 C;  4XKB A;  4KVO A;  3FTU A;  4ANV A;  5A23 A;  2VYI A;  3FUD A;  4J6I A;  3Q15 A;  4KYO B;  1WQK A;  1PY1 A;  3B13 A;  3CQG B;  3QNK A;  2C2L A;  4B94 A;  1UG3 A;  1Y8M A;  1H2V C;  4TRQ A;  4GA1 A;  5CMW A;  3ZEF A;  1HZ4 A;  3WXX A;  2XQ0 A;  2FF4 A;  3FDH A;  4ILI A;  3D3M A;  3ASD A;  3APF A;  3D4U B;  4EZL A;  3D9J A;  2AW6 A;  2XPI A;  3MKQ A;  3SZ7 A;  3LS8 A;  4BT8 A;  5EX0 A;  4HXI A;  4I2Z A;  4WWN A;  1JUQ A;  1N54 A;  1OWN A;  2EQX A;  2X6F A;  4KMO A;  4N5C A;  4OYS A;  5D0O D;  3FTW A;  4DLQ A;  2PQN A;  1HFA A;  4NUR A;  4M3O A;  3QB2 A;  4J8E A;  3QAR A;  2XXL A;  4EQF A;  3DBS A;  1H5O A;  3FUF A;  1UW4 B;  4GZ3 A;  3CHM A;  5C1D A;  3FUJ A;  2AVP A;  4AV7 A;  1XGW A;  2WPV A;  3AU5 A;  3APC A;  3UQ3 A;  1E8W A;  1Z99 A;  3CIA A;  5LCW J;  1EF1 C;  2VGX B;  3U9W A;  3SF4 A;  2JTO A;  3D9I A;  1WXN A;  4PS3 A;  2ION A;  4OVV A;  3ZFW A;  1L5J A;  2DBA A;  3ESL A;  3B7U X;  4YIR A;  4A3V A;  2J4D A;  5AJD A;  3GZ2 A;  4LCT A;  3L16 A;  4HLE A;  3CST A;  4MRU A;  4C0E A;  3PS6 A;  1E96 B;  1EPU A;  3NQP A;  5EDS A;  2IKE A;  1HG2 A;  1WM5 A;  5G55 A;  2CHZ A;  3LVR E;  2LAH A;  2J49 A;  3FTS A;  3LY8 A;  4I9C A;  2L9B A;  2I1J A;  3FH5 A;  2IOL A;  4EBA A;  5T3R A;  4CRW A;  3ML8 A;  3AS8 A;  5J08 A;  3QAQ A;  1FVF A;  2IU1 A;  2VGY A;  3LEW A;  2BDS A;  4ANU A;  4KBQ A;  4I6E A;  4GU5 A;  3KS2 A;  2CHX A;  3VLD A;  1KLX A;  3CHS A;  3UT8 A;  3RRN B;  5G05 C;  3U3W A;  4R7L A;  2WXP A;  3IHV A;  1NA3 A;  4RVB A;  5G04 C;  2I2O A;  3IHY A;  4YVQ C;  4B89 A;  3OAW A;  5AEN A;  2J09 A;  4TV3 A;  5FQ7 A;  2R17 C;  2I1K A;  4Y6C A;  3RU0 A;  3ZGQ A;  2IFU A;  2OVF A;  2WQ6 A;  3RKV A;  2J4B A;  4PS8 A;  3JCK C;  3ASH A;  3LPZ A;  4G2V A;  4A55 A;  1APF A;  2DCP A;  3PE3 A;  2ILR A;  4G1T A;  3OXG A;  2AWI A;  3ZHE A;  4BT9 A;  4CDR A;  3D9M A;  2SH1 A;  3I5P A;  2WXG A;  4FLB A;  3MGB A;  3OXL A;  2PQR A;  2XEV A;  4EPZ A;  5J90 A;  2YHE A;  3JQ1 A;  4HOR A;  4UWF A;  3LY9 A;  1UJJ A;  4UQY A;  1WAO 1;  5CHE E;  1E7V A;  5LOZ A;  3TXN A;  3AU4 A;  2X6H A;  4AXH A;  4HOT A;  1HS6 A;  4I17 A;  4U63 A;  4PS7 A;  3URZ A;  4N3A A;  3B7S A;  3VLE A;  5FT9 A;  3FP3 A;  2HJ9 C;  2YQ8 A;  4BX8 A;  3QJZ A;  3FUL A;  3I4R B;  4BY6 A;  1QNF A;  4F7A A;  4WNE A;  2WXF A;  2HR2 A;  4ATG A;  4LER A;  1FCH A;  2WXQ A;  3FEX A;  3S7D A;  3FH8 A;  2KCV A;  5A6C A;  4JHJ A;  4AM9 A;  2XPY A;  1P5Q A;  2L0I A;  2QY7 A;  1UJK A;  3FY4 A;  1VDY A;  4I43 A;  4XX5 A;  3UPV A;  1WY6 A;  2J07 A;  3UMV A;  1HO8 A;  3D9K A;  3MKQ B;  3CVQ A;  1OWP A;  3GZ1 A;  3L54 A;  4J8S A;  5G05 J;  3CK9 A;  4GML A;  3ASG A;  4G25 A;  3TJP A;  3G2T A;  5G04 J;  5LP0 A;  2X6J A;  5LCW C;  4A3T A;  3FUI A;  4ABN A;  2KC7 A;  1KT0 A;  4GZD A;  1X5B A;  3RO2 A;  3MV2 B;  3KEZ A;  4RSY A;  3CVN A;  2XCB A;  4APF A;  4G11 A;  5FZR A;  4G26 A;  1OUV A;  3IKO B;  2FO7 A;  3CK8 A;  3HHM A;  4KVM A;  2X38 A;  2HJE A;  1AHL A;  4GYO A;  4CT4 A;  2I9C A;  2WQH A;  4BWR A;  2WXO A;  3IBE A;  3PUJ A;  1BDS A;  2UWJ G;  3T8M A;  2CG3 A;  4YND A;  3CVU A;  2FUL A;  4G23 A;  3KAE A;  4H7Y A;  4UI9 K;  4B8A A;  2XGS A;  4RG6 A;  3CV0 A;  4BTB A;  5KJL A;  4FHJ A;  4WUY A;  1ZLH B;  2CFU A;  4W9R A;  4HOS A;  1D6B A;  3HIZ A;  4CGV A;  3PRE A;  4UWK A;  2CHW A;  2E2E A;  2LSV A;  1UN8 A;  4JHR A;  4IRU A;  3ONL A;  1MHQ A;  3C98 A;  2BTD A;  3FUN A;  4JW1 A;  3QDN A;  5FZQ A;  2KM4 A;  4AVX A;  2WXL A;  4YVO A;  4XI9 A;  3NZU A;  1DNP A;  3U66 A;  2L0T B;  2XPZ A;  3FTV A;  5FWQ A;  4CCA A;  4GZ6 A;  4BFR A;  3DPD A;  1HE8 A;  2MHK A;  2RD0 A;  5FJY A;  5T8I A;  3FHE A;  4DPR A;  3PDN A;  4JC8 A;  5D0Q D;  2UY1 A;  2V5F A;  4N2S A;  2WMO A;  3TXM A;  3D9P A;  3R9A B;  4WWP A;  1SHI A;  1SZA A;  5JJ6 A;  3BG1 B;  3HVE B;  4WND A;  3ZYL A;  4TUU A;  3IV0 A;  2IKD A;  3FU0 A;  4JPS A;  4QFV A;  3S7J A;  4JEU A;  1DVP A;  5E75 A;  3T5X A;  3ZRH A;  2QSH A;  3QC1 A;  1SQM A;  4WAF A;  3CVY A;  1B89 A;  2J9Q A;  1OWL A;  3CHR A;  3FUE A;  5HI7 A;  3PZD A;  2X3M A;  3D9N A;  4Q69 A;  2VTB B;  2GW1 A;  3S7B A;  3L13 A;  2OVB A;  3SFZ A;  4I1A A;  1QQE A;  4PDX A;  4CGW A;  1ZBP A;  4UQZ A;  5DIZ A;  2WXI A;  4J8D A;  3MJW A;  3P1U A;  4WWO A;  1ZHH B;  2PM6 A;  4JA9 A;  3MA5 A;  3UUX A;  3U4T A;  2WB2 A;  2I6H A;  4GZC A;  3LDZ A;  3HYM B;  4JZY A;  3SBT B;  5FQ4 A;  3PEV B;  4GZ5 A;  3L17 A;  4P29 A;  5ANR A;  3B7T A;  3CHP A;  5G2N A;  3G2W A;  2C0M A;  3FTY A;  4LEU A;  3SGH A;  3CVV A;  5ARG A;  2LNI A;  3FWV A;  4FU3 A;  3C30 A;  3EIJ A;  3QOU A;  2L6J A;  4DI3 A;  2QSF A;  2FBN A;  1HU3 A;  4G24 A;  3CLJ A;  1GW6 A;  4JXT A;  3PNT B;  3RRU A;  4I9E A;  2P58 C;  4FLH A;  3CKB A;  3GW4 A;  2KZT B;  1UN9 A;  2X6I A;  4DI4 A;  3CR3 A;  2XRZ A;  2DLA A;  3FUM A;  2HM8 A;  2JLB A;  4GB9 A;  3MZL B;  4NRH B;  3TG5 A;  3MEK A;  4CDM A;  4A1G A;  3S2A A;  4I6G A;  2WQ7 A;  1U3C A;  1Z6T A;  3ASF A;  1H19 A;  2MOW A;  3NF1 A;  4A1S A;  1TEZ A;  3PE4 A;  3SD5 A;  3CHO A;  1N52 A;  4LUN U;  3ONK A;  4I2W A;  3BEE A;  2VGX A;  3G2S A;  2KAT A;  3I3N A;  4BSX A;  1JWG A;  3VTX A;  1HG5 A;  4XI0 A;  3AS5 A;  3LMS B;  3MKR A;  3VTY A;  4GPK A;  4E85 A;  5AJL A;  1OWM A;  2XGM A;  5T4Y A;  5BNW A;  2MN3 A;  3GZS A;  3PRZ A;  2YNQ A;  2WXK A;  5KJN A;  3CEQ A;  4K03 A;  4CDN A;  4HFG A;  2LSU A;  1H0A A;  2XCC A;  4JVS A;  4LRZ A;  2XRY A;  4H7X A;  4L7T A;  3TG4 A;  4U0S A;  1EYH A;  5AIJ A;  4WNG A;  4AY6 A;  2E0I A;  1JWF A;  2WM9 A;  3RIB A;  4AEZ C;  3MV3 B;  2Y3A A;  3HDX A;  3JQ0 A;  1H6K A;  2BUG A;  3QK0 A;  4JEH A;  3EHN A;  3B7R L;  3MX3 A;  2RG8 A;  2WXN A;  2J08 A;  1NP7 A;  1QZ2 A;  2NSZ A;  2WXH A;  4IUL A;  3SNX A;  3EHM A;  3L22 A;  3FTX A;  4KXK B;  2K2X A;  1SH1 A;  3FUK A;  5CCL A;  5EX3 A;  3VLF A;  2AXZ A;  3LKU A;  3OXF A;  3EIQ C;  4GA2 A;  3NZS A;  2HYZ A;  4F1S A;  3LJ3 A;  2PZI A;  2V4L A;  3SI5 A;  4I1O B;  2PM7 A;  2X6K A;  3R7Q A;  1YA0 A;  1ZUE A;  5BT1 A;  3CSF A;  3QWP A;  5A7D B;  2QSG A;  2IF4 A;  3RRM B;  4GYW A;  4I1M A;  4UI9 J;  5FQ8 A;  5FTP A;  3RJV A;  4AIF A;  1E90 A;  4IYP A;  1TJF A;  3C38 A;  3CHQ A;  2Y4T A;  4XE0 A;  2AXV A;  1B8W A;  2V0P A;  4AP2 A;  3D9L A;  3CVX A;  4ME2 A;  1ELK A;  3QWW A;  2VJ8 A;  4ILG A;  4L2Y A;  5ANL A;  2JR3 A;  3RK6 A;  3UT4 A;  3CGH A;  5CCM A;  4JHK A;  5BV1 A;  3BG0 B;  1A17 A;  1HXI A;  2OND A;  3UX4 A;  5BV0 A;  1H2U A;  4PUC A;  5CMY A;  3CVL A;  3Q5M A;  3D9O A;  1JPL A;  3TL5 A;  4GA0 A;  4V3I A;  1NZN A;  3ZN3 A;  4B0Z A;  3Q49 B;  4GYY A;  2WXJ A;  4OVU A;  3AS4 A;  5HQ8 A;  2RNG A;  3LCA A;  4DJA A;  3CVW A;  4ANW A;  3JYS A;  2VSX E;  4N3B A;  5E76 A;  5KJK A;  2A4Z A;  1U3D A;  3K9I A;  3PEU B;  2KCK A;  3PVL A;  2OV8 A;  2XHE A;  4FP7 A;  1ELR A;  4E6H A;  4MKT A;  5JHB A;  2M63 A;  3RO3 A;  3MYV A;  2MRI A;  4CT0 A;  3S7F A;  4L23 A;  2V8S E;  4URK A;  4N39 A;  3ZPJ A;  1ELW A;  2C0L A;  5FZS A;  3ZIM A;  4F53 A;  1E8Z A;  1FVH A;  4FJY A;  3P2B A;  3ULQ A;  2Y4U A;  3E4B A;  3ZHE B;  2CFZ A;  2FI7 A;  3G2U A;  2QFC A;  4U07 A;  2IQC A;  3FEY A;  2HO1 A;  3R7R A;  3FTZ A;  2WXR A;  4AJW A;  3I4G A;  4FC8 A;  2WXM A;  4XIF A;  4AOF A;  4ANX A;  1LF8 A;  3ZYM A;  5ENN A;  1EDU A;  4BTA A;  3FUH A;  3Q4A B;  2GRM A;  4U0U A;  4D10 C;  4K0R A;  1E8X A;  4EZK A;  4MS6 A;  2A5U A;  4B8C B;  3ZYK A;  2YIN A;  1Z3X A;  3T5V A;  5LFA A;  1ZUF A;  2OOE A;  4FHK A;  2LAI A;  4FUL A;  3N71 A;  4XZ4 A;  3QKY A;  4GAA A;  4EEC A;  4KZ0 A;  1IQR A;  4HOQ A;  4I6J A;  4UQX A;  1INZ A;  4FA6 A;  5M72 A;  3ESK A;  5C2Y A;  4NAC A;  2NC9 A;  3QWV A;  5EKQ D;  4GMJ A;  3FU5 A;  1ZLI B;  1IQU A;  4PH4 B;  2BF0 X;  5KCM A;  4N3C A;  4Q94 A;  3EJN A;  3HVE A;  5DBK A;  1OWO A;  4XKC A;  3EDT B;  4UI9 C;  5JJT A;  3ZXS A;  2VSY A;  4U0Z A;  2CG2 A;  3CQC B;  1HX8 A;  2AXU A;  4L2L A;  3MCX A;  3Q47 B;  4EBA G;  4N2Q A;  4RG9 A;  5BPP A;  3L08 A;  3G2V A;  4FJZ A;  3PNL B;  4IN3 B;  4WNF A;  5AYW D;  2Q7F A;  2DIW A;  4ACL A;  4NQ0 A;  2WVI A;  2GRL A;  3PUK A;  4UWL A;  2WMN A;  1E8Y A;  4BX9 A;  4L1B A;  5KJM A;  2VTB A;  4GCO A;  2VSO E;  5BUZ A;  1TJC A;  3IEG A;  3O48 A;  3L6A A;  3LVQ E;  1ATX A;  1Y6I A;  4O6F A;  1XNF A;  3LYA A;  1W3B A;  4HS2 A;  2R59 A;  4ILH B;  3FFL A;  4MLP A;  1PC2 A;  4GV5 A;  4Q96 A;  3ZVV A;  1PAQ A;  4U04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...