3KEZA

Crystal structure of putative sugar binding protein (yp_001299726.1) from bacteroides vulgatus atcc 8482 at 1.90 a resolution
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
447
structure length
447
Chain Sequence
ETSINVLSDIEFTLNGIYSTMQSSDAYSGRLVYYGDVTGDDMQAVSSTKRTGNYYRFNFTKDNGPSSHWSYLYSIIQNCNLILMNVDKLSIDEDETEYKNDLKGQALAIRGMALFDLTRIFGYPYLKDNGASLGVPIVKELSTIDSKPARNTVAECYTEIISDLKNSTELLSGDFNKGKVNRWAAMTLLSRVYLYKGEYNEALTMAENAIKGAEKEGYALWTNEEYPTAWGNDASASNPGEILFEIVNLTTDSPGKESMGYLNSYNGYDDMCITCSFYQLLKKDPKDVRLKILSFDKKYYAYVNKYQPQQGENITDANIPLIRLSEAYLNAAEAAVQTGDNAKAVKYLNSIVQRANPENSVEGKTLTLENVLDERRKELVAEGHRMYDVIRNGMTVKRIDVKDSDINKTKHNTAYMEYDWNFHKILLPIPKKEMDANPNMKQNPGYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Putative sugar binding protein
publication title Crystal structure of Putative sugar binding protein (YP_001299726.1) from Bacteroides vulgatus ATCC 8482 at 1.90 A resolution
rcsb
source organism Bacteroides vulgatus atcc 8482
total genus 155
structure length 447
sequence length 447
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07980 SusD_RagB SusD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3kezA01
1.25.40.900 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3kezA03
2.20.20.130 Mainly Beta Single Sheet Anthopleurin-A Anthopleurin-A 3kezA02
3CK7A 3KEZA 3LEWA 3CKBA 3JQ0A 3OTNA 3CK9A 5T3RA 4Q69A 3EJNA 3FDHA 5J90A 5E76A 3NQPA 5E75A 3MCXA 3SGHA 3P1UA 4F7AA 5FQ4A 5T4YA 3IV0A 3MX3A 4MRUA 3SNXA 3EHNA 4L7TA 5FQ6A 5FQ8A 5FQ7A 3CK8A 5LX8A 4LERA 3EHMA 3CKCA 3IHVA 3L22A 3MYVA 3I4GA 3QNKA 3HDXA 4F53A 3GZSA 3JYSA 3CGHA 4PUCA 3JQ1A
chains in the Genus database with same CATH superfamily
2EILE 3Q9NC 4EHMA 1TJFA 5EX3A 2XZTG 4OVUA 4YDOA 5G05C 4WWOA 4OAUC 2XQ0A 4JA9A 3UKRG 3MV3B 4CGWA 3KEZA 2JTOA 2ETAA 2BF0X 2EIKE 1E7VA 2F0YA 3T8KA 4HOTA 2RFMA 4U0SA 3ABLE 4I17A 4EQFA 2WM9A 4P29A 4E85A 4EECA 4EBAG 4TRQA 2AJAA 4FA6A 3ZNGA 5BV1A 3FU5A 1FVHA 2R5SA 3D9OA 4AV7A 3PDNA 5T8IA 4GTRA 2VSYA 2B0OE 3PREA 4H7YA 3UIPC 1H19A 5CRUA 4HB5A 3HYMB 5JA4D 2RFAA 1NA0A 4PDXA 2HO1A 1G3NB 1OWMA 2Y4TA 4U0ZA 3QWPA 1BPOA 4GZCA 3CVVA 5FQ4A 3OAWA 1KT1A 4KZ0A 5FZQA 4BX9A 1OWLA 2IOLA 1HG5A 1QZ2A 4B89A 2J09A 4B93B 3ZXPA 3IHVA 1OXJA 4Z68A 5G55A 1XGWA 4C48B 2GW1A 4F3VA 2GRNB 4YDWA 2A5EA 4W9RA 3ESLA 1N94A 4TUUA 2H6HA 2OOEA 2ZISA 3PE3A 2AW6A 3CIAA 2VTBB 2LSUA 5CMWA 3RAUA 3HDXA 3D9MA 4NQ0A 2QSGA 3RKVA 2GRMA 1SA5A 2K2XA 5FZSA 3TWWA 3GZ1A 1U2VG 4I6EA 4U95D 3PEVB 2HJ9C 5IY5E 4U07A 3V30A 1OY3D 1SA4A 4G1TA 1BDSA 4DUIA 1O1SA 2B6CA 4HLLA 2UY1B 4GYOA 3BU8A 5CEAA 4HI9A 3NQPA 5E75A 5BV0A 3LMSB 3PE4A 3Q9UC 4GTOA 2X6JA 1N9AA 5AARA 3OXGA 5B1AE 4WNFA 3SY2A 3S7DA 1IXVA 4HXIA 4JVSA 2EINE 1MZCA 3ULYA 3S7BA 2X6IA 2PQRA 3I3NA 2VTBA 3HVEB 3QARA 2XGOA 3EHQA 3QAQA 5KCMA 3U66A 2YQ8A 1E7UA 3RO3A 1TN7A 1ZU2A 4MLPA 3X2QE 1IQRA 4GMLA 4G24A 3AU4A 1KT0A 2P2CP 4U96D 4U8VD 5AYWD 2XHEA 5E76A 3S7FA 2IQCA 1EPUA 3ML8A 1Z5SC 1HO8A 5BNWA 2FO7A 1RW2A 3UPVA 5HKPA 1ZUFA 3UQ3A 4Y6WA 4XEIG 1HF8A 2UY1A 3KSLA 3R7QA 2ETCA 2XCCA 4D10C 4GA2A 3ASDA 2LXMA 3RRMB 5KNHD 4DX5D 4UQZA 3LKUA 1JWFA 1LF8A 4A1GA 3DXKG 1OCRE 5G04J 4RLYA 2FO1E 3NAWA 2DBAA 2HE0A 4UWLA 3EIQC 2IKDA 2QSFA 4B94A 1N52A 4I1AA 3R7RA 2J4BA 3CGHA 2LAIA 2ZGDA 5EIDA 4JZYA 1WQKA 5ARFA 3L82A 5AQAA 4JHKA 4HS2A 4H7XA 3AS8A 1TR4A 5JMND 3FTSA 3F6QA 4XE0A 3TWUA 2FF4A 2FBNA 4U7EB 2Y3AA 3CHQA 4Q94A 5AIJA 5ENRD 2KCVA 3EU9A 3V79K 1ZUEA 2I1KA 4DI4A 5CMYA 1NI1A 2CG3A 3FU0A 2WXJA 1SW6A 3ZKJA 2FI7A 5AN8A 5AJLA 2XZDG 5EN5D 2WVIA 3P2BA 4GTMA 2E0IA 3G2VA 4J8SA 2XGMA 4GTPA 4CDNA 4X8QA 3FULA 3NZUA 5EKQD 2X3MA 4K5BA 3LVRE 3LCAA 2L0TB 2JABA 4AVXA 4NIKA 1HX8A 5AENA 1HU3A 3D9JA 2PL2A 4KBQA 4Q69A 2J08A 2I2OA 4N5QA 2F8YA 2P58C 3D9PA 3TG5A 4LCTA 3SZ7A 1LD7A 2AXUA 1MX2A 3E33A 4U0UA 4E6HA 5EIBE 3T9KA 3DEOA 3T8MA 1N4SA 1AHLA 4B8CB 2XEHA 3D3MA 3AG2E 3E37A 3S2AA 3MV2B 2E2EA 4JHRA 5AAOA 4GTSA 5ENTD 4YVOA 3AJIA 2KXPC 3CEQA 2EQXA 2KBXA 3ZGQA 1FT2A 4HRLA 4HQDA 2WQ6A 1S70B 4WWNA 1EYHA 3B7BA 3CHOA 4BT9A 3QOUA 3D9KA 5CEDB 2FULA 2HR2A 2XEEA 3FH7A 4BSXA 1H6PA 5CBNA 3G2UA 4HRNA 5CRVA 3Q5MA 4UI9J 1JWGA 3C3QA 4G23A 4U8HA 2MUBA 1SH1A 4L9PA 3Q4AB 5ANLA 4K0RA 3ZIMA 1OCCE 4I6JA 3NOCD 3DEPA 1BI7B 3UKUG 1UN8A 5J08A 1DCQA 3QWWA 2PM6A 1AWCB 2R2LA 2PQNA 3APCA 4DRXE 5ENPD 2GRPB 2P9IG 3C38A 2Q7FA 2NSZA 3P1UA 4XI9A 2OEWA 3T5VA 3CSFA 4BEPA 4ILGA 5FT9A 4I9CA 1N4QA 3UM2A 2RNGA 1S64A 2VYIA 2OEVA 3UT7A 4WUYA 2IFUA 2WXOA 5JJ6A 2RKKA 1WY6A 4U63A 1H0AA 1KZOA 1FVFA 2WQ7A 1BI8B 4MBGA 4I6GA 1D8EA 3PVLA 3O4ZA 1ZLHB 1FT1A 1XNFA 3B7RL 3FTZA 3HIZA 4TV3A 1ZB1A 3VLDA 1ATXA 1UJJA 3UM3A 3CHPA 4J8FA 4JA7A 2V4LA 1K1AA 2OV8A 5AQ7A 1YCSB 4K03A 3ZFWA 3CHRA 3JCKC 3JXJA 3IKOB 2WXGA 3Q79A 3FWVA 3U64A 2Y4UA 3LY8A 1HZ4A 4L2LA 2J4DA 4HVBA 4M7CA 3QKYA 3JXIA 3ENEA 2A5UA 3LY7A 2VGYA 1NFIE 2FEZA 2QSHA 2F37A 3ZUVB 4G2VA 1IYGA 1OWOA 1O1RA 2XGSA 4DJAA 2CG2A 1H2VC 1TNBA 3Q75A 4I1MA 5D0OD 3ONKA 4KYOB 1E8YA 4LEUA 4R7LA 3AAAC 3C30A 2IF4A 2XEVA 2F8XK 3OTNA 4Y6CA 3CK9A 2IKEA 3WXXA 3SFXA 4GV5A 5BXUA 3PZ1A 3ZW3A 3FUNA 3R9MA 3UX4A 3EHNA 4L7TA 1OT8A 4YVQC 1HXIA 5JHBA 4XKBA 3CVYA 2R05A 2OVFA 2R02A 4RVBA 3LEWA 3WG7E 4BFRA 4MS6A 3ZRHA 2NYJA 1TYQG 1V54E 4GZ3A 3HXEA 2H9XA 2J9QA 3ABKE 5BXOA 4AXHA 4AJWA 5M72A 3AU5A 3TWQA 3MYVA 1H2UA 4ANWA 3FHEA 3ZXSA 4N2QA 3BG1B 2V4HC 1YYHA 3SBSA 5HQ8A 3QDNA 3TXMA 4BX8A 1Z3YA 3TWXA 4PS7A 1U3DA 3FUMA 3DXMG 4N39A 3NBNB 3Q47B 4FP7A 3FH5A 3LXUX 3TL5A 2X38A 3ASOE 4OAVB 4F1PA 1SZ9A 3JYSA 2WXLA 4A63B 3NOGD 3JQ0A 2WXKA 1MX4A 3D9IA 4LNGA 3I5PA 2VSOE 3MX3A 2NXPA 3FEYA 3Q7FA 3FTYA 3ZPJA 1RZ4A 2ZGGA 4IRUA 2A4ZA 4GA0A 4FULA 5B1BE 3I4GA 4L23A 4FLBA 1H6KA 4ME2A 3RSEG 2M63A 5HI7A 4PUCA 1K3ZD 2I1JA 4RG6A 1KZPA 1A5EA 1WDYA 3PUJA 4GTTA 3PNLB 3J5QB 2C0LA 3UTMA 4J7WA 4DLOA 3L54A 4JEHA 1HE8A 3NF1A 1HG2A 1IKND 2XS8A 4BY6A 4JW1A 4FHJA 3G2WA 3PUKA 3RK6A 3DSWA 3ONLA 2I9CA 2YNQA 3IEGA 5T4YA 4LSZE 1INZA 5BW8C 2V5QC 3SFYA 3IF4A 4J6IA 3L08A 3LDZA 1PC2A 2UWJG 3U3WA 3BUAA 4FHKA 3EUVA 5EYPF 3ZN3A 4AIFA 3MA5A 4TUMA 3C3OA 2XPYA 3L6AA 4TXQA 5D2MC 2HM8A 4WNDA 4UWHA 2XPZA 2WXRA 3QC1A 3NB2A 2CFUA 1MYOA 4UWKA 2JLBA 3LJ3A 3SI5A 2VJ8A 2IJGX 3QJZA 4N5CA 5FIOA 3CHMA 5ENQD 4FU3A 4WWPA 2CHWA 4ILIA 3FY4A 3FUHA 3CR3A 4C0MA 1BU9A 3MJWA 2QFCA 3HXCA 5G04C 4HOQA 5HS0A 4ANVA 3D4UB 3DPDA 3DSVA 1SZAA 3ISMC 3V31A 4UUCA 2V0PA 1SVXA 1P5QA 3LVQE 4BESA 2DWZA 3MEKA 1MQSA 4JC8A 4GZ6A 4N3CA 3PS6A 1S0PA 1EDUA 2AVPA 4AY5A 4KVMA 4YDYA 1Y6IA 3RRNB 3MCXA 5D66A 1X81A 2H6IA 1ELRA 1WM5A 1APFA 2ZU6B 2WB2A 1D8DA 3CKCA 2ZXWE 5ENOD 4A3VA 2J07A 3PZ2A 4FC8A 3PRZA 3UUXA 4BTBA 1ZBPA 1ZLIB 3SFZA 4Q96A 4CDMA 3E30A 3CVUA 4CZ2D 4DPRA 4XKCA 3Q49B 1E90A 4GZ5A 3HXDA 2KATA 5CECB 2IONA 2LSVA 5EYLA 4CRWA 4KT6B 1SQMA 5LP0A 1E96B 3ZYKA 5CHEE 5KJMA 3R9AB 1YMPA 3B7SA 3VTXA 4G25A 2P9UG 3CSTA 3JUEA 2DYRE 4XI0A 4EBAA 4NURA 3UINC 1K1BA 3FTWA 3L16A 4DLQA 4PS8A 3TWTA 4AM9A 2MHKA 1B89A 5KBAA 3N71A 3AS5A 4ABNA 3ZU7B 1E8WA 3BQOA 5G2NA 4AY6A 3G2SA 3DSTA 3E34A 2XS1A 4EZLA 2ETBA 5LCWC 1TNYA 5C2YA 1TNZA 1KPSB 1HS6A 3UT4A 2WXMA 2BTDA 5AQ9A 4B8AA 2DVWA 2WMNA 1ELKA 4L2YA 4JL0A 2JR3A 3APDA 5BUZA 4BT8A 5ENSD 1GL9B 1DVPA 2P9KG 3DSSA 3CV0A 1EF1C 4UWFA 4ATZD 2BUGA 3FUJA 4MRUA 1LD8A 3ML9A 5EDSA 3CVWA 4KVOA 4IYPA 2CFZA 1IHBA 3NZSA 5KJLA 1D9SA 1BD8A 3SD5A 3SQVA 3KSQA 2KC7A 5ANRA 2XRZA 4XZ4A 4ACKA 4GYWA 3CVLA 1U3CA 3TG4A 5BPPA 3URZA 4CYMD 4DK5A 2GROB 1S63A 4GB9A 1IQUA 2YINA 3CVPA 4F53A 3LY9A 1N0QA 3CKBA 3UT8A 4YIRA 2GRLA 4RG9A 4ANXA 4A3TA 2J8SD 4ACLA 4CCAA 2L0IA 5EILA 5EX0A 2LO6A 4FADA 3ASNE 3TJPA 3AG1E 2LXLA 2J49A 2WXIA 2R03A 2Y1LE 3I4RB 4JXTA 4IN3B 1N4PA 4FLHA 2XENA 4NACA 1OUVA 1WAO1 3CHSA 4CDRA 3IXEA 1N4RA 3Q78A 2LNIA 2QY7A 3EU5A 4HI8A 2EIJE 1TN8A 3EDTB 2ILRA 4CT4A 2V8SE 2LAHA 4O60A 4GYYA 4HORA 4CGVA 2JEKA 3D9HA 1Z3XA 4HOSA 1QQEA 3OXFA 5DBKA 2H6FA 2QC9A 4DX1A 3FUDA 1N54A 4GMJA 3HHMA 5JJ7A 2H6GA 4FJYA 3TXNA 2X6HA 3QK0A 4O6FA 4BSZB 5G05J 2L6JA 3FU6A 2MYOA 2I6HA 2WXHA 3EHMA 2IO3C 4HFGA 3MGBA 4HRMB 3CVXA 4I43A 2WXPA 5H7PA 2Y69E 4LUNU 3FFLA 4TXRA 3KD7A 5CERB 1GW6A 5FQ6A 3J5PA 4GA1A 3GZ2A 3QWVA 3PH0C 3ZYMA 3JQ1A 3LPZA 4L1BA 4M3OA 2ONDA 2GGFA 4N3AA 4TXPA 4DX6D 5ARGA 4UQXA 3MKQB 1N0RA 2DLAA 3O48A 3SO8A 1UJKA 4OYSA 3IV0A 4QFVA 3GYZA 3AG3E 3FUKA 2IO2C 4C9BB 3C72A 3EJNA 2KCKA 3E32A 4AP2A 2PZIA 2CHZA 2BDSA 3SF4A 2YHCA 3APFA 1FCHA 4KZCA 4I2WA 2R59A 3BG0B 2IY0C 5A6CA 3B13A 2DZOA 2VGEA 1UG3A 4WNEA 4URKA 1QNFA 2XXLA 3G2TA 5DIZA 2P9SG 5CBOA 2IOSA 2P9PG 2C2LA 4FJZA 5JJTA 1D6BA 5FWQA 4WAFA 4LNUD 4GCOA 3CK8A 3Q7AA 5FJYA 4ATGA 1W3BA 2DIWA 3ABME 1UN9A 3MKRA 1NP7A 4MKTA 2WQHA 3PZ4A 2C0MA 3D9LA 3MKQA 3TAXA 3ESKA 1N95A 1OCZE 3ZEFA 4DX7D 4UI9K 1JPLA 4KXKB 5CCMA 1TN6A 4O1PA 5D0QD 2WXFA 3ZHEB 2HYZA 1ZHHB 3L13A 3UIOC 2BKKB 2VQ2A 3C5RA 1LTXA 2IU1A 2RD0A 3UI2A 4ILHB 3RO2A 2P9LG 3FDHA 3FU3A 3ULQA 3SGHA 3PZ3A 2ZIRA 4IULA 4GPMA 3RU0A 3ASGA 4F6RD 5LOZA 2MN3A 3TWVA 1A17A 4KMOA 4GZDA 3LJNA 3PZDA 3ZYQA 3HG0D 2SH1A 3DRAA 3RJVA 1TJCA 5AJDA 4J8YA 3SBTB 1SHIA 3D9NA 1DC2A 2GRRB 1TEZA 3JUIA 2PM7A 3L17A 4G8LA 2VSNA 3PEUB 4PS3A 4U04A 2Y0BG 1Z6TA 3AS4A 3ZVVA 3VLFA 3DSUA 4UWGA 5KWDA 4F7AA 3ZHEA 4HOUA 1TNUA 3RRUA 2VGXB 3T5XA 1NL4A 3Q73A 2CHXA 4LERA 3B7TA 1JCQA 4GTQA 1TNOA 2WXNA 2XCBA 3W9FA 1BLXB 3C3RA 2R17C 2VSXE 2KCLA 4WNGA 4BWRA 1NA3A 3FUIA 3SNXA 4N2SA 2LUHA 1HFAA 5FINA 1Y8MA 4YNDA 1L5JA 3IBEA 3FP3A 3HVEA 3AG4E 1YA0A 4GTVA 3FUEA 1H6OA 3TGOA 4V3IA 3ZYLA 2GRQB 4I9EA 2BEDA 1NZNA 4APFA 5FQ7A 2X6KA 4K5AB 3CLJA 4HBDA 3FH8A 2AWIA 3LYAA 3B95A 2RG8A 2VGXA 5KNGA 2NC9A 3S7JA 3ASFA 3HXFA 1FPPA 5LFAA 3DWLG 2EIME 2PNNA 3ASHA 1JCRA 1X5BA 1UOHA 1MJ0A 4APOA 3UM0A 3DPYA 3EIJA 5T3RA 1JCSA 1AP7A 2KZTB 2WPVA 1H5OA 2X6FA 5KJKA 4OVVA 4B0ZA 3U9WA 5FQ8A 1MX6A 3VLEA 4HNAD 4F1SA 1N11A 3SHFA 4QQIA 4EZKA 3GW4A 4EPZA 3ULEG 1OCOE 3V2XA 4N3BA 4RSYA 2P9NG 2AXVA 1VDYA 4J8EA 3FTVA 4I1OB 3TWSA 3LS8A 1HH8A 2MOWA 4J0UA 3L9TA 3U4TA 3L22A 4GCNA 1WXNA 2DCPA 4AEZC 4G8KA 4G11A 1UW4B 1V55E 3B7UX 3FTUA 4ANUA 2OCCE 3FEXA 5C1DA 3QB2A 3W9GA 3PNTB 3TWRA 4ZFHA 4A1SA 1QYMA 5LCWJ 4LNBA 2YHEA 3HXBA 4DI3A 4K5CA 2KZTA 2L9BA 2L6BA 3VTYA 4XX5A 5ITZF 3EHRA 4J8DA 3FTXA 2AXZA 4A55A 2DZNA 2KM4A 5FZRA 1DNPA 1ELWA 2WXQA 4PH4B 4YDEA 5B3SE 4AOFA 3DBSA 5A7DB 1DCEA 4CEMA 4XIFA 5A23A 1JUQA 1PAQA 5BT1A 4GMRA 1Z99A 3CQCB 3CVNA 2BKGA 4UI9C 4EZJA 3OXLA 3BEEA 3K9IA 1B8WA 2OVBA 2QZAA 3IHYA 2XRYA 4NRHB 3DSXA 4CT0A 5LX8A 1E8XA 3KAEA 4GPKA 4DX2A 4BTAA 4U8YD 5CCLA 3FUFA 3CK7A 3Q15A 1Q2ZA 5KJNA 3UMVA 2QYJA 3RIBA 4O1OA 2DYSE 4BERA 4C0EA 1WG0A 3CQGB 2MRIA 2XPIA 5AQBA 5J90A 4BETA 3HRAA 3E4BA 1O5MA 2IEJA 1MHQA 4LG6A 4ZHBA 3CVQA 3QNKA 1H2TC 4JD2G 5ENNA 4GU5A 3V2OA 5FTPA 5HRYA 2B9KA 4LRZA 2HJEA 4I2ZA 3C98A 1EL6A 3MZLB 3UM1A 4HLEA 4JHJA 4UQYA 3GZSA 2WMOA 2QYUA 2V5FA 1K8KG 3KS2A 1GKUB 5JHAA 1E8ZA 4G26A 4JEUA 1QBQA 4JB8P 1OWNA 4GAAA 1OWPA 3UXGA 4JPSA 1KLXA 3KEAA 1PY1A 4RQIA 1O1TA 1IHGA
chains in the Genus database with same CATH topology
4KVMA 4WWNA 1EYHA 1Y6IA 3RRNB 2C0MA 3CHOA 3D9LA 3MKQA 3MCXA 3ESKA 3TAXA 4BT9A 1TJFA 3QOUA 3D9KA 5EX3A 2FULA 2HR2A 3ZEFA 4UI9K 3FH7A 4BSXA 1JPLA 1ELRA 4KXKB 4OVUA 3G2UA 5CCMA 1WM5A 5D0QD 1APFA 2ZU6B 2WXFA 2WB2A 5G05C 3ZHEB 3Q5MA 4WWOA 2HYZA 1ZHHB 3CKCA 3L13A 2VQ2A 2XQ0A 1JWGA 4UI9J 4G23A 4JA9A 4A3VA 2IU1A 4U8HA 2J07A 2RD0A 2MUBA 3MV3B 4FC8A 4CGWA 3PRZA 4ILHB 1SH1A 3KEZA 3RO2A 2JTOA 3UUXA 4BTBA 1ZBPA 2BF0X 1ZLIB 3Q4AB 5ANLA 3FDHA 4K0RA 3FU3A 1E7VA 4I6JA 3ULQA 3ZIMA 4HOTA 3SGHA 4U0SA 3SFZA 4IULA 4Q96A 1UN8A 4CDMA 4I17A 3CVUA 4EQFA 2WM9A 5J08A 4P29A 4E85A 3RU0A 5AENA 3ASGA 4EECA 3QWWA 4EBAG 5LOZA 2PM6A 4DPRA 4XKCA 2MN3A 1A17A 4TRQA 4KMOA 4GZDA 4FA6A 3Q49B 1E90A 2PQNA 3APCA 5BV1A 4GZ5A 3FU5A 3PZDA 1FVHA 3ZYQA 2KATA 2IONA 2R5SA 2SH1A 3D9OA 1TJCA 5AJDA 3RJVA 2LSVA 3SBTB 4AV7A 3PDNA 3C38A 2Q7FA 2NSZA 4CRWA 4KT6B 3P1UA 5T8IA 4XI9A 1SQMA 2VSYA 5LP0A 1E96B 3PREA 4H7YA 3ZYKA 3T5VA 3CSFA 1H19A 4ILGA 5FT9A 4I9CA 5CHEE 1SHIA 3D9NA 5KJMA 2RNGA 1TEZA 3R9AB 2VYIA 3B7SA 3VTXA 3JUIA 2PM7A 4G25A 3L17A 3UT7A 2VSNA 3PEUB 4PS3A 2IFUA 3HYMB 2WXOA 4U04A 3CSTA 4WUYA 5JJ6A 4XI0A 1WY6A 1Z6TA 3AS4A 4U63A 4NURA 3ZVVA 4EBAA 3L16A 3FTWA 1NA0A 3VLFA 4PDXA 1H0AA 4DLQA 4PS8A 2HO1A 1OWMA 2Y4TA 4UWGA 1FVFA 4U0ZA 3QWPA 1BPOA 4GZCA 4AM9A 2MHKA 1B89A 2WQ7A 4F7AA 3N71A 3ZHEA 3AS5A 5FQ4A 3CVVA 4I6GA 4ABNA 3OAWA 1KT1A 1E8WA 3PVLA 4HOUA 4KZ0A 5FZQA 4BX9A 1OWLA 3RRUA 3O4ZA 2IOLA 2VGXB 3T5XA 1ZLHB 1HG5A 5G2NA 4AY6A 1QZ2A 4B89A 2J09A 2CHXA 4LERA 3IHVA 3B7TA 1XNFA 3G2SA 3B7RL 5G55A 1XGWA 2WXNA 4EZLA 2XCBA 3FTZA 3HIZA 4TV3A 5LCWC 2GW1A 3VLDA 5C2YA 4F3VA 1HS6A 1ATXA 1UJJA 2R17C 4W9RA 2VSXE 3UT4A 2KCLA 3CHPA 2WXMA 2BTDA 3ESLA 4JA7A 4J8FA 4TUUA 4WNGA 2OOEA 4B8AA 4BWRA 3PE3A 1NA3A 2V4LA 3FUIA 2OV8A 2WMNA 3SNXA 4N2SA 1ELKA 2AW6A 4K03A 4L2YA 3ZFWA 1HFAA 3CIAA 4JL0A 2JR3A 3APDA 2VTBB 1Y8MA 2LSUA 4BT8A 5BUZA 4YNDA 5CMWA 1L5JA 3IBEA 3FP3A 3HVEA 3HDXA 3CHRA 3D9MA 4NQ0A 3JCKC 1DVPA 1YA0A 3RKVA 2QSGA 3FUEA 2GRMA 3CV0A 2K2XA 5FZSA 3TGOA 3IKOB 2WXGA 3FWVA 1EF1C 3GZ1A 4V3IA 4UWFA 2BUGA 4I6EA 3U64A 2Y4UA 3FUJA 1HZ4A 3LY8A 3ZYLA 4I9EA 4MRUA 3PEVB 4L2LA 3ML9A 5EDSA 2J4DA 2HJ9C 3CVWA 1NZNA 4KVOA 4IYPA 4HVBA 4APFA 3QKYA 5FQ7A 4U07A 2CFZA 3NZSA 5KJLA 3ENEA 2X6KA 2A5UA 3SD5A 3LY7A 4G1TA 2VGYA 2KC7A 5ANRA 1BDSA 3CLJA 2FEZA 2XRZA 3FH8A 2AWIA 2QSHA 3LYAA 4XZ4A 2UY1B 4ACKA 4GYOA 2RG8A 4G2VA 1IYGA 4GYWA 1OWOA 2VGXA 3CVLA 3NQPA 2XGSA 5E75A 5BV0A 3LMSB 4DJAA 1U3CA 2CG2A 2NC9A 3S7JA 3TG4A 1H2VC 5BPPA 3ASFA 3URZA 4DK5A 3PE4A 5LFAA 2X6JA 4GB9A 1IQUA 3OXGA 4I1MA 4WNFA 3ONKA 5D0OD 4KYOB 3ASHA 2YINA 1X5BA 1E8YA 3CVPA 4LEUA 4R7LA 4APOA 3S7DA 4F53A 3C30A 2IF4A 2XEVA 3LY9A 4HXIA 3CKBA 3OTNA 4Y6CA 3CK9A 4JVSA 3EIJA 5T3RA 2IKEA 3WXXA 2KZTB 2WPVA 1H5OA 2X6FA 3S7BA 3UT8A 2X6IA 4YIRA 2PQRA 3I3NA 5KJKA 2VTBA 3HVEB 4GV5A 3QARA 4OVVA 2XGOA 3ZW3A 3FUNA 4B0ZA 2GRLA 3UX4A 3U9WA 3QAQA 5KCMA 3EHNA 3U66A 4L7TA 2YQ8A 5FQ8A 4YVQC 1E7UA 4RG9A 3RO3A 1ZU2A 1HXIA 4ANXA 4MLPA 3VLEA 4A3TA 5JHBA 4XKBA 1IQRA 4GMLA 4G24A 4ACLA 3CVYA 3AU4A 2OVFA 1KT0A 4F1SA 4CCAA 2L0IA 3SHFA 4RVBA 3LEWA 4EZKA 3GW4A 5AYWD 4BFRA 4EPZA 2XHEA 4MS6A 5EX0A 5E76A 3S7FA 2IQCA 3ZRHA 2LO6A 1EPUA 3ML8A 4FADA 4N3BA 1HO8A 3TJPA 2FO7A 5BNWA 4GZ3A 4RSYA 3UPVA 1ZUFA 2H9XA 2AXVA 1VDYA 4J8EA 3UQ3A 3FTVA 4I1OB 4Y6WA 2J49A 2J9QA 2WXIA 1HF8A 3LS8A 1HH8A 2UY1A 3R7QA 2MOWA 3I4RB 4JXTA 4IN3B 4AXHA 4J0UA 4AJWA 2XCCA 4FLHA 5M72A 4D10C 4GA2A 4NACA 3AU5A 3ASDA 3U4TA 1OUVA 3L22A 3MYVA 4GCNA 1WXNA 1WAO1 1H2UA 4ANWA 3RRMB 3FHEA 2DCPA 3ZXSA 4AEZC 3CHSA 4G11A 4CDRA 1UW4B 3B7UX 3FTUA 4ANUA 4N2QA 4UQZA 3LKUA 1JWFA 3BG1B 3FEXA 5C1DA 3SBSA 5HQ8A 3QB2A 3QDNA 3TXMA 4BX8A 1LF8A 3PNTB 1Z3YA 4PS7A 4A1GA 1U3DA 3FUMA 2LNIA 5G04J 4N39A 2QY7A 3Q47B 4FP7A 4A1SA 3FH5A 3LXUX 2DBAA 3EDTB 4UWLA 5LCWJ 3EIQC 2ILRA 2YHEA 4CT4A 3TL5A 2X38A 4DI3A 4B94A 2IKDA 2KZTA 2QSFA 1N52A 4I1AA 2L9BA 1SZ9A 3R7RA 2V8SE 2LAHA 2J4BA 3VTYA 4XX5A 3JYSA 3CGHA 2LAIA 2WXLA 3JQ0A 2WXKA 4J8DA 4GYYA 3FTXA 4HORA 4CGVA 3D9IA 2JEKA 2AXZA 4JZYA 4A55A 1Z3XA 2KM4A 5ARFA 5FZRA 3I5PA 4HOSA 1WQKA 1DNPA 2VSOE 3MX3A 2NXPA 3FEYA 4JHKA 1ELWA 2WXQA 1QQEA 4PH4B 4HS2A 3FTYA 3OXFA 3ZPJA 4AOFA 3DBSA 5DBKA 5A7DB 4IRUA 2A4ZA 4GA0A 4H7XA 4CEMA 4FULA 4XIFA 5A23A 3FUDA 1JUQA 1PAQA 3AS8A 3I4GA 4L23A 4FLBA 1N54A 1H6KA 4GMJA 5BT1A 3HHMA 4ME2A 2M63A 5JJ7A 4PUCA 5HI7A 1Z99A 3FTSA 3CQCB 3CVNA 2I1JA 4RG6A 4UI9C 4EZJA 4FJYA 3PUJA 4XE0A 3OXLA 3TXNA 3BEEA 3K9IA 1B8WA 3PNLB 2FF4A 4DLOA 2C0LA 2X6HA 3QK0A 4O6FA 3L54A 2OVBA 2FBNA 4JEHA 3IHYA 1HE8A 5G05J 2XRYA 2L6JA 3FU6A 2Y3AA 3NF1A 4NRHB 1HG2A 2I6HA 3CHQA 4Q94A 2WXHA 4CT0A 5AIJA 2KCVA 5LX8A 1E8XA 3EHMA 4HFGA 3MGBA 4BY6A 3KAEA 1ZUEA 4GPKA 4BTAA 3CVXA 5CCLA 2I1KA 4DI4A 5CMYA 4I43A 2WXPA 4JW1A 3FUFA 4FHJA 3CK7A 3G2WA 3Q15A 5KJNA 3PUKA 2CG3A 3FU0A 3UMVA 2WXJA 3RK6A 4LUNU 3ONLA 3RIBA 3FFLA 2I9CA 2YNQA 3IEGA 5T4YA 2FI7A 5AJLA 3KD7A 1GW6A 1INZA 5BW8C 5FQ6A 4GA1A 4J6IA 3L08A 3LDZA 1PC2A 2UWJG 3U3WA 4FHKA 2WVIA 3P2BA 4C0EA 3ZN3A 4AIFA 3GZ2A 3MA5A 3CQGB 3QWVA 3PH0C 2E0IA 2XPYA 3ZYMA 3L6AA 3G2VA 2MRIA 2XPIA 3JQ1A 3LPZA 4J8SA 4L1BA 5J90A 2XGMA 4M3OA 2ONDA 4CDNA 3E4BA 2GGFA 4N3AA 3FULA 3NZUA 2HM8A 4WNDA 4UWHA 2XPZA 2WXRA 5EKQD 5ARGA 3QC1A 2X3MA 4UQXA 2CFUA 3LVRE 3MKQB 3LCAA 2L0TB 4AVXA 4UWKA 1MHQA 3CVQA 2DLAA 1HX8A 3O48A 1HU3A 3D9JA 2JLBA 1UJKA 2PL2A 3LJ3A 3QNKA 1H2TC 3SI5A 2VJ8A 4KBQA 2IJGX 4OYSA 3IV0A 4QFVA 3GYZA 3FUKA 3QJZA 4GU5A 5ENNA 4Q69A 2J08A 4C9BB 3EJNA 2I2OA 2KCKA 4N5CA 4AP2A 3CHMA 5FTPA 2PZIA 4FU3A 2CHZA 4WWPA 2BDSA 2B9KA 4LRZA 2CHWA 2YHCA 4ILIA 3FY4A 3APFA 3SF4A 3FUHA 2P58C 3CR3A 3D9PA 3TG5A 4C0MA 2HJEA 3MJWA 1FCHA 4I2ZA 2QFCA 4I2WA 4LCTA 4KZCA 2R59A 3C98A 3SZ7A 2AXUA 5G04C 3BG0B 4HOQA 3MZLB 4U0UA 4ANVA 4E6HA 5A6CA 3B13A 3D4UB 4HLEA 4JHJA 4UQYA 3GZSA 3DPDA 2WMOA 1UG3A 4WNEA 4URKA 1SZAA 3T8MA 1QNFA 2V5FA 2XXLA 3G2TA 3KS2A 5DIZA 5JHAA 1E8ZA 4G26A 2IOSA 4JEUA 1AHLA 4B8CB 3D3MA 2C2LA 4FJZA 3S2AA 3MV2B 5JJTA 2V0PA 3LVQE 1P5QA 2E2EA 4JHRA 1OWNA 3MEKA 1D6BA 4YVOA 5FWQA 1MQSA 4GAAA 4WAFA 1OWPA 3CEQA 4JC8A 2EQXA 4GCOA 3CK8A 4GZ6A 4JPSA 4N3CA 5FJYA 1KLXA 3PS6A 1S0PA 4ATGA 1W3BA 1PY1A 2DIWA 1EDUA 3ZGQA 1UN9A 3MKRA 1NP7A 1IHGA 4MKTA 2WQ6A 2AVPA 2WQHA 4AY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CK7 A;  3KEZ A;  3LEW A;  3CKB A;  3JQ0 A;  3OTN A;  3CK9 A;  5T3R A;  4Q69 A;  3EJN A;  3FDH A;  5J90 A;  5E76 A;  3NQP A;  5E75 A;  3MCX A;  3SGH A;  3P1U A;  4F7A A;  5FQ4 A;  5T4Y A;  3IV0 A;  3MX3 A;  4MRU A;  3SNX A;  3EHN A;  4L7T A;  5FQ6 A;  5FQ8 A;  5FQ7 A;  3CK8 A;  5LX8 A;  4LER A;  3EHM A;  3CKC A;  3IHV A;  3L22 A;  3MYV A;  3I4G A;  3QNK A;  3HDX A;  4F53 A;  3GZS A;  3JYS A;  3CGH A;  4PUC A;  3JQ1 A; 
#chains in the Genus database with same CATH topology
 2EIL E;  3Q9N C;  4EHM A;  1TJF A;  5EX3 A;  2XZT G;  4OVU A;  4YDO A;  5G05 C;  4WWO A;  4OAU C;  2XQ0 A;  4JA9 A;  3UKR G;  3MV3 B;  4CGW A;  3KEZ A;  2JTO A;  2ETA A;  2BF0 X;  2EIK E;  1E7V A;  2F0Y A;  3T8K A;  4HOT A;  2RFM A;  4U0S A;  3ABL E;  4I17 A;  4EQF A;  2WM9 A;  4P29 A;  4E85 A;  4EEC A;  4EBA G;  4TRQ A;  2AJA A;  4FA6 A;  3ZNG A;  5BV1 A;  3FU5 A;  1FVH A;  2R5S A;  3D9O A;  4AV7 A;  3PDN A;  5T8I A;  4GTR A;  2VSY A;  2B0O E;  3PRE A;  4H7Y A;  3UIP C;  1H19 A;  5CRU A;  4HB5 A;  3HYM B;  5JA4 D;  2RFA A;  1NA0 A;  4PDX A;  2HO1 A;  1G3N B;  1OWM A;  2Y4T A;  4U0Z A;  3QWP A;  1BPO A;  4GZC A;  3CVV A;  5FQ4 A;  3OAW A;  1KT1 A;  4KZ0 A;  5FZQ A;  4BX9 A;  1OWL A;  2IOL A;  1HG5 A;  1QZ2 A;  4B89 A;  2J09 A;  4B93 B;  3ZXP A;  3IHV A;  1OXJ A;  4Z68 A;  5G55 A;  1XGW A;  4C48 B;  2GW1 A;  4F3V A;  2GRN B;  4YDW A;  2A5E A;  4W9R A;  3ESL A;  1N94 A;  4TUU A;  2H6H A;  2OOE A;  2ZIS A;  3PE3 A;  2AW6 A;  3CIA A;  2VTB B;  2LSU A;  5CMW A;  3RAU A;  3HDX A;  3D9M A;  4NQ0 A;  2QSG A;  3RKV A;  2GRM A;  1SA5 A;  2K2X A;  5FZS A;  3TWW A;  3GZ1 A;  1U2V G;  4I6E A;  4U95 D;  3PEV B;  2HJ9 C;  5IY5 E;  4U07 A;  3V30 A;  1OY3 D;  1SA4 A;  4G1T A;  1BDS A;  4DUI A;  1O1S A;  2B6C A;  4HLL A;  2UY1 B;  4GYO A;  3BU8 A;  5CEA A;  4HI9 A;  3NQP A;  5E75 A;  5BV0 A;  3LMS B;  3PE4 A;  3Q9U C;  4GTO A;  2X6J A;  1N9A A;  5AAR A;  3OXG A;  5B1A E;  4WNF A;  3SY2 A;  3S7D A;  1IXV A;  4HXI A;  4JVS A;  2EIN E;  1MZC A;  3ULY A;  3S7B A;  2X6I A;  2PQR A;  3I3N A;  2VTB A;  3HVE B;  3QAR A;  2XGO A;  3EHQ A;  3QAQ A;  5KCM A;  3U66 A;  2YQ8 A;  1E7U A;  3RO3 A;  1TN7 A;  1ZU2 A;  4MLP A;  3X2Q E;  1IQR A;  4GML A;  4G24 A;  3AU4 A;  1KT0 A;  2P2C P;  4U96 D;  4U8V D;  5AYW D;  2XHE A;  5E76 A;  3S7F A;  2IQC A;  1EPU A;  3ML8 A;  1Z5S C;  1HO8 A;  5BNW A;  2FO7 A;  1RW2 A;  3UPV A;  5HKP A;  1ZUF A;  3UQ3 A;  4Y6W A;  4XEI G;  1HF8 A;  2UY1 A;  3KSL A;  3R7Q A;  2ETC A;  2XCC A;  4D10 C;  4GA2 A;  3ASD A;  2LXM A;  3RRM B;  5KNH D;  4DX5 D;  4UQZ A;  3LKU A;  1JWF A;  1LF8 A;  4A1G A;  3DXK G;  1OCR E;  5G04 J;  4RLY A;  2FO1 E;  3NAW A;  2DBA A;  2HE0 A;  4UWL A;  3EIQ C;  2IKD A;  2QSF A;  4B94 A;  1N52 A;  4I1A A;  3R7R A;  2J4B A;  3CGH A;  2LAI A;  2ZGD A;  5EID A;  4JZY A;  1WQK A;  5ARF A;  3L82 A;  5AQA A;  4JHK A;  4HS2 A;  4H7X A;  3AS8 A;  1TR4 A;  5JMN D;  3FTS A;  3F6Q A;  4XE0 A;  3TWU A;  2FF4 A;  2FBN A;  4U7E B;  2Y3A A;  3CHQ A;  4Q94 A;  5AIJ A;  5ENR D;  2KCV A;  3EU9 A;  3V79 K;  1ZUE A;  2I1K A;  4DI4 A;  5CMY A;  1NI1 A;  2CG3 A;  3FU0 A;  2WXJ A;  1SW6 A;  3ZKJ A;  2FI7 A;  5AN8 A;  5AJL A;  2XZD G;  5EN5 D;  2WVI A;  3P2B A;  4GTM A;  2E0I A;  3G2V A;  4J8S A;  2XGM A;  4GTP A;  4CDN A;  4X8Q A;  3FUL A;  3NZU A;  5EKQ D;  2X3M A;  4K5B A;  3LVR E;  3LCA A;  2L0T B;  2JAB A;  4AVX A;  4NIK A;  1HX8 A;  5AEN A;  1HU3 A;  3D9J A;  2PL2 A;  4KBQ A;  4Q69 A;  2J08 A;  2I2O A;  4N5Q A;  2F8Y A;  2P58 C;  3D9P A;  3TG5 A;  4LCT A;  3SZ7 A;  1LD7 A;  2AXU A;  1MX2 A;  3E33 A;  4U0U A;  4E6H A;  5EIB E;  3T9K A;  3DEO A;  3T8M A;  1N4S A;  1AHL A;  4B8C B;  2XEH A;  3D3M A;  3AG2 E;  3E37 A;  3S2A A;  3MV2 B;  2E2E A;  4JHR A;  5AAO A;  4GTS A;  5ENT D;  4YVO A;  3AJI A;  2KXP C;  3CEQ A;  2EQX A;  2KBX A;  3ZGQ A;  1FT2 A;  4HRL A;  4HQD A;  2WQ6 A;  1S70 B;  4WWN A;  1EYH A;  3B7B A;  3CHO A;  4BT9 A;  3QOU A;  3D9K A;  5CED B;  2FUL A;  2HR2 A;  2XEE A;  3FH7 A;  4BSX A;  1H6P A;  5CBN A;  3G2U A;  4HRN A;  5CRV A;  3Q5M A;  4UI9 J;  1JWG A;  3C3Q A;  4G23 A;  4U8H A;  2MUB A;  1SH1 A;  4L9P A;  3Q4A B;  5ANL A;  4K0R A;  3ZIM A;  1OCC E;  4I6J A;  3NOC D;  3DEP A;  1BI7 B;  3UKU G;  1UN8 A;  5J08 A;  1DCQ A;  3QWW A;  2PM6 A;  1AWC B;  2R2L A;  2PQN A;  3APC A;  4DRX E;  5ENP D;  2GRP B;  2P9I G;  3C38 A;  2Q7F A;  2NSZ A;  3P1U A;  4XI9 A;  2OEW A;  3T5V A;  3CSF A;  4BEP A;  4ILG A;  5FT9 A;  4I9C A;  1N4Q A;  3UM2 A;  2RNG A;  1S64 A;  2VYI A;  2OEV A;  3UT7 A;  4WUY A;  2IFU A;  2WXO A;  5JJ6 A;  2RKK A;  1WY6 A;  4U63 A;  1H0A A;  1KZO A;  1FVF A;  2WQ7 A;  1BI8 B;  4MBG A;  4I6G A;  1D8E A;  3PVL A;  3O4Z A;  1ZLH B;  1FT1 A;  1XNF A;  3B7R L;  3FTZ A;  3HIZ A;  4TV3 A;  1ZB1 A;  3VLD A;  1ATX A;  1UJJ A;  3UM3 A;  3CHP A;  4J8F A;  4JA7 A;  2V4L A;  1K1A A;  2OV8 A;  5AQ7 A;  1YCS B;  4K03 A;  3ZFW A;  3CHR A;  3JCK C;  3JXJ A;  3IKO B;  2WXG A;  3Q79 A;  3FWV A;  3U64 A;  2Y4U A;  3LY8 A;  1HZ4 A;  4L2L A;  2J4D A;  4HVB A;  4M7C A;  3QKY A;  3JXI A;  3ENE A;  2A5U A;  3LY7 A;  2VGY A;  1NFI E;  2FEZ A;  2QSH A;  2F37 A;  3ZUV B;  4G2V A;  1IYG A;  1OWO A;  1O1R A;  2XGS A;  4DJA A;  2CG2 A;  1H2V C;  1TNB A;  3Q75 A;  4I1M A;  5D0O D;  3ONK A;  4KYO B;  1E8Y A;  4LEU A;  4R7L A;  3AAA C;  3C30 A;  2IF4 A;  2XEV A;  2F8X K;  3OTN A;  4Y6C A;  3CK9 A;  2IKE A;  3WXX A;  3SFX A;  4GV5 A;  5BXU A;  3PZ1 A;  3ZW3 A;  3FUN A;  3R9M A;  3UX4 A;  3EHN A;  4L7T A;  1OT8 A;  4YVQ C;  1HXI A;  5JHB A;  4XKB A;  3CVY A;  2R05 A;  2OVF A;  2R02 A;  4RVB A;  3LEW A;  3WG7 E;  4BFR A;  4MS6 A;  3ZRH A;  2NYJ A;  1TYQ G;  1V54 E;  4GZ3 A;  3HXE A;  2H9X A;  2J9Q A;  3ABK E;  5BXO A;  4AXH A;  4AJW A;  5M72 A;  3AU5 A;  3TWQ A;  3MYV A;  1H2U A;  4ANW A;  3FHE A;  3ZXS A;  4N2Q A;  3BG1 B;  2V4H C;  1YYH A;  3SBS A;  5HQ8 A;  3QDN A;  3TXM A;  4BX8 A;  1Z3Y A;  3TWX A;  4PS7 A;  1U3D A;  3FUM A;  3DXM G;  4N39 A;  3NBN B;  3Q47 B;  4FP7 A;  3FH5 A;  3LXU X;  3TL5 A;  2X38 A;  3ASO E;  4OAV B;  4F1P A;  1SZ9 A;  3JYS A;  2WXL A;  4A63 B;  3NOG D;  3JQ0 A;  2WXK A;  1MX4 A;  3D9I A;  4LNG A;  3I5P A;  2VSO E;  3MX3 A;  2NXP A;  3FEY A;  3Q7F A;  3FTY A;  3ZPJ A;  1RZ4 A;  2ZGG A;  4IRU A;  2A4Z A;  4GA0 A;  4FUL A;  5B1B E;  3I4G A;  4L23 A;  4FLB A;  1H6K A;  4ME2 A;  3RSE G;  2M63 A;  5HI7 A;  4PUC A;  1K3Z D;  2I1J A;  4RG6 A;  1KZP A;  1A5E A;  1WDY A;  3PUJ A;  4GTT A;  3PNL B;  3J5Q B;  2C0L A;  3UTM A;  4J7W A;  4DLO A;  3L54 A;  4JEH A;  1HE8 A;  3NF1 A;  1HG2 A;  1IKN D;  2XS8 A;  4BY6 A;  4JW1 A;  4FHJ A;  3G2W A;  3PUK A;  3RK6 A;  3DSW A;  3ONL A;  2I9C A;  2YNQ A;  3IEG A;  5T4Y A;  4LSZ E;  1INZ A;  5BW8 C;  2V5Q C;  3SFY A;  3IF4 A;  4J6I A;  3L08 A;  3LDZ A;  1PC2 A;  2UWJ G;  3U3W A;  3BUA A;  4FHK A;  3EUV A;  5EYP F;  3ZN3 A;  4AIF A;  3MA5 A;  4TUM A;  3C3O A;  2XPY A;  3L6A A;  4TXQ A;  5D2M C;  2HM8 A;  4WND A;  4UWH A;  2XPZ A;  2WXR A;  3QC1 A;  3NB2 A;  2CFU A;  1MYO A;  4UWK A;  2JLB A;  3LJ3 A;  3SI5 A;  2VJ8 A;  2IJG X;  3QJZ A;  4N5C A;  5FIO A;  3CHM A;  5ENQ D;  4FU3 A;  4WWP A;  2CHW A;  4ILI A;  3FY4 A;  3FUH A;  3CR3 A;  4C0M A;  1BU9 A;  3MJW A;  2QFC A;  3HXC A;  5G04 C;  4HOQ A;  5HS0 A;  4ANV A;  3D4U B;  3DPD A;  3DSV A;  1SZA A;  3ISM C;  3V31 A;  4UUC A;  2V0P A;  1SVX A;  1P5Q A;  3LVQ E;  4BES A;  2DWZ A;  3MEK A;  1MQS A;  4JC8 A;  4GZ6 A;  4N3C A;  3PS6 A;  1S0P A;  1EDU A;  2AVP A;  4AY5 A;  4KVM A;  4YDY A;  1Y6I A;  3RRN B;  3MCX A;  5D66 A;  1X81 A;  2H6I A;  1ELR A;  1WM5 A;  1APF A;  2ZU6 B;  2WB2 A;  1D8D A;  3CKC A;  2ZXW E;  5ENO D;  4A3V A;  2J07 A;  3PZ2 A;  4FC8 A;  3PRZ A;  3UUX A;  4BTB A;  1ZBP A;  1ZLI B;  3SFZ A;  4Q96 A;  4CDM A;  3E30 A;  3CVU A;  4CZ2 D;  4DPR A;  4XKC A;  3Q49 B;  1E90 A;  4GZ5 A;  3HXD A;  2KAT A;  5CEC B;  2ION A;  2LSV A;  5EYL A;  4CRW A;  4KT6 B;  1SQM A;  5LP0 A;  1E96 B;  3ZYK A;  5CHE E;  5KJM A;  3R9A B;  1YMP A;  3B7S A;  3VTX A;  4G25 A;  2P9U G;  3CST A;  3JUE A;  2DYR E;  4XI0 A;  4EBA A;  4NUR A;  3UIN C;  1K1B A;  3FTW A;  3L16 A;  4DLQ A;  4PS8 A;  3TWT A;  4AM9 A;  2MHK A;  1B89 A;  5KBA A;  3N71 A;  3AS5 A;  4ABN A;  3ZU7 B;  1E8W A;  3BQO A;  5G2N A;  4AY6 A;  3G2S A;  3DST A;  3E34 A;  2XS1 A;  4EZL A;  2ETB A;  5LCW C;  1TNY A;  5C2Y A;  1TNZ A;  1KPS B;  1HS6 A;  3UT4 A;  2WXM A;  2BTD A;  5AQ9 A;  4B8A A;  2DVW A;  2WMN A;  1ELK A;  4L2Y A;  4JL0 A;  2JR3 A;  3APD A;  5BUZ A;  4BT8 A;  5ENS D;  1GL9 B;  1DVP A;  2P9K G;  3DSS A;  3CV0 A;  1EF1 C;  4UWF A;  4ATZ D;  2BUG A;  3FUJ A;  4MRU A;  1LD8 A;  3ML9 A;  5EDS A;  3CVW A;  4KVO A;  4IYP A;  2CFZ A;  1IHB A;  3NZS A;  5KJL A;  1D9S A;  1BD8 A;  3SD5 A;  3SQV A;  3KSQ A;  2KC7 A;  5ANR A;  2XRZ A;  4XZ4 A;  4ACK A;  4GYW A;  3CVL A;  1U3C A;  3TG4 A;  5BPP A;  3URZ A;  4CYM D;  4DK5 A;  2GRO B;  1S63 A;  4GB9 A;  1IQU A;  2YIN A;  3CVP A;  4F53 A;  3LY9 A;  1N0Q A;  3CKB A;  3UT8 A;  4YIR A;  2GRL A;  4RG9 A;  4ANX A;  4A3T A;  2J8S D;  4ACL A;  4CCA A;  2L0I A;  5EIL A;  5EX0 A;  2LO6 A;  4FAD A;  3ASN E;  3TJP A;  3AG1 E;  2LXL A;  2J49 A;  2WXI A;  2R03 A;  2Y1L E;  3I4R B;  4JXT A;  4IN3 B;  1N4P A;  4FLH A;  2XEN A;  4NAC A;  1OUV A;  1WAO 1;  3CHS A;  4CDR A;  3IXE A;  1N4R A;  3Q78 A;  2LNI A;  2QY7 A;  3EU5 A;  4HI8 A;  2EIJ E;  1TN8 A;  3EDT B;  2ILR A;  4CT4 A;  2V8S E;  2LAH A;  4O60 A;  4GYY A;  4HOR A;  4CGV A;  2JEK A;  3D9H A;  1Z3X A;  4HOS A;  1QQE A;  3OXF A;  5DBK A;  2H6F A;  2QC9 A;  4DX1 A;  3FUD A;  1N54 A;  4GMJ A;  3HHM A;  5JJ7 A;  2H6G A;  4FJY A;  3TXN A;  2X6H A;  3QK0 A;  4O6F A;  4BSZ B;  5G05 J;  2L6J A;  3FU6 A;  2MYO A;  2I6H A;  2WXH A;  3EHM A;  2IO3 C;  4HFG A;  3MGB A;  4HRM B;  3CVX A;  4I43 A;  2WXP A;  5H7P A;  2Y69 E;  4LUN U;  3FFL A;  4TXR A;  3KD7 A;  5CER B;  1GW6 A;  5FQ6 A;  3J5P A;  4GA1 A;  3GZ2 A;  3QWV A;  3PH0 C;  3ZYM A;  3JQ1 A;  3LPZ A;  4L1B A;  4M3O A;  2OND A;  2GGF A;  4N3A A;  4TXP A;  4DX6 D;  5ARG A;  4UQX A;  3MKQ B;  1N0R A;  2DLA A;  3O48 A;  3SO8 A;  1UJK A;  4OYS A;  3IV0 A;  4QFV A;  3GYZ A;  3AG3 E;  3FUK A;  2IO2 C;  4C9B B;  3C72 A;  3EJN A;  2KCK A;  3E32 A;  4AP2 A;  2PZI A;  2CHZ A;  2BDS A;  3SF4 A;  2YHC A;  3APF A;  1FCH A;  4KZC A;  4I2W A;  2R59 A;  3BG0 B;  2IY0 C;  5A6C A;  3B13 A;  2DZO A;  2VGE A;  1UG3 A;  4WNE A;  4URK A;  1QNF A;  2XXL A;  3G2T A;  5DIZ A;  2P9S G;  5CBO A;  2IOS A;  2P9P G;  2C2L A;  4FJZ A;  5JJT A;  1D6B A;  5FWQ A;  4WAF A;  4LNU D;  4GCO A;  3CK8 A;  3Q7A A;  5FJY A;  4ATG A;  1W3B A;  2DIW A;  3ABM E;  1UN9 A;  3MKR A;  1NP7 A;  4MKT A;  2WQH A;  3PZ4 A;  2C0M A;  3D9L A;  3MKQ A;  3TAX A;  3ESK A;  1N95 A;  1OCZ E;  3ZEF A;  4DX7 D;  4UI9 K;  1JPL A;  4KXK B;  5CCM A;  1TN6 A;  4O1P A;  5D0Q D;  2WXF A;  3ZHE B;  2HYZ A;  1ZHH B;  3L13 A;  3UIO C;  2BKK B;  2VQ2 A;  3C5R A;  1LTX A;  2IU1 A;  2RD0 A;  3UI2 A;  4ILH B;  3RO2 A;  2P9L G;  3FDH A;  3FU3 A;  3ULQ A;  3SGH A;  3PZ3 A;  2ZIR A;  4IUL A;  4GPM A;  3RU0 A;  3ASG A;  4F6R D;  5LOZ A;  2MN3 A;  3TWV A;  1A17 A;  4KMO A;  4GZD A;  3LJN A;  3PZD A;  3ZYQ A;  3HG0 D;  2SH1 A;  3DRA A;  3RJV A;  1TJC A;  5AJD A;  4J8Y A;  3SBT B;  1SHI A;  3D9N A;  1DC2 A;  2GRR B;  1TEZ A;  3JUI A;  2PM7 A;  3L17 A;  4G8L A;  2VSN A;  3PEU B;  4PS3 A;  4U04 A;  2Y0B G;  1Z6T A;  3AS4 A;  3ZVV A;  3VLF A;  3DSU A;  4UWG A;  5KWD A;  4F7A A;  3ZHE A;  4HOU A;  1TNU A;  3RRU A;  2VGX B;  3T5X A;  1NL4 A;  3Q73 A;  2CHX A;  4LER A;  3B7T A;  1JCQ A;  4GTQ A;  1TNO A;  2WXN A;  2XCB A;  3W9F A;  1BLX B;  3C3R A;  2R17 C;  2VSX E;  2KCL A;  4WNG A;  4BWR A;  1NA3 A;  3FUI A;  3SNX A;  4N2S A;  2LUH A;  1HFA A;  5FIN A;  1Y8M A;  4YND A;  1L5J A;  3IBE A;  3FP3 A;  3HVE A;  3AG4 E;  1YA0 A;  4GTV A;  3FUE A;  1H6O A;  3TGO A;  4V3I A;  3ZYL A;  2GRQ B;  4I9E A;  2BED A;  1NZN A;  4APF A;  5FQ7 A;  2X6K A;  4K5A B;  3CLJ A;  4HBD A;  3FH8 A;  2AWI A;  3LYA A;  3B95 A;  2RG8 A;  2VGX A;  5KNG A;  2NC9 A;  3S7J A;  3ASF A;  3HXF A;  1FPP A;  5LFA A;  3DWL G;  2EIM E;  2PNN A;  3ASH A;  1JCR A;  1X5B A;  1UOH A;  1MJ0 A;  4APO A;  3UM0 A;  3DPY A;  3EIJ A;  5T3R A;  1JCS A;  1AP7 A;  2KZT B;  2WPV A;  1H5O A;  2X6F A;  5KJK A;  4OVV A;  4B0Z A;  3U9W A;  5FQ8 A;  1MX6 A;  3VLE A;  4HNA D;  4F1S A;  1N11 A;  3SHF A;  4QQI A;  4EZK A;  3GW4 A;  4EPZ A;  3ULE G;  1OCO E;  3V2X A;  4N3B A;  4RSY A;  2P9N G;  2AXV A;  1VDY A;  4J8E A;  3FTV A;  4I1O B;  3TWS A;  3LS8 A;  1HH8 A;  2MOW A;  4J0U A;  3L9T A;  3U4T A;  3L22 A;  4GCN A;  1WXN A;  2DCP A;  4AEZ C;  4G8K A;  4G11 A;  1UW4 B;  1V55 E;  3B7U X;  3FTU A;  4ANU A;  2OCC E;  3FEX A;  5C1D A;  3QB2 A;  3W9G A;  3PNT B;  3TWR A;  4ZFH A;  4A1S A;  1QYM A;  5LCW J;  4LNB A;  2YHE A;  3HXB A;  4DI3 A;  4K5C A;  2KZT A;  2L9B A;  2L6B A;  3VTY A;  4XX5 A;  5ITZ F;  3EHR A;  4J8D A;  3FTX A;  2AXZ A;  4A55 A;  2DZN A;  2KM4 A;  5FZR A;  1DNP A;  1ELW A;  2WXQ A;  4PH4 B;  4YDE A;  5B3S E;  4AOF A;  3DBS A;  5A7D B;  1DCE A;  4CEM A;  4XIF A;  5A23 A;  1JUQ A;  1PAQ A;  5BT1 A;  4GMR A;  1Z99 A;  3CQC B;  3CVN A;  2BKG A;  4UI9 C;  4EZJ A;  3OXL A;  3BEE A;  3K9I A;  1B8W A;  2OVB A;  2QZA A;  3IHY A;  2XRY A;  4NRH B;  3DSX A;  4CT0 A;  5LX8 A;  1E8X A;  3KAE A;  4GPK A;  4DX2 A;  4BTA A;  4U8Y D;  5CCL A;  3FUF A;  3CK7 A;  3Q15 A;  1Q2Z A;  5KJN A;  3UMV A;  2QYJ A;  3RIB A;  4O1O A;  2DYS E;  4BER A;  4C0E A;  1WG0 A;  3CQG B;  2MRI A;  2XPI A;  5AQB A;  5J90 A;  4BET A;  3HRA A;  3E4B A;  1O5M A;  2IEJ A;  1MHQ A;  4LG6 A;  4ZHB A;  3CVQ A;  3QNK A;  1H2T C;  4JD2 G;  5ENN A;  4GU5 A;  3V2O A;  5FTP A;  5HRY A;  2B9K A;  4LRZ A;  2HJE A;  4I2Z A;  3C98 A;  1EL6 A;  3MZL B;  3UM1 A;  4HLE A;  4JHJ A;  4UQY A;  3GZS A;  2WMO A;  2QYU A;  2V5F A;  1K8K G;  3KS2 A;  1GKU B;  5JHA A;  1E8Z A;  4G26 A;  4JEU A;  1QBQ A;  4JB8 P;  1OWN A;  4GAA A;  1OWP A;  3UXG A;  4JPS A;  1KLX A;  3KEA A;  1PY1 A;  4RQI A;  1O1T A;  1IHG A; 
#chains in the Genus database with same CATH homology
 4KVM A;  4WWN A;  1EYH A;  1Y6I A;  3RRN B;  2C0M A;  3CHO A;  3D9L A;  3MKQ A;  3MCX A;  3ESK A;  3TAX A;  4BT9 A;  1TJF A;  3QOU A;  3D9K A;  5EX3 A;  2FUL A;  2HR2 A;  3ZEF A;  4UI9 K;  3FH7 A;  4BSX A;  1JPL A;  1ELR A;  4KXK B;  4OVU A;  3G2U A;  5CCM A;  1WM5 A;  5D0Q D;  1APF A;  2ZU6 B;  2WXF A;  2WB2 A;  5G05 C;  3ZHE B;  3Q5M A;  4WWO A;  2HYZ A;  1ZHH B;  3CKC A;  3L13 A;  2VQ2 A;  2XQ0 A;  1JWG A;  4UI9 J;  4G23 A;  4JA9 A;  4A3V A;  2IU1 A;  4U8H A;  2J07 A;  2RD0 A;  2MUB A;  3MV3 B;  4FC8 A;  4CGW A;  3PRZ A;  4ILH B;  1SH1 A;  3KEZ A;  3RO2 A;  2JTO A;  3UUX A;  4BTB A;  1ZBP A;  2BF0 X;  1ZLI B;  3Q4A B;  5ANL A;  3FDH A;  4K0R A;  3FU3 A;  1E7V A;  4I6J A;  3ULQ A;  3ZIM A;  4HOT A;  3SGH A;  4U0S A;  3SFZ A;  4IUL A;  4Q96 A;  1UN8 A;  4CDM A;  4I17 A;  3CVU A;  4EQF A;  2WM9 A;  5J08 A;  4P29 A;  4E85 A;  3RU0 A;  5AEN A;  3ASG A;  4EEC A;  3QWW A;  4EBA G;  5LOZ A;  2PM6 A;  4DPR A;  4XKC A;  2MN3 A;  1A17 A;  4TRQ A;  4KMO A;  4GZD A;  4FA6 A;  3Q49 B;  1E90 A;  2PQN A;  3APC A;  5BV1 A;  4GZ5 A;  3FU5 A;  3PZD A;  1FVH A;  3ZYQ A;  2KAT A;  2ION A;  2R5S A;  2SH1 A;  3D9O A;  1TJC A;  5AJD A;  3RJV A;  2LSV A;  3SBT B;  4AV7 A;  3PDN A;  3C38 A;  2Q7F A;  2NSZ A;  4CRW A;  4KT6 B;  3P1U A;  5T8I A;  4XI9 A;  1SQM A;  2VSY A;  5LP0 A;  1E96 B;  3PRE A;  4H7Y A;  3ZYK A;  3T5V A;  3CSF A;  1H19 A;  4ILG A;  5FT9 A;  4I9C A;  5CHE E;  1SHI A;  3D9N A;  5KJM A;  2RNG A;  1TEZ A;  3R9A B;  2VYI A;  3B7S A;  3VTX A;  3JUI A;  2PM7 A;  4G25 A;  3L17 A;  3UT7 A;  2VSN A;  3PEU B;  4PS3 A;  2IFU A;  3HYM B;  2WXO A;  4U04 A;  3CST A;  4WUY A;  5JJ6 A;  4XI0 A;  1WY6 A;  1Z6T A;  3AS4 A;  4U63 A;  4NUR A;  3ZVV A;  4EBA A;  3L16 A;  3FTW A;  1NA0 A;  3VLF A;  4PDX A;  1H0A A;  4DLQ A;  4PS8 A;  2HO1 A;  1OWM A;  2Y4T A;  4UWG A;  1FVF A;  4U0Z A;  3QWP A;  1BPO A;  4GZC A;  4AM9 A;  2MHK A;  1B89 A;  2WQ7 A;  4F7A A;  3N71 A;  3ZHE A;  3AS5 A;  5FQ4 A;  3CVV A;  4I6G A;  4ABN A;  3OAW A;  1KT1 A;  1E8W A;  3PVL A;  4HOU A;  4KZ0 A;  5FZQ A;  4BX9 A;  1OWL A;  3RRU A;  3O4Z A;  2IOL A;  2VGX B;  3T5X A;  1ZLH B;  1HG5 A;  5G2N A;  4AY6 A;  1QZ2 A;  4B89 A;  2J09 A;  2CHX A;  4LER A;  3IHV A;  3B7T A;  1XNF A;  3G2S A;  3B7R L;  5G55 A;  1XGW A;  2WXN A;  4EZL A;  2XCB A;  3FTZ A;  3HIZ A;  4TV3 A;  5LCW C;  2GW1 A;  3VLD A;  5C2Y A;  4F3V A;  1HS6 A;  1ATX A;  1UJJ A;  2R17 C;  4W9R A;  2VSX E;  3UT4 A;  2KCL A;  3CHP A;  2WXM A;  2BTD A;  3ESL A;  4JA7 A;  4J8F A;  4TUU A;  4WNG A;  2OOE A;  4B8A A;  4BWR A;  3PE3 A;  1NA3 A;  2V4L A;  3FUI A;  2OV8 A;  2WMN A;  3SNX A;  4N2S A;  1ELK A;  2AW6 A;  4K03 A;  4L2Y A;  3ZFW A;  1HFA A;  3CIA A;  4JL0 A;  2JR3 A;  3APD A;  2VTB B;  1Y8M A;  2LSU A;  4BT8 A;  5BUZ A;  4YND A;  5CMW A;  1L5J A;  3IBE A;  3FP3 A;  3HVE A;  3HDX A;  3CHR A;  3D9M A;  4NQ0 A;  3JCK C;  1DVP A;  1YA0 A;  3RKV A;  2QSG A;  3FUE A;  2GRM A;  3CV0 A;  2K2X A;  5FZS A;  3TGO A;  3IKO B;  2WXG A;  3FWV A;  1EF1 C;  3GZ1 A;  4V3I A;  4UWF A;  2BUG A;  4I6E A;  3U64 A;  2Y4U A;  3FUJ A;  1HZ4 A;  3LY8 A;  3ZYL A;  4I9E A;  4MRU A;  3PEV B;  4L2L A;  3ML9 A;  5EDS A;  2J4D A;  2HJ9 C;  3CVW A;  1NZN A;  4KVO A;  4IYP A;  4HVB A;  4APF A;  3QKY A;  5FQ7 A;  4U07 A;  2CFZ A;  3NZS A;  5KJL A;  3ENE A;  2X6K A;  2A5U A;  3SD5 A;  3LY7 A;  4G1T A;  2VGY A;  2KC7 A;  5ANR A;  1BDS A;  3CLJ A;  2FEZ A;  2XRZ A;  3FH8 A;  2AWI A;  2QSH A;  3LYA A;  4XZ4 A;  2UY1 B;  4ACK A;  4GYO A;  2RG8 A;  4G2V A;  1IYG A;  4GYW A;  1OWO A;  2VGX A;  3CVL A;  3NQP A;  2XGS A;  5E75 A;  5BV0 A;  3LMS B;  4DJA A;  1U3C A;  2CG2 A;  2NC9 A;  3S7J A;  3TG4 A;  1H2V C;  5BPP A;  3ASF A;  3URZ A;  4DK5 A;  3PE4 A;  5LFA A;  2X6J A;  4GB9 A;  1IQU A;  3OXG A;  4I1M A;  4WNF A;  3ONK A;  5D0O D;  4KYO B;  3ASH A;  2YIN A;  1X5B A;  1E8Y A;  3CVP A;  4LEU A;  4R7L A;  4APO A;  3S7D A;  4F53 A;  3C30 A;  2IF4 A;  2XEV A;  3LY9 A;  4HXI A;  3CKB A;  3OTN A;  4Y6C A;  3CK9 A;  4JVS A;  3EIJ A;  5T3R A;  2IKE A;  3WXX A;  2KZT B;  2WPV A;  1H5O A;  2X6F A;  3S7B A;  3UT8 A;  2X6I A;  4YIR A;  2PQR A;  3I3N A;  5KJK A;  2VTB A;  3HVE B;  4GV5 A;  3QAR A;  4OVV A;  2XGO A;  3ZW3 A;  3FUN A;  4B0Z A;  2GRL A;  3UX4 A;  3U9W A;  3QAQ A;  5KCM A;  3EHN A;  3U66 A;  4L7T A;  2YQ8 A;  5FQ8 A;  4YVQ C;  1E7U A;  4RG9 A;  3RO3 A;  1ZU2 A;  1HXI A;  4ANX A;  4MLP A;  3VLE A;  4A3T A;  5JHB A;  4XKB A;  1IQR A;  4GML A;  4G24 A;  4ACL A;  3CVY A;  3AU4 A;  2OVF A;  1KT0 A;  4F1S A;  4CCA A;  2L0I A;  3SHF A;  4RVB A;  3LEW A;  4EZK A;  3GW4 A;  5AYW D;  4BFR A;  4EPZ A;  2XHE A;  4MS6 A;  5EX0 A;  5E76 A;  3S7F A;  2IQC A;  3ZRH A;  2LO6 A;  1EPU A;  3ML8 A;  4FAD A;  4N3B A;  1HO8 A;  3TJP A;  2FO7 A;  5BNW A;  4GZ3 A;  4RSY A;  3UPV A;  1ZUF A;  2H9X A;  2AXV A;  1VDY A;  4J8E A;  3UQ3 A;  3FTV A;  4I1O B;  4Y6W A;  2J49 A;  2J9Q A;  2WXI A;  1HF8 A;  3LS8 A;  1HH8 A;  2UY1 A;  3R7Q A;  2MOW A;  3I4R B;  4JXT A;  4IN3 B;  4AXH A;  4J0U A;  4AJW A;  2XCC A;  4FLH A;  5M72 A;  4D10 C;  4GA2 A;  4NAC A;  3AU5 A;  3ASD A;  3U4T A;  1OUV A;  3L22 A;  3MYV A;  4GCN A;  1WXN A;  1WAO 1;  1H2U A;  4ANW A;  3RRM B;  3FHE A;  2DCP A;  3ZXS A;  4AEZ C;  3CHS A;  4G11 A;  4CDR A;  1UW4 B;  3B7U X;  3FTU A;  4ANU A;  4N2Q A;  4UQZ A;  3LKU A;  1JWF A;  3BG1 B;  3FEX A;  5C1D A;  3SBS A;  5HQ8 A;  3QB2 A;  3QDN A;  3TXM A;  4BX8 A;  1LF8 A;  3PNT B;  1Z3Y A;  4PS7 A;  4A1G A;  1U3D A;  3FUM A;  2LNI A;  5G04 J;  4N39 A;  2QY7 A;  3Q47 B;  4FP7 A;  4A1S A;  3FH5 A;  3LXU X;  2DBA A;  3EDT B;  4UWL A;  5LCW J;  3EIQ C;  2ILR A;  2YHE A;  4CT4 A;  3TL5 A;  2X38 A;  4DI3 A;  4B94 A;  2IKD A;  2KZT A;  2QSF A;  1N52 A;  4I1A A;  2L9B A;  1SZ9 A;  3R7R A;  2V8S E;  2LAH A;  2J4B A;  3VTY A;  4XX5 A;  3JYS A;  3CGH A;  2LAI A;  2WXL A;  3JQ0 A;  2WXK A;  4J8D A;  4GYY A;  3FTX A;  4HOR A;  4CGV A;  3D9I A;  2JEK A;  2AXZ A;  4JZY A;  4A55 A;  1Z3X A;  2KM4 A;  5ARF A;  5FZR A;  3I5P A;  4HOS A;  1WQK A;  1DNP A;  2VSO E;  3MX3 A;  2NXP A;  3FEY A;  4JHK A;  1ELW A;  2WXQ A;  1QQE A;  4PH4 B;  4HS2 A;  3FTY A;  3OXF A;  3ZPJ A;  4AOF A;  3DBS A;  5DBK A;  5A7D B;  4IRU A;  2A4Z A;  4GA0 A;  4H7X A;  4CEM A;  4FUL A;  4XIF A;  5A23 A;  3FUD A;  1JUQ A;  1PAQ A;  3AS8 A;  3I4G A;  4L23 A;  4FLB A;  1N54 A;  1H6K A;  4GMJ A;  5BT1 A;  3HHM A;  4ME2 A;  2M63 A;  5JJ7 A;  4PUC A;  5HI7 A;  1Z99 A;  3FTS A;  3CQC B;  3CVN A;  2I1J A;  4RG6 A;  4UI9 C;  4EZJ A;  4FJY A;  3PUJ A;  4XE0 A;  3OXL A;  3TXN A;  3BEE A;  3K9I A;  1B8W A;  3PNL B;  2FF4 A;  4DLO A;  2C0L A;  2X6H A;  3QK0 A;  4O6F A;  3L54 A;  2OVB A;  2FBN A;  4JEH A;  3IHY A;  1HE8 A;  5G05 J;  2XRY A;  2L6J A;  3FU6 A;  2Y3A A;  3NF1 A;  4NRH B;  1HG2 A;  2I6H A;  3CHQ A;  4Q94 A;  2WXH A;  4CT0 A;  5AIJ A;  2KCV A;  5LX8 A;  1E8X A;  3EHM A;  4HFG A;  3MGB A;  4BY6 A;  3KAE A;  1ZUE A;  4GPK A;  4BTA A;  3CVX A;  5CCL A;  2I1K A;  4DI4 A;  5CMY A;  4I43 A;  2WXP A;  4JW1 A;  3FUF A;  4FHJ A;  3CK7 A;  3G2W A;  3Q15 A;  5KJN A;  3PUK A;  2CG3 A;  3FU0 A;  3UMV A;  2WXJ A;  3RK6 A;  4LUN U;  3ONL A;  3RIB A;  3FFL A;  2I9C A;  2YNQ A;  3IEG A;  5T4Y A;  2FI7 A;  5AJL A;  3KD7 A;  1GW6 A;  1INZ A;  5BW8 C;  5FQ6 A;  4GA1 A;  4J6I A;  3L08 A;  3LDZ A;  1PC2 A;  2UWJ G;  3U3W A;  4FHK A;  2WVI A;  3P2B A;  4C0E A;  3ZN3 A;  4AIF A;  3GZ2 A;  3MA5 A;  3CQG B;  3QWV A;  3PH0 C;  2E0I A;  2XPY A;  3ZYM A;  3L6A A;  3G2V A;  2MRI A;  2XPI A;  3JQ1 A;  3LPZ A;  4J8S A;  4L1B A;  5J90 A;  2XGM A;  4M3O A;  2OND A;  4CDN A;  3E4B A;  2GGF A;  4N3A A;  3FUL A;  3NZU A;  2HM8 A;  4WND A;  4UWH A;  2XPZ A;  2WXR A;  5EKQ D;  5ARG A;  3QC1 A;  2X3M A;  4UQX A;  2CFU A;  3LVR E;  3MKQ B;  3LCA A;  2L0T B;  4AVX A;  4UWK A;  1MHQ A;  3CVQ A;  2DLA A;  1HX8 A;  3O48 A;  1HU3 A;  3D9J A;  2JLB A;  1UJK A;  2PL2 A;  3LJ3 A;  3QNK A;  1H2T C;  3SI5 A;  2VJ8 A;  4KBQ A;  2IJG X;  4OYS A;  3IV0 A;  4QFV A;  3GYZ A;  3FUK A;  3QJZ A;  4GU5 A;  5ENN A;  4Q69 A;  2J08 A;  4C9B B;  3EJN A;  2I2O A;  2KCK A;  4N5C A;  4AP2 A;  3CHM A;  5FTP A;  2PZI A;  4FU3 A;  2CHZ A;  4WWP A;  2BDS A;  2B9K A;  4LRZ A;  2CHW A;  2YHC A;  4ILI A;  3FY4 A;  3APF A;  3SF4 A;  3FUH A;  2P58 C;  3CR3 A;  3D9P A;  3TG5 A;  4C0M A;  2HJE A;  3MJW A;  1FCH A;  4I2Z A;  2QFC A;  4I2W A;  4LCT A;  4KZC A;  2R59 A;  3C98 A;  3SZ7 A;  2AXU A;  5G04 C;  3BG0 B;  4HOQ A;  3MZL B;  4U0U A;  4ANV A;  4E6H A;  5A6C A;  3B13 A;  3D4U B;  4HLE A;  4JHJ A;  4UQY A;  3GZS A;  3DPD A;  2WMO A;  1UG3 A;  4WNE A;  4URK A;  1SZA A;  3T8M A;  1QNF A;  2V5F A;  2XXL A;  3G2T A;  3KS2 A;  5DIZ A;  5JHA A;  1E8Z A;  4G26 A;  2IOS A;  4JEU A;  1AHL A;  4B8C B;  3D3M A;  2C2L A;  4FJZ A;  3S2A A;  3MV2 B;  5JJT A;  2V0P A;  3LVQ E;  1P5Q A;  2E2E A;  4JHR A;  1OWN A;  3MEK A;  1D6B A;  4YVO A;  5FWQ A;  1MQS A;  4GAA A;  4WAF A;  1OWP A;  3CEQ A;  4JC8 A;  2EQX A;  4GCO A;  3CK8 A;  4GZ6 A;  4JPS A;  4N3C A;  5FJY A;  1KLX A;  3PS6 A;  1S0P A;  4ATG A;  1W3B A;  1PY1 A;  2DIW A;  1EDU A;  3ZGQ A;  1UN9 A;  3MKR A;  1NP7 A;  1IHG A;  4MKT A;  2WQ6 A;  2AVP A;  2WQH A;  4AY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...