2HJ9C

Crystal structure of the autoinducer-2-bound form of vibrio harveyi luxp complexed with the periplasmic domain of luxq
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
219
structure length
210
Chain Sequence
SKQQTSALIHNIFDSHFAAIQIHHDSNSKSEVIRDFYTDRDTDVLNFFFLSIDQSDPSHTPEFRFLTDHKGIIWDDGNAHFYGVNDLILDSLANRVSFSNNWYYINVMTSIGSRHMLVRRVPILDPSTGEVLGFSFNAVVLDNNFALMEKLKSESNVDNVVLVANSVPLANSLIGDEPYNVADVLQRLLVIETPIVVNAVTTELCLLTVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Autoinducer 2-binding periplasmic protein luxP
publication title Ligand-induced asymmetry in histidine sensor kinase complex regulates quorum sensing.
pubmed doi rcsb
source organism Vibrio harveyi
total genus 67
structure length 210
sequence length 219
chains with identical sequence D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.20.100 Mainly Beta Single Sheet Anthopleurin-A Anthopleurin-A 2hj9C02
3.30.450.220 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2hj9C01
2HJ9C 3C30A 2HJEA 1ZHHB 3C38A
chains in the Genus database with same CATH superfamily
2ZC3B 2M7UA 5TFQA 3GR2A 2V1BA 2EX2A 5FA7A 4PM8A 1YSPA 1PNEA 1X0OA 1TS6A 4R23A 1VETB 4GCZA 3D72A 5L2FA 3OCLA 3ZNTA 3GDIA 1YLJA 3ZGAB 3VFHA 3T4JA 1ESIA 2PR5A 4E3JA 2WGWA 5HDSA 3MJQA 1ZHHB 2ZC7A 2BASA 2VGLM 3UE3A 1YM1A 4PAUA 1P9WA 4GHIA 2WYXA 1XPBA 1GHIA 5CRFA 1OTBA 3KSGA 2ZOIA 1LI9A 1ODVA 3T4SA 1FCNA 3O86A 4LRZE 3BW6A 5DFXA 3U4LP 3PAGA 4ID4A 3V39A 1LI0A 4LCMA 3RXXA 3VSKA 5GLCA 1WQKA 2H5SA 2RL3A 3LIBA 1PI5A 2ZC5B 4P0MA 5HX9A 1PI4A 1OTIA 3FKVA 1SKFA 3LUQA 1OT9A 4F94A 1OJ5A 2G2UA 3M6BA 4EETB 1P9RA 4XXRA 2O99A 2H9XA 3FPVA 3CPTA 4ZJ3A 4BD0A 2XR0A 2ZM2A 3JVVA 3E2KA 4S2KA 1IYQA 3MQQA 4I3JA 4WZ4A 1YLPA 1YT4A 2GZAA 4BBVA 4R4RA 4ETXA 1HTZA 3ZHHA 2QPNA 3HLFA 1GL9B 4YINA 2EXBA 1K4FA 2WKEA 4BLMA 4WEJA 2HZ5A 1Q2PA 2IWDA 1H5XA 4OP5A 3MCXA 3NC8A 4IVIA 3WS2A 4IBRA 5A90A 4Y15A 3ZFZA 2V0UA 2IKDA 3E4QA 5E2HA 4B88A 1MKMA 3EQVA 1BSGA 3TW8A 4BMWA 3A0SA 1T1BA 1H0MA 4IUHA 1LL8A 3HLEA 3CG5A 1HD8A 5CHUA 4CQHA 2ZM8A 3I7JA 1W8YA 2DRWA 3B47A 5DKKA 3BFDA 1PWGA 3IX3A 3EEAA 3NOPC 4DMZA 3CUEA 2JR3A 5HWVA 3LR4A 1W5DA 5EUAA 3C7UA 1D6BA 3W4OA 3BJNA 2Y8HA 1LLBA 1GSWA 3F1NA 4JGPA 3F1PB 3VP4A 4S2NA 1NRFA 2BTFP 4E3OA 3GECA 3ZVTA 1LSVA 1RGZA 2XD5A 3T4TA 3QP2A 4DDSA 3BFEA 4OQHA 4G3VA 2PD7A 1JWVA 2WKIA 4DN0A 3BQ8A 2Y79A 3MKEA 3L9KA 4P87A 3HLDA 5M19A 3UPNA 4R3JA 5EOEA 1TEMA 1XJ4A 3Q7VB 4OONA 1KGGA 4QJGA 4GD8A 2ZMFA 3MZFA 2JE5A 1MY8A 1K57C 3E4PA 3MZEA 1UWNX 3EOIA 4WN5A 3V3SA 3A3FA 4IEDA 1S4SA 1WYBA 2PYPA 3QP8A 4JXGA 4EBNA 1F9IA 4QWOA 3BLSA 3LY4A 4G3WA 1PYYA 4X6TA 2Y2JA 1VQQA 3T1SA 4MBFA 3FPWA 1L3LA 3SH8A 1NZUA 4F3LB 5HW3A 1XFQA 1OTDA 4EERA 4IBXA 3SH9A 3F1OB 5KIZA 1F98A 4WMCD 5CTNA 2XRNA 3HLGA 1FQGA 3UMEA 4KENB 1EL6A 1UWPX 3AGEA 2V9AA 4I5SA 2L1MA 1H5OA 1W63M 1VETA 4N1HA 4N9KA 2X01A 4MEZA 3PXPA 5EVEA 2XDMA 3HJKA 4I3IA 5AJGA 3FG8A 1NYMA 2JKFA 1KGEA 2RNGA 3K3DA 2W3EA 2AVXA 3R4KA 5JYPA 3IH8A 4LFUA 3OOVA 2PDRA 3TJZC 2PAVP 3HL9A 4AFIA 1VM1A 4E6WA 2HV1A 3NCKA 2QSGA 4BBUA 5D3OA 4JF5A 2Y59A 3W4QA 2EX6A 5F1GA 4OQGA 3LR3A 4O01A 4HJ4A 1S1ZA 4JGOA 4S2JA 2QYBA 2B95A 1L0DA 1FIKA 4QY5A 5AQBA 1CI8A 3C30A 3N6IA 1TS7A 2JHEA 4GHIB 4IVKA 4KQOA 1K4EA 2W3GA 2XF3A 2WAFA 3KSFA 1BLSA 4EXOA 1EI5A 3V67A 3C8CA 3LEZA 2R78A 1H8MA 3FYZA 4CJNA 2G7UA 4HHDA 2MN3A 2X71A 3IWIA 3BEBA 4WMCA 2Y2IA 2ZQCA 1G68A 3UNWA 3T4LA 1DP8A 3GQZA 3M2JA 2V8CA 4O8GA 4Y2FA 4X53A 1ZKJA 5CGWA 2OOLA 4JGQA 4OVDA 5CTMA 3CWFA 2ZQAA 5HSQA 4C3QA 4N1XA 2VX8A 1XJ2A 3A0RA 5EVIC 2HDQA 1YLYA 2XGNA 2V1ZA 4E3IA 2OWHA 2D02A 4KZ4A 2OLUA 3LICA 2FFYA 3B33A 1WE4A 1ES2A 3A3DA 4XT2B 3P98A 4HNBA 4QB8A 1S4RA 2E8IA 4CLCB 4MN7A 3UB5P 4DRTA 2WGVA 4PM7A 4EESA 3PBNA 3P01A 4WZ5C 5DFYA 1C3BA 1ATXA 4BL3A 1ALQA 3IWQA 4BWIA 1LT0A 3LY3A 3MXSA 1IEMA 1W63Q 5IS1A 2PHYA 3O5YA 5FQIA 3LFVA 1GSXA 3F1PA 4OPRA 1APFA 1K55C 2Y2HA 3K3CA 3CLOA 3ICYA 3TRCA 2QWSA 3GTCA 2Y55A 5EFWA 5EOOA 1WA9A 3IX4A 4K91A 3RXWA 2ZD8A 3IHBA 4BENA 2KOIA 4LPZA 2P08A 3DTEA 3Q7VA 3NJAA 3ZVWA 3S7OA 1N9LA 5EPHA 2EX9A 1KE3A 3OLOA 4R3AA 4E3KA 3HUNA 2VZWA 4RX2A 2O0YA 3WS0A 3W8KA 3IXGA 5HPIA 2Z6DA 4XUZA 4UA7A 5EM0A 2A2LA 2P74A 3G4PA 1K38A 4UQIM 5AQ9A 3P7NA 3VE3A 4R0QA 4F3LA 3EEHA 1S6RA 1D06A 3DWKA 1K56A 1D1JA 1OJGA 1V9YA 3QNCA 1JTGA 2OAQ1 4QY6A 2K2XA 4K08A 1CEFA 2ZJ9A 1LSWA 2M7VA 3UB8A 1YLWA 2FFFB 1NRJA 5TR7A 4C75A 4DE1A 1RGYA 2WZXA 3S4XA 5CX7A 3Q81A 1E4DA 5CGXA 4PM5A 1ERQA 2OWJA 2Y2MA 1BUEA 2XA7M 4KZ8A 2LB9A 2I9VA 4EEUA 4R38A 1CJFA 3O3VA 1N9OA 5KSCA 1BULA 3O88A 2B5RA 2CC1A 3JPUA 2XLNA 3CHWP 1XFNA 4OOYA 2DLAA 3G31A 2GJ3A 1FR6A 3C4PA 4S2PA 4CLCD 1K6RA 1YSQA 3ISGA 1IKIA 1OMEA 4NXEA 3HLBA 3MKFA 3VOYA 2Y2QA 3CITA 1K54C 4ZTKA 2XXLA 1PWCA 4UHUA 4Y5FA 4P6ZS 4OQIA 3S7NA 4X68A 4HQAA 2QZ6A 2XFTA 1S66L 4X1MA 5C5KA 4IUKA 1QMEA 3QHYA 1OTAA 5DVAA 5HAPA 2Y91A 2Z2LB 1DJCA 2O9BA 3R7WB 2ZQ8A 4Y0OA 4NETA 1OT6A 5F69A 1EWZA 5FQMA 5E2FA 4L9EA 3UDXA 3H82B 2VGJA 1XJ3A 1PW1A 3KSHA 2K7SA 5DF7A 1G28A 1GSVA 5F68A 5G4ZA 4JXSA 1Q2QA 3BY8A 3NIAA 4RX3A 3DW0A 4QD4A 3B3XA 3KSIA 4DJ2A 2IA2A 1H8YA 3NULA 4HJ6A 4MBKA 3VP2A 4KZ3A 1NLYA 3OPPA 4HJ3A 4XUXA 2EA9A 4OLDA 2ZQDA 3KEZA 5AQAA 1W8QA 4XT2A 2WKQA 3UE1A 5JYOA 4GD6A 4U0XA 2ZQ7A 3E0YA 1XX2A 4KZAA 4CLCA 2X02A 2Y2PA 2YKFA 4PPRA 1ZC2A 4LRYC 4X1LA 3LMSB 3ZG8B 3ZYTA 1BYWA 2G2WA 5A91A 1KE4A 3GV9A 3K2NA 4ZJ1A 2IKEA 3D4UB 2EWVA 2M1CA 3ZG0A 1OPXA 5HPFA 2XQZA 2QSHA 1CEGA 2PBYA 4EQ1A 5FASA 3DTMA 3MBZA 1FSYA 4N92A 3IF5A 5E2GA 2JKRI 1WXNA 3L7HA 4IJGA 3M2KA 4KZ7A 1P0ZA 2VEAA 3NI9A 5KZHA 3NDEA 2KLIA 3MXRA 3RH8B 1PZOA 1TVFA 3O87A 1FOFA 2HP6A 1RP5A 1ONHA 1G5UA 1DRMA 5HL6A 2OV5A 3IF6A 3ZG5A 3CUEC 3IBJA 4QHCA 1NLZA 4HEFA 1S1YA 3GRJA 4X69A 2Q0OA 1J9MA 5DTKA 2VGKA 3T1QB 4GN2A 1LSXA 1NJ4A 3RJUA 4PKYA 1Z6FA 4S2NC 3MFDA 4PM9A 1ERMA 2H0YA 5J3WA 1YAXA 2L0WA 4PM6A 5CECA 4LRXC 1ZLHB 1Y4OA 5K5BA 5CHJA 4E3MA 3DTKA 4O0PA 4FOFA 2JTOA 5CEDA 3LO7A 4MNRA 5F82A 2NUTC 2VV7A 2HJ9C 4X25A 5FI7A 2Z2MB 2HGVA 1ONGA 4ZBEA 2XSSA 3NOTC 2J9PA 4UAAA 3QP6A 5CEBA 4MN5A 4OPYA 4E6XA 2VLGA 1SDNA 4GDNA 3N7WA 3DWZA 3IXDA 4GNUA 4U0TA 4GOGA 5IU1A 3IHAA 2XROA 5AVEA 4DDYA 3MQ0A 3QP5A 4Q0HA 4R4SA 3UPPA 4S2OA 4K0XA 4B93A 2JKTM 1KDSA 4KZ6A 2P9VB 4WF0A 3C4OA 4ARZA 4Y0UA 1PRQA 4OOMA 3UMDA 5FATA 3VOLA 1FCOA 5GLDA 3R7WA 2D01A 1S0WA 2IWBA 1PIOA 4RQ9A 3T4OA 1BLPA 1LL5A 3Q07A 2J3TC 3IT9A 5EE8A 3E2LA 1QMFA 3ZDJA 3N8SA 3WS4A 3CZDA 4DKIA 3H82A 4JF4A 4JXVA 3SH7A 1AHLA 4LV2A 4K0WA 2ZOHA 4P6BA 2LB5A 3SOIA 3LGOA 2JBFA 1V9ZA 4ESPA 4LLOB 1MWUA 5FI6A 3S7PA 3CJMA 1ZLIB 1KDWA 5HAQA 4ME4A 4CPKA 4WELA 1MPLA 4Z9QA 1SDEA 5KSHA 3BY9A 1BT5A 3M6HA 3TSGA 1BLHA 3BRMA 3UE6A 1TS8A 2UV0E 4GV5A 1D7EA 2WKHA 4LCLA 1FILA 3UB6A 4HOIA 5AVFA 4WBGA 2VV8A 5FEGA 5E43A 3MF0A 4GLQA 3HVFA 3A3JA 3FKWA 4MLLA 1IYPA 4Y13A 4M4XA 1KGFA 4KZ5A 2HF6A 3ZCZA 3BWLA 5J8XA 5FQJA 4DF6A 5J7EA 1KOUA 4Q0JA 5HDDA 1GKUB 1TDLA 3KX0X 5FQ9A 3VP3A 3VMAA 5HFOA 3BFGA 3T12B 2A3UA 2H10A 3BLMA 2NUPC 2OLVA 4DXCA 3G32A 2JKRM 3HLCA 3LI8A 4H6JB 1BDSA 1L0EA 4NXBA 1CQAA 5FDSA 1RCJA 3VV4A 1T1AA 4OH0A 4GB7A 4Y0TA 1IFQA 2R9WA 1N9BA 1UGUA 4C6YA 3HJIA 5DKLA 3UY6A 2XEPA 2OAP1 5FAPA 2BG1A 3T4KA 1ES3A 4LENA 3W2ZA 3PBTA 5FAQA 2ACGA 1ZUFA 3UO9A 3HLWA 4DE0A 4FUWA 4WEKA 1CF0A 4DJ3A 2W1TB 3QNBA 4EV4A 2WUQA 2WAEA 3WRZA 1MKIA 2W0NA 2DCFA 2KDKA 1KVLA 2WK0A 2XD1A 1SHIA 3AGFA 5FQKA 1EW0A 3JVUA 3N4IA 1AWIA 2L4RA 2INWA 5TGFA 3CMZA 2ZMAA 5F6AA 1CK3A 2EFUA 4S2LA 5GLAA 3IF6B 3SZTA 4JGRA 3U2AA 2VKSA 1DP6A 4X56A 3QP4A 1FCMA 1YMXA 4MMNA 4UA9A 1PFLA 4GW9A 1M6KA 3HUOA 1NXYA 2GDNA 2A24A 4OLGA 3LCEA 1B8WA 4R70A 2O9AA 1HLUP 3IF4A 4OKPA 1IKGA 1SCWA 3LIEA 2WKPA 4ZJ2A 1E3UD 1W7FA 5AQ7A 1YQSA 2VGLS 1H3QA 4EQIA 4OQ0A 3H9WA 1NY0A 2ZMVA 1J3WA 2WZZA 1VEUB 5J4EA 2XFSA 4EBLA 1Y28A 4KZ9A 2I72A 5CERA 4R6LA 1BLCA 1JVJA 2P9VA 2CMNA 3WS5A 1YMSA 3HCYA 1DJAA 4LV1A 4MDZA 2MJ6A 3Q7ZA 2E8JA 3WWXA 4HESA 3Q82A 2MUBA 4N9LA 3VP0A 4FSFA 3H7WB 3T4QA 5U47A 4EBPA 2BDSA 1FR1A 4LV0A 3G34A 4L9GA 4FH2A 3MMHA 3ULFA 4HY8A 2V2FF 2H28A 3GSGA 5G18A 3EGDC 4E3LA 3TG9A 2Y4AA 5TBMA 1N4OA 1M40A 5FI2A 2PR6A 3A0VA 4M3KA 1XA7A 1MWSA 2JKTI 4KG6A 4ARZB 2Z6CA 1JTDA 1SHVA 5F1FA 1ES4A 4YFMA 1SZVA 1O7EA 4IHQA 3T1RA 3GMWA 4PKYG 3VP1A 1L2SA 1LL9A 3V5MA 3BQAA 2ZC6B 3IQAA 4MCWA 3TOIA 4NXGA 5A92A 2WGIA 5FDHA 5F5YA 1KVMA 2HP9A 2J7VA 1ZG4A 2KX6A 1EROA 1S67L 2A49A 1E3UA 4GS9B 3MS6A 4NEED 4S2MA 1PW8A 3BFFA 3LEQA 4ZRRA 2YKHA 1IELA 5HARA 2FH5A 3S7QA 4P6ZM 5G4YA 5A93A 4E04A 3UB9A 4RA7A 3T50A 3LIFA 3SS3A 4HH2A 3NECA 4Z1WA 5DTTA 3OBFA 4B4XA 2QHKA 3V3RA 3RTYA 5KMWA 3LI9A 5M1AA 4H6JA 4YOFA 2RCXA 4Y7PA 1L0GA 1HVBA 2XK1A 1JWPA 3UDFA 5EVIB 4FD8A 4GZBA 4EU0A 3A3EA 3PR6A 3IX8A 5GLBA 3ZG7B 4NKPA 3VFFA 2EX8A 2DMWA 4CLCE 4Q8IA 3PBOA 4DXBA 1K0KA 4CLCC 3IS2B 4B4ZA 3N8RA 3PBRA 3ZNYA 2Y2KA 4RYEA 3PHYA 1GCEA 1VHMA 3PBQA 5E2EA 5L10A 3S22A 3MZDA 3SS4A 2VK3A 4KG5A 4KUOA 1YLTA 2P04A 1F5MA 2HPBA 4YWZA 3FV7A 2W1TA 3LR0A 3CAXA 2Y2NA 2QJ7A 4EW7A 2EXAA 1MZUA 3SS5A 3GVBA 4RVAA 5I94A 4O7DA 1E25A 5CHMA 2R9XA 2PD8A 2K2NA 2W3DA 1IOUA 2Q9NA 2HDUA 5LBRA 3C5AA 1IYSA 1ZG6A 3RFBA 2VV6A 3MYVA 3KYQA 2GNXA 3BECA 2PT7A 4Q0IA 2V0WA 3NOUC 4PMAA 2J3TD 3NY4A 1TS0A 1MC0A 3G30A 4WL9A 4U3TA 4R3BA 2V8FA 4HP4A 1K57A 1ZTUA 3IF6C 2ZL1B 2J9OA 4P85A 2HP5A 5DJTA 3UE0A 1YPRA 2W3FA 5GHYA 5CGSA 3QP1A 4HBUA 1NZOA 2WADA 4Y17A 2HJEA 4GDBA 3OPHA 4JXWA 4UA6A 4HIAA 4X55A 1ZUEA 3E4OA 4Y3IA 4D2OA 1ACFA 1VEUA 1G6AA 1CI9A 5A8BA 4OPQA 1SH1A 4KUKA 1JWZA 3HREA 2JKGA 4JKTA 4KZBA 2EFXA 2QKPA 2J3WA 5FQQA 1XP4A 2A24B 3D9YA 4KG2A 3C2WA 1XKZA 3FWLA 5GL9A 4YNRA 2W27A 1P97A 3BM6A 3H7WA 5GHZA 3MQOA 4I39A 3DAVA 4OP8A 2PU4A 1JNUA 3KYZA 5EVID 4B9OA 5HL1A 1A0KA 4PHTA 4EEPA 1F2KA 1HZOA 5HAIA 2ZLYA 3NHQA 5FEFA 1W79A 2BLSA 1N9NA 3HUMA 4G3KA 4MBHA 2C6WB 5IHVA 3KYEA 1SKOB 1DP9A 5EVLA 4BD1A 5HWTA 3MR0A 3NBLA 2XH9A 1MWTA 1NWZA 5IT5A 4YIRA 4BJPA 1TDGA 1FSWA 1PZPA 1AXBA 3EGXC 5HDCA 1ESUA 3WRTA 4A5RA 3G6OA 4WLAA 1OTEA 5DTSA 2JCHA 5HZHA 1K25A 5TBMB 4WUJA 4GKUA 5MC7A 1G6OA 4GS9A 4HH3A 1Z99A 4H8RA 5I5LA 1MBLA 4D60A 4EUVA 2WGWB 4KQDA 2W1RA 3IWOA 3EWKA 1I2SA 4FTXA 3EQUA 1BZAA 3C7VA 2PBDP 5TJJA 3LIAA 2ZM0A 3UDIA 2H0TA 3OPRA 4BQMA 3ITBA 5L09A 4HBTA 4ZDXA 4ZAMA 3IXHA 5L07A 1MWRA 1TF1A 2PU2A 5L8MA 2J80A 4FH4A 4R1GA 2W3HA 1GHMA 4S2IA 4E3NA 4I38A 2V20A 5EVIA 1XA1A 2B02A 4OPZA 1XGIA 2QSFA 3MXQA 2PYRA 2PRFA 2SH1A 3PTEA 3IS2A 4I3AA 3G2ZA 3CPTB 1WYCA 2OSUA 2O9CA 2GX5A 4WYYA 3UB7A 3FC7A 4WZ5A 2ZC4B 1T18A 2IWCA 2WKRA 1BTLA 3PYPA 1K56D 1KE0A 5HWWA 3CI6A 3OC2A 3ITAA 3S1YA 4LV3A 2ZBBA 4NK3A 2V1AA 4JBFA 1K55A 5EV0A 3SW1A 2P7JA 2HDSA 3MFXA 1GA0A 4KQQA 3WS1A 4NXFA 3D3OA 5EECA 4BBTA 2QJ5A 4UEYA 4UQIS 4JF6A 3VE4A 3VSLA 3ZG9B 5DF8A 1IYOA 2FZ0A 2VJWA 2J8YA 4JPMA 1XGJA 3C38A 1K6SA 3MSHA 5CXWA 1Y54A 2JN7A 2UWXA 3TE8A 5M18A 1NYYA 2Y2GA 4JLFA 3BFCA 1U60A 3KO6A 3P09A 5HD3A 4HP9A 5F83A 2QMIA 3OZHA 3OPLA 3UN7A 4L0LA 4QU3A 4EWFA 2XA7S 2ZL1A 5BOHA 4WM9A 1XJ6A 4NG2A 5GHXA 1Z09A 2C5WB 4BL2A 1T1CA 3UPOA 3LIDA 1I2WA 3DBAA 3Q1FA 3G2YA 1I5QA 2HDRA 1O07A 3A3IA 5HD5A 4KQRA 1ES5A 3E98A 3F1NB 3PAEA 3AGDA 3OCNA 3IBRA 3W4PA 3PBSA 2EWWA 1GA9A 4LGWA 1T19A 3FZCA 1MXOA 1DJBA 1DY6A 1H8ZA 1VB6A 3N8LA 3NDGA 4MN6A 4QPRA 3B42A 1GHPA 1LHYA 1YKDA 4L9FA 1XXMA 3F1OA 3ZQ5A 2DNSA 1L0FA 2K31A 5FAOA 2Y2OA 5FL3A 2Y2LA 4HI4A 1TD5A 4GJ4A 5FSRA 2Q9MA 3DTIA 3LYXA 3D4FA 3VOZA 2VA0A 3IH9A 1SKOA 4II7A 2B18A 4EUZA 2ZQ9A 5EM1A 5DF9A 4DE2A 1YLZA 4OOLA 3V50A 2B9KA 3BYDA 3JYIA 3T1XA 3LR5A 3IXBA 4DE3A 4FCFA 5DJUA 1K54A 1PWDA 3HBRA 2JC7A 4ETZA 1STZA 3G35A
chains in the Genus database with same CATH topology
3PHYA 1VHMA 3PBQA 2JKTM 4B93A 2M7UA 4BWIA 1LT0A 4WF0A 2V1BA 1W63Q 5IS1A 2PHYA 4ARZA 1YSPA 4KUOA 3O5YA 1X0OA 1TS6A 2P04A 1F5MA 4OOMA 4YWZA 3UMDA 3LFVA 1GSXA 3F1PA 4GCZA 3D72A 1APFA 2W1TA 3OCLA 3VOLA 3GDIA 3LR0A 3CAXA 3R7WA 2D01A 2QJ7A 4EW7A 4RQ9A 1MZUA 3T4JA 3K3CA 2PR5A 3T4OA 3CLOA 3ICYA 2J3TC 3TRCA 5HDSA 2QWSA 3MJQA 2PD8A 1ZHHB 2K2NA 2BASA 2W3DA 2VGLM 5EFWA 3UE3A 1IOUA 1WA9A 4PAUA 5LBRA 1P9WA 4GHIA 3H82A 3RFBA 2VV6A 3MYVA 3KYQA 2GNXA 1OTBA 3KSGA 1AHLA 2PT7A 2KOIA 2V0WA 3NOUC 4LPZA 4Q0IA 2ZOHA 2ZOIA 2J3TD 2P08A 1ODVA 2LB5A 3T4SA 1TS0A 1MC0A 4WL9A 3NJAA 4LRZE 3BW6A 3S7OA 1N9LA 1V9ZA 5DFXA 4LLOB 3OLOA 4R3AA 4HP4A 1ZTUA 2VZWA 3S7PA 2O0YA 1WQKA 3LIBA 1ZLIB 5HPIA 2Z6DA 5DJTA 1OTIA 4ME4A 2A2LA 4WELA 3LUQA 1OT9A 4UQIM 3P7NA 1OJ5A 2W3FA 3VE3A 5KSHA 3BY9A 4EETB 4F3LA 1P9RA 3EEHA 3UE6A 1D06A 2O99A 2H9XA 1TS8A 2HJEA 1OJGA 3FPVA 1V9YA 2OAQ1 4HIAA 4GV5A 1ZUEA 1D7EA 3E4OA 4Y3IA 3JVVA 2K2XA 4K08A 3MQQA 3UB6A 5A8BA 1SH1A 4I3JA 1LSWA 4HOIA 2M7VA 4KUKA 5AVFA 3UB8A 2GZAA 1NRJA 4BBVA 2VV8A 4ETXA 5CX7A 2QKPA 3MF0A 4GLQA 2J3WA 2OWJA 2A24B 2XA7M 4M4XA 3C2WA 4YNRA 2W27A 2HF6A 2LB9A 3BWLA 4WEJA 5J7EA 1P97A 1KOUA 2I9VA 3H7WA 4R38A 4EEUA 4Q0JA 3MQOA 4I39A 5HDDA 3MCXA 3KX0X 1N9OA 1JNUA 3KYZA 4B9OA 2V0UA 4PHTA 2NUPC 2IKDA 4EEPA 3E4QA 2JKRM 1MKMA 1XFNA 3NHQA 3EQVA 3LI8A 2DLAA 1N9NA 4H6JB 2GJ3A 3TW8A 4G3KA 1BDSA 4BMWA 3A0SA 1T1BA 4IUHA 1LL8A 4NXBA 4CLCD 1DP9A 1YSQA 4CQHA 3VV4A 5HWTA 3MR0A 4NXEA 1T1AA 1NWZA 3CITA 1IFQA 5IT5A 4YIRA 4BJPA 3B47A 5DKKA 2XXLA 1UGUA 4Y5FA 3HJIA 3EGXC 3EEAA 5DKLA 3NOPC 4DMZA 4P6ZS 5HDCA 3S7NA 3CUEA 2OAP1 3G6OA 2JR3A 4HQAA 3T4KA 3W2ZA 5HWVA 4WLAA 1OTEA 3LR4A 3PBTA 1S66L 5HZHA 5C5KA 4IUKA 1ZUFA 1D6BA 5TBMB 3BJNA 2Y8HA 4WUJA 1OTAA 1GSWA 4WEKA 3F1NA 4JGPA 3F1PB 4DJ3A 2W1TB 5MC7A 2O9BA 2W0NA 2KDKA 3GECA 3R7WB 1G6OA 1SHIA 4GS9A 4HH3A 1LSVA 1EW0A 3JVUA 1Z99A 3T4TA 5I5LA 2L4RA 2INWA 1OT6A 5F69A 4EUVA 5F6AA 4G3VA 2PD7A 4KQDA 4L9EA 2W1RA 3EWKA 3H82B 4JGRA 1XJ3A 3KSHA 3U2AA 2K7SA 4DN0A 3BQ8A 3EQUA 2Y79A 2VKSA 1G28A 1GSVA 5F68A 5G4ZA 5TJJA 3LIAA 1DP6A 1XJ4A 3BY8A 4MMNA 2ZMFA 3KSIA 4DJ2A 4GW9A 3E4PA 1TF1A 1UWNX 3EOIA 4WN5A 5L8MA 2IA2A 4HJ6A 2J80A 1S4SA 2W3HA 2A24A 2PYPA 4I38A 1F9IA 1NLYA 1B8WA 4R70A 2O9AA 4HJ3A 4G3WA 2EA9A 3LIEA 2B02A 2WKPA 3KEZA 3FPWA 2QSFA 4XT2A 4F3LB 3MXQA 2PYRA 2WKQA 2SH1A 1XFQA 1OTDA 3IS2A 2VGLS 4EERA 3E0YA 1H3QA 4I3AA 4CLCA 3H9WA 3F1OB 5KIZA 2O9CA 1F98A 2YKFA 2ZMVA 2GX5A 3UB7A 4LRYC 2XRNA 3FC7A 5J4EA 1Y28A 3LMSB 1T18A 3UMEA 2WKRA 4R6LA 3PYPA 1BYWA 3ZYTA 1UWPX 2V9AA 3K2NA 4I5SA 5HWWA 2CMNA 2L1MA 1H5OA 3CI6A 3OC2A 3HCYA 2IKEA 1W63M 4MDZA 3D4UB 2ZBBA 2MJ6A 2V1AA 3PXPA 2EWVA 2M1CA 3HJKA 4I3IA 5AJGA 1OPXA 3FG8A 5HPFA 2QSHA 2MUBA 4EQ1A 3SW1A 2P7JA 4FSFA 3MFXA 2RNGA 3H7WB 3T4QA 3K3DA 2W3EA 2BDSA 4NXFA 3D3OA 4BBTA 2QJ5A 3R4KA 4UEYA 4UQIS 4L9GA 3MMHA 3ULFA 3OOVA 3VE4A 2PDRA 3TJZC 4HY8A 4AFIA 2H28A 2JKRI 3EGDC 2FZ0A 2VJWA 1WXNA 4IJGA 2HV1A 5TBMA 3C38A 2VEAA 1P0ZA 2JN7A 2QSGA 4BBUA 2PR6A 3A0VA 3TE8A 2JKTI 2KLIA 4ARZB 2Z6CA 3RH8B 3KO6A 3LR3A 4O01A 4HJ4A 1S1ZA 5HD3A 4HP9A 4IHQA 4JGOA 4L0LA 1DRMA 2XA7S 5HL6A 4PKYG 3CUEC 2QYBA 1XJ6A 3IBJA 3BQAA 1NLZA 1S1YA 3C30A 4MCWA 1T1CA 4NXGA 1TS7A 2JHEA 4GHIB 3LIDA 4KQOA 3DBAA 1LSXA 2W3GA 4PKYA 5HD5A 5F5YA 3E98A 3F1NB 3KSFA 3OCNA 4EXOA 3IBRA 2KX6A 3V67A 3C8CA 3PBSA 2R78A 1S67L 5J3WA 1H8MA 1YAXA 2EWWA 2L0WA 4GS9B 4NEED 2G7UA 1ZLHB 4LRXC 4HHDA 2MN3A 5K5BA 4ZRRA 1T19A 2YKHA 4O0PA 4FOFA 2JTOA 3S7QA 2FH5A 1VB6A 4MN6A 4QPRA 4P6ZM 5G4YA 4E04A 3T4LA 3UB9A 3B42A 1DP8A 2NUTC 1YKDA 2VV7A 4L9FA 2HJ9C 3T50A 3LIFA 4HH2A 3F1OA 3ZQ5A 4O8GA 4Y2FA 2HGVA 2K31A 4Z1WA 2OOLA 3OBFA 4JGQA 2XSSA 2QHKA 5FL3A 3CWFA 4HI4A 3NOTC 5HSQA 1TD5A 4GJ4A 3RTYA 3LI9A 3LYXA 4H6JA 2VX8A 4YOFA 1XJ2A 3A0RA 2VA0A 4MN5A 2VLGA 4II7A 4EU0A 2OWHA 3PR6A 2B18A 2D02A 4NKPA 5DF9A 3LICA 2DMWA 4OOLA 4CLCE 2B9KA 3B33A 3PBOA 4XT2B 3LR5A 4HNBA 5IU1A 2XROA 4CLCC 1S4RA 3IS2B 5DJUA 3PBRA 4CLCB 4MN7A 5AVEA 3MQ0A 4Q0HA 4ETZA 4EESA 3PBNA 3P01A 1STZA 5DFYA 1ATXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJ9 C;  3C30 A;  2HJE A;  1ZHH B;  3C38 A; 
#chains in the Genus database with same CATH topology
 2ZC3 B;  2M7U A;  5TFQ A;  3GR2 A;  2V1B A;  2EX2 A;  5FA7 A;  4PM8 A;  1YSP A;  1PNE A;  1X0O A;  1TS6 A;  4R23 A;  1VET B;  4GCZ A;  3D72 A;  5L2F A;  3OCL A;  3ZNT A;  3GDI A;  1YLJ A;  3ZGA B;  3VFH A;  3T4J A;  1ESI A;  2PR5 A;  4E3J A;  2WGW A;  5HDS A;  3MJQ A;  1ZHH B;  2ZC7 A;  2BAS A;  2VGL M;  3UE3 A;  1YM1 A;  4PAU A;  1P9W A;  4GHI A;  2WYX A;  1XPB A;  1GHI A;  5CRF A;  1OTB A;  3KSG A;  2ZOI A;  1LI9 A;  1ODV A;  3T4S A;  1FCN A;  3O86 A;  4LRZ E;  3BW6 A;  5DFX A;  3U4L P;  3PAG A;  4ID4 A;  3V39 A;  1LI0 A;  4LCM A;  3RXX A;  3VSK A;  5GLC A;  1WQK A;  2H5S A;  2RL3 A;  3LIB A;  1PI5 A;  2ZC5 B;  4P0M A;  5HX9 A;  1PI4 A;  1OTI A;  3FKV A;  1SKF A;  3LUQ A;  1OT9 A;  4F94 A;  1OJ5 A;  2G2U A;  3M6B A;  4EET B;  1P9R A;  4XXR A;  2O99 A;  2H9X A;  3FPV A;  3CPT A;  4ZJ3 A;  4BD0 A;  2XR0 A;  2ZM2 A;  3JVV A;  3E2K A;  4S2K A;  1IYQ A;  3MQQ A;  4I3J A;  4WZ4 A;  1YLP A;  1YT4 A;  2GZA A;  4BBV A;  4R4R A;  4ETX A;  1HTZ A;  3ZHH A;  2QPN A;  3HLF A;  1GL9 B;  4YIN A;  2EXB A;  1K4F A;  2WKE A;  4BLM A;  4WEJ A;  2HZ5 A;  1Q2P A;  2IWD A;  1H5X A;  4OP5 A;  3MCX A;  3NC8 A;  4IVI A;  3WS2 A;  4IBR A;  5A90 A;  4Y15 A;  3ZFZ A;  2V0U A;  2IKD A;  3E4Q A;  5E2H A;  4B88 A;  1MKM A;  3EQV A;  1BSG A;  3TW8 A;  4BMW A;  3A0S A;  1T1B A;  1H0M A;  4IUH A;  1LL8 A;  3HLE A;  3CG5 A;  1HD8 A;  5CHU A;  4CQH A;  2ZM8 A;  3I7J A;  1W8Y A;  2DRW A;  3B47 A;  5DKK A;  3BFD A;  1PWG A;  3IX3 A;  3EEA A;  3NOP C;  4DMZ A;  3CUE A;  2JR3 A;  5HWV A;  3LR4 A;  1W5D A;  5EUA A;  3C7U A;  1D6B A;  3W4O A;  3BJN A;  2Y8H A;  1LLB A;  1GSW A;  3F1N A;  4JGP A;  3F1P B;  3VP4 A;  4S2N A;  1NRF A;  2BTF P;  4E3O A;  3GEC A;  3ZVT A;  1LSV A;  1RGZ A;  2XD5 A;  3T4T A;  3QP2 A;  4DDS A;  3BFE A;  4OQH A;  4G3V A;  2PD7 A;  1JWV A;  2WKI A;  4DN0 A;  3BQ8 A;  2Y79 A;  3MKE A;  3L9K A;  4P87 A;  3HLD A;  5M19 A;  3UPN A;  4R3J A;  5EOE A;  1TEM A;  1XJ4 A;  3Q7V B;  4OON A;  1KGG A;  4QJG A;  4GD8 A;  2ZMF A;  3MZF A;  2JE5 A;  1MY8 A;  1K57 C;  3E4P A;  3MZE A;  1UWN X;  3EOI A;  4WN5 A;  3V3S A;  3A3F A;  4IED A;  1S4S A;  1WYB A;  2PYP A;  3QP8 A;  4JXG A;  4EBN A;  1F9I A;  4QWO A;  3BLS A;  3LY4 A;  4G3W A;  1PYY A;  4X6T A;  2Y2J A;  1VQQ A;  3T1S A;  4MBF A;  3FPW A;  1L3L A;  3SH8 A;  1NZU A;  4F3L B;  5HW3 A;  1XFQ A;  1OTD A;  4EER A;  4IBX A;  3SH9 A;  3F1O B;  5KIZ A;  1F98 A;  4WMC D;  5CTN A;  2XRN A;  3HLG A;  1FQG A;  3UME A;  4KEN B;  1EL6 A;  1UWP X;  3AGE A;  2V9A A;  4I5S A;  2L1M A;  1H5O A;  1W63 M;  1VET A;  4N1H A;  4N9K A;  2X01 A;  4MEZ A;  3PXP A;  5EVE A;  2XDM A;  3HJK A;  4I3I A;  5AJG A;  3FG8 A;  1NYM A;  2JKF A;  1KGE A;  2RNG A;  3K3D A;  2W3E A;  2AVX A;  3R4K A;  5JYP A;  3IH8 A;  4LFU A;  3OOV A;  2PDR A;  3TJZ C;  2PAV P;  3HL9 A;  4AFI A;  1VM1 A;  4E6W A;  2HV1 A;  3NCK A;  2QSG A;  4BBU A;  5D3O A;  4JF5 A;  2Y59 A;  3W4Q A;  2EX6 A;  5F1G A;  4OQG A;  3LR3 A;  4O01 A;  4HJ4 A;  1S1Z A;  4JGO A;  4S2J A;  2QYB A;  2B95 A;  1L0D A;  1FIK A;  4QY5 A;  5AQB A;  1CI8 A;  3C30 A;  3N6I A;  1TS7 A;  2JHE A;  4GHI B;  4IVK A;  4KQO A;  1K4E A;  2W3G A;  2XF3 A;  2WAF A;  3KSF A;  1BLS A;  4EXO A;  1EI5 A;  3V67 A;  3C8C A;  3LEZ A;  2R78 A;  1H8M A;  3FYZ A;  4CJN A;  2G7U A;  4HHD A;  2MN3 A;  2X71 A;  3IWI A;  3BEB A;  4WMC A;  2Y2I A;  2ZQC A;  1G68 A;  3UNW A;  3T4L A;  1DP8 A;  3GQZ A;  3M2J A;  2V8C A;  4O8G A;  4Y2F A;  4X53 A;  1ZKJ A;  5CGW A;  2OOL A;  4JGQ A;  4OVD A;  5CTM A;  3CWF A;  2ZQA A;  5HSQ A;  4C3Q A;  4N1X A;  2VX8 A;  1XJ2 A;  3A0R A;  5EVI C;  2HDQ A;  1YLY A;  2XGN A;  2V1Z A;  4E3I A;  2OWH A;  2D02 A;  4KZ4 A;  2OLU A;  3LIC A;  2FFY A;  3B33 A;  1WE4 A;  1ES2 A;  3A3D A;  4XT2 B;  3P98 A;  4HNB A;  4QB8 A;  1S4R A;  2E8I A;  4CLC B;  4MN7 A;  3UB5 P;  4DRT A;  2WGV A;  4PM7 A;  4EES A;  3PBN A;  3P01 A;  4WZ5 C;  5DFY A;  1C3B A;  1ATX A;  4BL3 A;  1ALQ A;  3IWQ A;  4BWI A;  1LT0 A;  3LY3 A;  3MXS A;  1IEM A;  1W63 Q;  5IS1 A;  2PHY A;  3O5Y A;  5FQI A;  3LFV A;  1GSX A;  3F1P A;  4OPR A;  1APF A;  1K55 C;  2Y2H A;  3K3C A;  3CLO A;  3ICY A;  3TRC A;  2QWS A;  3GTC A;  2Y55 A;  5EFW A;  5EOO A;  1WA9 A;  3IX4 A;  4K91 A;  3RXW A;  2ZD8 A;  3IHB A;  4BEN A;  2KOI A;  4LPZ A;  2P08 A;  3DTE A;  3Q7V A;  3NJA A;  3ZVW A;  3S7O A;  1N9L A;  5EPH A;  2EX9 A;  1KE3 A;  3OLO A;  4R3A A;  4E3K A;  3HUN A;  2VZW A;  4RX2 A;  2O0Y A;  3WS0 A;  3W8K A;  3IXG A;  5HPI A;  2Z6D A;  4XUZ A;  4UA7 A;  5EM0 A;  2A2L A;  2P74 A;  3G4P A;  1K38 A;  4UQI M;  5AQ9 A;  3P7N A;  3VE3 A;  4R0Q A;  4F3L A;  3EEH A;  1S6R A;  1D06 A;  3DWK A;  1K56 A;  1D1J A;  1OJG A;  1V9Y A;  3QNC A;  1JTG A;  2OAQ 1;  4QY6 A;  2K2X A;  4K08 A;  1CEF A;  2ZJ9 A;  1LSW A;  2M7V A;  3UB8 A;  1YLW A;  2FFF B;  1NRJ A;  5TR7 A;  4C75 A;  4DE1 A;  1RGY A;  2WZX A;  3S4X A;  5CX7 A;  3Q81 A;  1E4D A;  5CGX A;  4PM5 A;  1ERQ A;  2OWJ A;  2Y2M A;  1BUE A;  2XA7 M;  4KZ8 A;  2LB9 A;  2I9V A;  4EEU A;  4R38 A;  1CJF A;  3O3V A;  1N9O A;  5KSC A;  1BUL A;  3O88 A;  2B5R A;  2CC1 A;  3JPU A;  2XLN A;  3CHW P;  1XFN A;  4OOY A;  2DLA A;  3G31 A;  2GJ3 A;  1FR6 A;  3C4P A;  4S2P A;  4CLC D;  1K6R A;  1YSQ A;  3ISG A;  1IKI A;  1OME A;  4NXE A;  3HLB A;  3MKF A;  3VOY A;  2Y2Q A;  3CIT A;  1K54 C;  4ZTK A;  2XXL A;  1PWC A;  4UHU A;  4Y5F A;  4P6Z S;  4OQI A;  3S7N A;  4X68 A;  4HQA A;  2QZ6 A;  2XFT A;  1S66 L;  4X1M A;  5C5K A;  4IUK A;  1QME A;  3QHY A;  1OTA A;  5DVA A;  5HAP A;  2Y91 A;  2Z2L B;  1DJC A;  2O9B A;  3R7W B;  2ZQ8 A;  4Y0O A;  4NET A;  1OT6 A;  5F69 A;  1EWZ A;  5FQM A;  5E2F A;  4L9E A;  3UDX A;  3H82 B;  2VGJ A;  1XJ3 A;  1PW1 A;  3KSH A;  2K7S A;  5DF7 A;  1G28 A;  1GSV A;  5F68 A;  5G4Z A;  4JXS A;  1Q2Q A;  3BY8 A;  3NIA A;  4RX3 A;  3DW0 A;  4QD4 A;  3B3X A;  3KSI A;  4DJ2 A;  2IA2 A;  1H8Y A;  3NUL A;  4HJ6 A;  4MBK A;  3VP2 A;  4KZ3 A;  1NLY A;  3OPP A;  4HJ3 A;  4XUX A;  2EA9 A;  4OLD A;  2ZQD A;  3KEZ A;  5AQA A;  1W8Q A;  4XT2 A;  2WKQ A;  3UE1 A;  5JYO A;  4GD6 A;  4U0X A;  2ZQ7 A;  3E0Y A;  1XX2 A;  4KZA A;  4CLC A;  2X02 A;  2Y2P A;  2YKF A;  4PPR A;  1ZC2 A;  4LRY C;  4X1L A;  3LMS B;  3ZG8 B;  3ZYT A;  1BYW A;  2G2W A;  5A91 A;  1KE4 A;  3GV9 A;  3K2N A;  4ZJ1 A;  2IKE A;  3D4U B;  2EWV A;  2M1C A;  3ZG0 A;  1OPX A;  5HPF A;  2XQZ A;  2QSH A;  1CEG A;  2PBY A;  4EQ1 A;  5FAS A;  3DTM A;  3MBZ A;  1FSY A;  4N92 A;  3IF5 A;  5E2G A;  2JKR I;  1WXN A;  3L7H A;  4IJG A;  3M2K A;  4KZ7 A;  1P0Z A;  2VEA A;  3NI9 A;  5KZH A;  3NDE A;  2KLI A;  3MXR A;  3RH8 B;  1PZO A;  1TVF A;  3O87 A;  1FOF A;  2HP6 A;  1RP5 A;  1ONH A;  1G5U A;  1DRM A;  5HL6 A;  2OV5 A;  3IF6 A;  3ZG5 A;  3CUE C;  3IBJ A;  4QHC A;  1NLZ A;  4HEF A;  1S1Y A;  3GRJ A;  4X69 A;  2Q0O A;  1J9M A;  5DTK A;  2VGK A;  3T1Q B;  4GN2 A;  1LSX A;  1NJ4 A;  3RJU A;  4PKY A;  1Z6F A;  4S2N C;  3MFD A;  4PM9 A;  1ERM A;  2H0Y A;  5J3W A;  1YAX A;  2L0W A;  4PM6 A;  5CEC A;  4LRX C;  1ZLH B;  1Y4O A;  5K5B A;  5CHJ A;  4E3M A;  3DTK A;  4O0P A;  4FOF A;  2JTO A;  5CED A;  3LO7 A;  4MNR A;  5F82 A;  2NUT C;  2VV7 A;  2HJ9 C;  4X25 A;  5FI7 A;  2Z2M B;  2HGV A;  1ONG A;  4ZBE A;  2XSS A;  3NOT C;  2J9P A;  4UAA A;  3QP6 A;  5CEB A;  4MN5 A;  4OPY A;  4E6X A;  2VLG A;  1SDN A;  4GDN A;  3N7W A;  3DWZ A;  3IXD A;  4GNU A;  4U0T A;  4GOG A;  5IU1 A;  3IHA A;  2XRO A;  5AVE A;  4DDY A;  3MQ0 A;  3QP5 A;  4Q0H A;  4R4S A;  3UPP A;  4S2O A;  4K0X A;  4B93 A;  2JKT M;  1KDS A;  4KZ6 A;  2P9V B;  4WF0 A;  3C4O A;  4ARZ A;  4Y0U A;  1PRQ A;  4OOM A;  3UMD A;  5FAT A;  3VOL A;  1FCO A;  5GLD A;  3R7W A;  2D01 A;  1S0W A;  2IWB A;  1PIO A;  4RQ9 A;  3T4O A;  1BLP A;  1LL5 A;  3Q07 A;  2J3T C;  3IT9 A;  5EE8 A;  3E2L A;  1QMF A;  3ZDJ A;  3N8S A;  3WS4 A;  3CZD A;  4DKI A;  3H82 A;  4JF4 A;  4JXV A;  3SH7 A;  1AHL A;  4LV2 A;  4K0W A;  2ZOH A;  4P6B A;  2LB5 A;  3SOI A;  3LGO A;  2JBF A;  1V9Z A;  4ESP A;  4LLO B;  1MWU A;  5FI6 A;  3S7P A;  3CJM A;  1ZLI B;  1KDW A;  5HAQ A;  4ME4 A;  4CPK A;  4WEL A;  1MPL A;  4Z9Q A;  1SDE A;  5KSH A;  3BY9 A;  1BT5 A;  3M6H A;  3TSG A;  1BLH A;  3BRM A;  3UE6 A;  1TS8 A;  2UV0 E;  4GV5 A;  1D7E A;  2WKH A;  4LCL A;  1FIL A;  3UB6 A;  4HOI A;  5AVF A;  4WBG A;  2VV8 A;  5FEG A;  5E43 A;  3MF0 A;  4GLQ A;  3HVF A;  3A3J A;  3FKW A;  4MLL A;  1IYP A;  4Y13 A;  4M4X A;  1KGF A;  4KZ5 A;  2HF6 A;  3ZCZ A;  3BWL A;  5J8X A;  5FQJ A;  4DF6 A;  5J7E A;  1KOU A;  4Q0J A;  5HDD A;  1GKU B;  1TDL A;  3KX0 X;  5FQ9 A;  3VP3 A;  3VMA A;  5HFO A;  3BFG A;  3T12 B;  2A3U A;  2H10 A;  3BLM A;  2NUP C;  2OLV A;  4DXC A;  3G32 A;  2JKR M;  3HLC A;  3LI8 A;  4H6J B;  1BDS A;  1L0E A;  4NXB A;  1CQA A;  5FDS A;  1RCJ A;  3VV4 A;  1T1A A;  4OH0 A;  4GB7 A;  4Y0T A;  1IFQ A;  2R9W A;  1N9B A;  1UGU A;  4C6Y A;  3HJI A;  5DKL A;  3UY6 A;  2XEP A;  2OAP 1;  5FAP A;  2BG1 A;  3T4K A;  1ES3 A;  4LEN A;  3W2Z A;  3PBT A;  5FAQ A;  2ACG A;  1ZUF A;  3UO9 A;  3HLW A;  4DE0 A;  4FUW A;  4WEK A;  1CF0 A;  4DJ3 A;  2W1T B;  3QNB A;  4EV4 A;  2WUQ A;  2WAE A;  3WRZ A;  1MKI A;  2W0N A;  2DCF A;  2KDK A;  1KVL A;  2WK0 A;  2XD1 A;  1SHI A;  3AGF A;  5FQK A;  1EW0 A;  3JVU A;  3N4I A;  1AWI A;  2L4R A;  2INW A;  5TGF A;  3CMZ A;  2ZMA A;  5F6A A;  1CK3 A;  2EFU A;  4S2L A;  5GLA A;  3IF6 B;  3SZT A;  4JGR A;  3U2A A;  2VKS A;  1DP6 A;  4X56 A;  3QP4 A;  1FCM A;  1YMX A;  4MMN A;  4UA9 A;  1PFL A;  4GW9 A;  1M6K A;  3HUO A;  1NXY A;  2GDN A;  2A24 A;  4OLG A;  3LCE A;  1B8W A;  4R70 A;  2O9A A;  1HLU P;  3IF4 A;  4OKP A;  1IKG A;  1SCW A;  3LIE A;  2WKP A;  4ZJ2 A;  1E3U D;  1W7F A;  5AQ7 A;  1YQS A;  2VGL S;  1H3Q A;  4EQI A;  4OQ0 A;  3H9W A;  1NY0 A;  2ZMV A;  1J3W A;  2WZZ A;  1VEU B;  5J4E A;  2XFS A;  4EBL A;  1Y28 A;  4KZ9 A;  2I72 A;  5CER A;  4R6L A;  1BLC A;  1JVJ A;  2P9V A;  2CMN A;  3WS5 A;  1YMS A;  3HCY A;  1DJA A;  4LV1 A;  4MDZ A;  2MJ6 A;  3Q7Z A;  2E8J A;  3WWX A;  4HES A;  3Q82 A;  2MUB A;  4N9L A;  3VP0 A;  4FSF A;  3H7W B;  3T4Q A;  5U47 A;  4EBP A;  2BDS A;  1FR1 A;  4LV0 A;  3G34 A;  4L9G A;  4FH2 A;  3MMH A;  3ULF A;  4HY8 A;  2V2F F;  2H28 A;  3GSG A;  5G18 A;  3EGD C;  4E3L A;  3TG9 A;  2Y4A A;  5TBM A;  1N4O A;  1M40 A;  5FI2 A;  2PR6 A;  3A0V A;  4M3K A;  1XA7 A;  1MWS A;  2JKT I;  4KG6 A;  4ARZ B;  2Z6C A;  1JTD A;  1SHV A;  5F1F A;  1ES4 A;  4YFM A;  1SZV A;  1O7E A;  4IHQ A;  3T1R A;  3GMW A;  4PKY G;  3VP1 A;  1L2S A;  1LL9 A;  3V5M A;  3BQA A;  2ZC6 B;  3IQA A;  4MCW A;  3TOI A;  4NXG A;  5A92 A;  2WGI A;  5FDH A;  5F5Y A;  1KVM A;  2HP9 A;  2J7V A;  1ZG4 A;  2KX6 A;  1ERO A;  1S67 L;  2A49 A;  1E3U A;  4GS9 B;  3MS6 A;  4NEE D;  4S2M A;  1PW8 A;  3BFF A;  3LEQ A;  4ZRR A;  2YKH A;  1IEL A;  5HAR A;  2FH5 A;  3S7Q A;  4P6Z M;  5G4Y A;  5A93 A;  4E04 A;  3UB9 A;  4RA7 A;  3T50 A;  3LIF A;  3SS3 A;  4HH2 A;  3NEC A;  4Z1W A;  5DTT A;  3OBF A;  4B4X A;  2QHK A;  3V3R A;  3RTY A;  5KMW A;  3LI9 A;  5M1A A;  4H6J A;  4YOF A;  2RCX A;  4Y7P A;  1L0G A;  1HVB A;  2XK1 A;  1JWP A;  3UDF A;  5EVI B;  4FD8 A;  4GZB A;  4EU0 A;  3A3E A;  3PR6 A;  3IX8 A;  5GLB A;  3ZG7 B;  4NKP A;  3VFF A;  2EX8 A;  2DMW A;  4CLC E;  4Q8I A;  3PBO A;  4DXB A;  1K0K A;  4CLC C;  3IS2 B;  4B4Z A;  3N8R A;  3PBR A;  3ZNY A;  2Y2K A;  4RYE A;  3PHY A;  1GCE A;  1VHM A;  3PBQ A;  5E2E A;  5L10 A;  3S22 A;  3MZD A;  3SS4 A;  2VK3 A;  4KG5 A;  4KUO A;  1YLT A;  2P04 A;  1F5M A;  2HPB A;  4YWZ A;  3FV7 A;  2W1T A;  3LR0 A;  3CAX A;  2Y2N A;  2QJ7 A;  4EW7 A;  2EXA A;  1MZU A;  3SS5 A;  3GVB A;  4RVA A;  5I94 A;  4O7D A;  1E25 A;  5CHM A;  2R9X A;  2PD8 A;  2K2N A;  2W3D A;  1IOU A;  2Q9N A;  2HDU A;  5LBR A;  3C5A A;  1IYS A;  1ZG6 A;  3RFB A;  2VV6 A;  3MYV A;  3KYQ A;  2GNX A;  3BEC A;  2PT7 A;  4Q0I A;  2V0W A;  3NOU C;  4PMA A;  2J3T D;  3NY4 A;  1TS0 A;  1MC0 A;  3G30 A;  4WL9 A;  4U3T A;  4R3B A;  2V8F A;  4HP4 A;  1K57 A;  1ZTU A;  3IF6 C;  2ZL1 B;  2J9O A;  4P85 A;  2HP5 A;  5DJT A;  3UE0 A;  1YPR A;  2W3F A;  5GHY A;  5CGS A;  3QP1 A;  4HBU A;  1NZO A;  2WAD A;  4Y17 A;  2HJE A;  4GDB A;  3OPH A;  4JXW A;  4UA6 A;  4HIA A;  4X55 A;  1ZUE A;  3E4O A;  4Y3I A;  4D2O A;  1ACF A;  1VEU A;  1G6A A;  1CI9 A;  5A8B A;  4OPQ A;  1SH1 A;  4KUK A;  1JWZ A;  3HRE A;  2JKG A;  4JKT A;  4KZB A;  2EFX A;  2QKP A;  2J3W A;  5FQQ A;  1XP4 A;  2A24 B;  3D9Y A;  4KG2 A;  3C2W A;  1XKZ A;  3FWL A;  5GL9 A;  4YNR A;  2W27 A;  1P97 A;  3BM6 A;  3H7W A;  5GHZ A;  3MQO A;  4I39 A;  3DAV A;  4OP8 A;  2PU4 A;  1JNU A;  3KYZ A;  5EVI D;  4B9O A;  5HL1 A;  1A0K A;  4PHT A;  4EEP A;  1F2K A;  1HZO A;  5HAI A;  2ZLY A;  3NHQ A;  5FEF A;  1W79 A;  2BLS A;  1N9N A;  3HUM A;  4G3K A;  4MBH A;  2C6W B;  5IHV A;  3KYE A;  1SKO B;  1DP9 A;  5EVL A;  4BD1 A;  5HWT A;  3MR0 A;  3NBL A;  2XH9 A;  1MWT A;  1NWZ A;  5IT5 A;  4YIR A;  4BJP A;  1TDG A;  1FSW A;  1PZP A;  1AXB A;  3EGX C;  5HDC A;  1ESU A;  3WRT A;  4A5R A;  3G6O A;  4WLA A;  1OTE A;  5DTS A;  2JCH A;  5HZH A;  1K25 A;  5TBM B;  4WUJ A;  4GKU A;  5MC7 A;  1G6O A;  4GS9 A;  4HH3 A;  1Z99 A;  4H8R A;  5I5L A;  1MBL A;  4D60 A;  4EUV A;  2WGW B;  4KQD A;  2W1R A;  3IWO A;  3EWK A;  1I2S A;  4FTX A;  3EQU A;  1BZA A;  3C7V A;  2PBD P;  5TJJ A;  3LIA A;  2ZM0 A;  3UDI A;  2H0T A;  3OPR A;  4BQM A;  3ITB A;  5L09 A;  4HBT A;  4ZDX A;  4ZAM A;  3IXH A;  5L07 A;  1MWR A;  1TF1 A;  2PU2 A;  5L8M A;  2J80 A;  4FH4 A;  4R1G A;  2W3H A;  1GHM A;  4S2I A;  4E3N A;  4I38 A;  2V20 A;  5EVI A;  1XA1 A;  2B02 A;  4OPZ A;  1XGI A;  2QSF A;  3MXQ A;  2PYR A;  2PRF A;  2SH1 A;  3PTE A;  3IS2 A;  4I3A A;  3G2Z A;  3CPT B;  1WYC A;  2OSU A;  2O9C A;  2GX5 A;  4WYY A;  3UB7 A;  3FC7 A;  4WZ5 A;  2ZC4 B;  1T18 A;  2IWC A;  2WKR A;  1BTL A;  3PYP A;  1K56 D;  1KE0 A;  5HWW A;  3CI6 A;  3OC2 A;  3ITA A;  3S1Y A;  4LV3 A;  2ZBB A;  4NK3 A;  2V1A A;  4JBF A;  1K55 A;  5EV0 A;  3SW1 A;  2P7J A;  2HDS A;  3MFX A;  1GA0 A;  4KQQ A;  3WS1 A;  4NXF A;  3D3O A;  5EEC A;  4BBT A;  2QJ5 A;  4UEY A;  4UQI S;  4JF6 A;  3VE4 A;  3VSL A;  3ZG9 B;  5DF8 A;  1IYO A;  2FZ0 A;  2VJW A;  2J8Y A;  4JPM A;  1XGJ A;  3C38 A;  1K6S A;  3MSH A;  5CXW A;  1Y54 A;  2JN7 A;  2UWX A;  3TE8 A;  5M18 A;  1NYY A;  2Y2G A;  4JLF A;  3BFC A;  1U60 A;  3KO6 A;  3P09 A;  5HD3 A;  4HP9 A;  5F83 A;  2QMI A;  3OZH A;  3OPL A;  3UN7 A;  4L0L A;  4QU3 A;  4EWF A;  2XA7 S;  2ZL1 A;  5BOH A;  4WM9 A;  1XJ6 A;  4NG2 A;  5GHX A;  1Z09 A;  2C5W B;  4BL2 A;  1T1C A;  3UPO A;  3LID A;  1I2W A;  3DBA A;  3Q1F A;  3G2Y A;  1I5Q A;  2HDR A;  1O07 A;  3A3I A;  5HD5 A;  4KQR A;  1ES5 A;  3E98 A;  3F1N B;  3PAE A;  3AGD A;  3OCN A;  3IBR A;  3W4P A;  3PBS A;  2EWW A;  1GA9 A;  4LGW A;  1T19 A;  3FZC A;  1MXO A;  1DJB A;  1DY6 A;  1H8Z A;  1VB6 A;  3N8L A;  3NDG A;  4MN6 A;  4QPR A;  3B42 A;  1GHP A;  1LHY A;  1YKD A;  4L9F A;  1XXM A;  3F1O A;  3ZQ5 A;  2DNS A;  1L0F A;  2K31 A;  5FAO A;  2Y2O A;  5FL3 A;  2Y2L A;  4HI4 A;  1TD5 A;  4GJ4 A;  5FSR A;  2Q9M A;  3DTI A;  3LYX A;  3D4F A;  3VOZ A;  2VA0 A;  3IH9 A;  1SKO A;  4II7 A;  2B18 A;  4EUZ A;  2ZQ9 A;  5EM1 A;  5DF9 A;  4DE2 A;  1YLZ A;  4OOL A;  3V50 A;  2B9K A;  3BYD A;  3JYI A;  3T1X A;  3LR5 A;  3IXB A;  4DE3 A;  4FCF A;  5DJU A;  1K54 A;  1PWD A;  3HBR A;  2JC7 A;  4ETZ A;  1STZ A;  3G35 A; 
#chains in the Genus database with same CATH homology
 3PHY A;  1VHM A;  3PBQ A;  2JKT M;  4B93 A;  2M7U A;  4BWI A;  1LT0 A;  4WF0 A;  2V1B A;  1W63 Q;  5IS1 A;  2PHY A;  4ARZ A;  1YSP A;  4KUO A;  3O5Y A;  1X0O A;  1TS6 A;  2P04 A;  1F5M A;  4OOM A;  4YWZ A;  3UMD A;  3LFV A;  1GSX A;  3F1P A;  4GCZ A;  3D72 A;  1APF A;  2W1T A;  3OCL A;  3VOL A;  3GDI A;  3LR0 A;  3CAX A;  3R7W A;  2D01 A;  2QJ7 A;  4EW7 A;  4RQ9 A;  1MZU A;  3T4J A;  3K3C A;  2PR5 A;  3T4O A;  3CLO A;  3ICY A;  2J3T C;  3TRC A;  5HDS A;  2QWS A;  3MJQ A;  2PD8 A;  1ZHH B;  2K2N A;  2BAS A;  2W3D A;  2VGL M;  5EFW A;  3UE3 A;  1IOU A;  1WA9 A;  4PAU A;  5LBR A;  1P9W A;  4GHI A;  3H82 A;  3RFB A;  2VV6 A;  3MYV A;  3KYQ A;  2GNX A;  1OTB A;  3KSG A;  1AHL A;  2PT7 A;  2KOI A;  2V0W A;  3NOU C;  4LPZ A;  4Q0I A;  2ZOH A;  2ZOI A;  2J3T D;  2P08 A;  1ODV A;  2LB5 A;  3T4S A;  1TS0 A;  1MC0 A;  4WL9 A;  3NJA A;  4LRZ E;  3BW6 A;  3S7O A;  1N9L A;  1V9Z A;  5DFX A;  4LLO B;  3OLO A;  4R3A A;  4HP4 A;  1ZTU A;  2VZW A;  3S7P A;  2O0Y A;  1WQK A;  3LIB A;  1ZLI B;  5HPI A;  2Z6D A;  5DJT A;  1OTI A;  4ME4 A;  2A2L A;  4WEL A;  3LUQ A;  1OT9 A;  4UQI M;  3P7N A;  1OJ5 A;  2W3F A;  3VE3 A;  5KSH A;  3BY9 A;  4EET B;  4F3L A;  1P9R A;  3EEH A;  3UE6 A;  1D06 A;  2O99 A;  2H9X A;  1TS8 A;  2HJE A;  1OJG A;  3FPV A;  1V9Y A;  2OAQ 1;  4HIA A;  4GV5 A;  1ZUE A;  1D7E A;  3E4O A;  4Y3I A;  3JVV A;  2K2X A;  4K08 A;  3MQQ A;  3UB6 A;  5A8B A;  1SH1 A;  4I3J A;  1LSW A;  4HOI A;  2M7V A;  4KUK A;  5AVF A;  3UB8 A;  2GZA A;  1NRJ A;  4BBV A;  2VV8 A;  4ETX A;  5CX7 A;  2QKP A;  3MF0 A;  4GLQ A;  2J3W A;  2OWJ A;  2A24 B;  2XA7 M;  4M4X A;  3C2W A;  4YNR A;  2W27 A;  2HF6 A;  2LB9 A;  3BWL A;  4WEJ A;  5J7E A;  1P97 A;  1KOU A;  2I9V A;  3H7W A;  4R38 A;  4EEU A;  4Q0J A;  3MQO A;  4I39 A;  5HDD A;  3MCX A;  3KX0 X;  1N9O A;  1JNU A;  3KYZ A;  4B9O A;  2V0U A;  4PHT A;  2NUP C;  2IKD A;  4EEP A;  3E4Q A;  2JKR M;  1MKM A;  1XFN A;  3NHQ A;  3EQV A;  3LI8 A;  2DLA A;  1N9N A;  4H6J B;  2GJ3 A;  3TW8 A;  4G3K A;  1BDS A;  4BMW A;  3A0S A;  1T1B A;  4IUH A;  1LL8 A;  4NXB A;  4CLC D;  1DP9 A;  1YSQ A;  4CQH A;  3VV4 A;  5HWT A;  3MR0 A;  4NXE A;  1T1A A;  1NWZ A;  3CIT A;  1IFQ A;  5IT5 A;  4YIR A;  4BJP A;  3B47 A;  5DKK A;  2XXL A;  1UGU A;  4Y5F A;  3HJI A;  3EGX C;  3EEA A;  5DKL A;  3NOP C;  4DMZ A;  4P6Z S;  5HDC A;  3S7N A;  3CUE A;  2OAP 1;  3G6O A;  2JR3 A;  4HQA A;  3T4K A;  3W2Z A;  5HWV A;  4WLA A;  1OTE A;  3LR4 A;  3PBT A;  1S66 L;  5HZH A;  5C5K A;  4IUK A;  1ZUF A;  1D6B A;  5TBM B;  3BJN A;  2Y8H A;  4WUJ A;  1OTA A;  1GSW A;  4WEK A;  3F1N A;  4JGP A;  3F1P B;  4DJ3 A;  2W1T B;  5MC7 A;  2O9B A;  2W0N A;  2KDK A;  3GEC A;  3R7W B;  1G6O A;  1SHI A;  4GS9 A;  4HH3 A;  1LSV A;  1EW0 A;  3JVU A;  1Z99 A;  3T4T A;  5I5L A;  2L4R A;  2INW A;  1OT6 A;  5F69 A;  4EUV A;  5F6A A;  4G3V A;  2PD7 A;  4KQD A;  4L9E A;  2W1R A;  3EWK A;  3H82 B;  4JGR A;  1XJ3 A;  3KSH A;  3U2A A;  2K7S A;  4DN0 A;  3BQ8 A;  3EQU A;  2Y79 A;  2VKS A;  1G28 A;  1GSV A;  5F68 A;  5G4Z A;  5TJJ A;  3LIA A;  1DP6 A;  1XJ4 A;  3BY8 A;  4MMN A;  2ZMF A;  3KSI A;  4DJ2 A;  4GW9 A;  3E4P A;  1TF1 A;  1UWN X;  3EOI A;  4WN5 A;  5L8M A;  2IA2 A;  4HJ6 A;  2J80 A;  1S4S A;  2W3H A;  2A24 A;  2PYP A;  4I38 A;  1F9I A;  1NLY A;  1B8W A;  4R70 A;  2O9A A;  4HJ3 A;  4G3W A;  2EA9 A;  3LIE A;  2B02 A;  2WKP A;  3KEZ A;  3FPW A;  2QSF A;  4XT2 A;  4F3L B;  3MXQ A;  2PYR A;  2WKQ A;  2SH1 A;  1XFQ A;  1OTD A;  3IS2 A;  2VGL S;  4EER A;  3E0Y A;  1H3Q A;  4I3A A;  4CLC A;  3H9W A;  3F1O B;  5KIZ A;  2O9C A;  1F98 A;  2YKF A;  2ZMV A;  2GX5 A;  3UB7 A;  4LRY C;  2XRN A;  3FC7 A;  5J4E A;  1Y28 A;  3LMS B;  1T18 A;  3UME A;  2WKR A;  4R6L A;  3PYP A;  1BYW A;  3ZYT A;  1UWP X;  2V9A A;  3K2N A;  4I5S A;  5HWW A;  2CMN A;  2L1M A;  1H5O A;  3CI6 A;  3OC2 A;  3HCY A;  2IKE A;  1W63 M;  4MDZ A;  3D4U B;  2ZBB A;  2MJ6 A;  2V1A A;  3PXP A;  2EWV A;  2M1C A;  3HJK A;  4I3I A;  5AJG A;  1OPX A;  3FG8 A;  5HPF A;  2QSH A;  2MUB A;  4EQ1 A;  3SW1 A;  2P7J A;  4FSF A;  3MFX A;  2RNG A;  3H7W B;  3T4Q A;  3K3D A;  2W3E A;  2BDS A;  4NXF A;  3D3O A;  4BBT A;  2QJ5 A;  3R4K A;  4UEY A;  4UQI S;  4L9G A;  3MMH A;  3ULF A;  3OOV A;  3VE4 A;  2PDR A;  3TJZ C;  4HY8 A;  4AFI A;  2H28 A;  2JKR I;  3EGD C;  2FZ0 A;  2VJW A;  1WXN A;  4IJG A;  2HV1 A;  5TBM A;  3C38 A;  2VEA A;  1P0Z A;  2JN7 A;  2QSG A;  4BBU A;  2PR6 A;  3A0V A;  3TE8 A;  2JKT I;  2KLI A;  4ARZ B;  2Z6C A;  3RH8 B;  3KO6 A;  3LR3 A;  4O01 A;  4HJ4 A;  1S1Z A;  5HD3 A;  4HP9 A;  4IHQ A;  4JGO A;  4L0L A;  1DRM A;  2XA7 S;  5HL6 A;  4PKY G;  3CUE C;  2QYB A;  1XJ6 A;  3IBJ A;  3BQA A;  1NLZ A;  1S1Y A;  3C30 A;  4MCW A;  1T1C A;  4NXG A;  1TS7 A;  2JHE A;  4GHI B;  3LID A;  4KQO A;  3DBA A;  1LSX A;  2W3G A;  4PKY A;  5HD5 A;  5F5Y A;  3E98 A;  3F1N B;  3KSF A;  3OCN A;  4EXO A;  3IBR A;  2KX6 A;  3V67 A;  3C8C A;  3PBS A;  2R78 A;  1S67 L;  5J3W A;  1H8M A;  1YAX A;  2EWW A;  2L0W A;  4GS9 B;  4NEE D;  2G7U A;  1ZLH B;  4LRX C;  4HHD A;  2MN3 A;  5K5B A;  4ZRR A;  1T19 A;  2YKH A;  4O0P A;  4FOF A;  2JTO A;  3S7Q A;  2FH5 A;  1VB6 A;  4MN6 A;  4QPR A;  4P6Z M;  5G4Y A;  4E04 A;  3T4L A;  3UB9 A;  3B42 A;  1DP8 A;  2NUT C;  1YKD A;  2VV7 A;  4L9F A;  2HJ9 C;  3T50 A;  3LIF A;  4HH2 A;  3F1O A;  3ZQ5 A;  4O8G A;  4Y2F A;  2HGV A;  2K31 A;  4Z1W A;  2OOL A;  3OBF A;  4JGQ A;  2XSS A;  2QHK A;  5FL3 A;  3CWF A;  4HI4 A;  3NOT C;  5HSQ A;  1TD5 A;  4GJ4 A;  3RTY A;  3LI9 A;  3LYX A;  4H6J A;  2VX8 A;  4YOF A;  1XJ2 A;  3A0R A;  2VA0 A;  4MN5 A;  2VLG A;  4II7 A;  4EU0 A;  2OWH A;  3PR6 A;  2B18 A;  2D02 A;  4NKP A;  5DF9 A;  3LIC A;  2DMW A;  4OOL A;  4CLC E;  2B9K A;  3B33 A;  3PBO A;  4XT2 B;  3LR5 A;  4HNB A;  5IU1 A;  2XRO A;  4CLC C;  1S4R A;  3IS2 B;  5DJU A;  3PBR A;  4CLC B;  4MN7 A;  5AVE A;  3MQ0 A;  4Q0H A;  4ETZ A;  4EES A;  3PBN A;  3P01 A;  1STZ A;  5DFY A;  1ATX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...