2HJ9C

Crystal structure of the autoinducer-2-bound form of vibrio harveyi luxp complexed with the periplasmic domain of luxq
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
219
structure length
210
Chain Sequence
SKQQTSALIHNIFDSHFAAIQIHHDSNSKSEVIRDFYTDRDTDVLNFFFLSIDQSDPSHTPEFRFLTDHKGIIWDDGNAHFYGVNDLILDSLANRVSFSNNWYYINVMTSIGSRHMLVRRVPILDPSTGEVLGFSFNAVVLDNNFALMEKLKSESNVDNVVLVANSVPLANSLIGDEPYNVADVLQRLLVIETPIVVNAVTTELCLLTVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autoinducer 2-binding periplasmic protein luxP
publication title Ligand-induced asymmetry in histidine sensor kinase complex regulates quorum sensing.
pubmed doi rcsb
source organism Vibrio harveyi
molecule tags Signaling protein
total genus 67
structure length 210
sequence length 219
chains with identical sequence D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.20.100 Mainly Beta Single Sheet Anthopleurin-A Anthopleurin-A 2hj9C02
3.30.450.220 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2hj9C01
1ZHHB 3C38A 3C30A 2HJ9C 2HJEA
chains in the Genus database with same CATH superfamily
3DBAA 3P98A 3G4PA 1TD5A 4G3WA 3A0SA 1PNEA 3KO6A 3SH7A 4Q0IA 2ZQ7A 4R3AA 4GHIA 3S4XA 3F1PA 5KMWA 4MEZA 1ESUA 2JCHA 3NOUC 4KZ4A 1MKIA 1JVJA 1TS6A 3UB7A 1BLPA 2Y91A 1GHMA 3VE3A 2ZC3B 4RX2A 5GHYA 5HAQA 2VV8A 1V9YA 4O0PA 4G3VA 1H5XA 3LIEA 4IHQA 1QMEA 3MBZA 1NRFA 4FH4A 3IH9A 4CQHA 4E3OA 1W5DA 3GDIA 1W63Q 3OBFA 5HAIA 3SZTA 1ERQA 3LR4A 2XD5A 1BLHA 2ZD8A 4EV4A 4X1LA 1NRJA 1H3QA 2EX6A 3BECA 5CRFA 2KDKA 4HIAA 3LEZA 2W1RA 4NXFA 5TFQA 3E4PA 3A3FA 2PR6A 3N7WA 2IWBA 4JF4A 3FPWA 1NXYA 3LIAA 5AQBA 3BFEA 4GDBA 1GSVA 5DFYA 3MSHA 4LRYC 4OP8A 4N1HA 2IWCA 2H0YA 2PYRA 2V1ZA 1OTDA 2ZBBA 2BLSA 1XGJA 4MBFA 2J7VA 1L0EA 2HV1A 3TSGA 2VA0A 5KIZA 3N8LA 4MBHA 1IYQA 1IOUA 3VV4A 3PAGA 3G32A 2R9XA 3B42A 3LR0A 1XPBA 3NY4A 2ZC7A 1G6AA 2JHEA 3GSGA 4HH2A 1UWPX 1KVMA 3DTEA 2XH9A 2JKTM 4E6WA 2P9VB 3GV9A 3LY4A 2L4RA 2BASA 2OSUA 4KQRA 4L9GA 5HW3A 2OOLA 4GS9B 2WAFA 3H9WA 5AQ9A 2OWJA 3SS3A 4X1MA 1RCJA 1X0OA 1CEGA 4Y15A 5F6AA 3TRCA 2NUTC 3E2LA 4QY6A 3OPHA 3KYZA 2ACGA 2QSHA 3UB8A 3KEZA 5FQ9A 3G2YA 4Y3IA 2WKEA 5DF8A 5GLCA 4DXCA 4ESPA 2AVXA 2P7JA 4WZ5A 4ZBEA 3KX0X 4KQQA 3HLEA 3IX3A 4N1XA 2DLAA 4F3LB 2A3UA 4OQ0A 3P01A 2VGLM 4NG2A 1GSXA 3JPUA 5FASA 1D1JA 1NJ4A 2C6WB 4JXSA 3NI9A 3FC7A 3G34A 1JWVA 5HDSA 4NETA 5EUAA 3T50A 5HWWA 5E2GA 4OPYA 2Q0OA 3WWXA 2XGNA 5TBMB 3SH8A 2XFTA 3T4QA 1FCNA 3IF4A 5G18A 2B5RA 1IELA 4GDNA 3G31A 2OLUA 5HPFA 3EQVA 1L0GA 1M6KA 3BLMA 5EVEA 5L10A 4N9LA 4KZ3A 1NY0A 1K4EA 2GZAA 3O88A 3KSHA 2ZC6B 3SOIA 5M1AA 3IX4A 1K57C 2JKTI 3BFGA 5F68A 2A49A 5FI7A 4CLCB 2P9VA 2V9AA 5FQKA 4FTXA 2GDNA 2PU4A 3GTCA 4NKPA 2QSGA 4GS9A 1KDWA 2C5WB 1PFLA 1Y4OA 2XROA 1BLCA 1Q2QA 4DN0A 2WUQA 5F1FA 5J8XA 4YINA 1ES5A 1VM1A 1W79A 2W3GA 1BT5A 2LB9A 3S22A 1BTLA 3ZG0A 1PW8A 4OPRA 3LEQA 4CJNA 2O9BA 2WGWB 2ZM2A 2R9WA 3EGXC 2EXBA 3SS4A 4LFUA 2BG1A 4O01A 4BQMA 1K4FA 1YLJA 4GW9A 2B18A 3Q07A 2P04A 5M19A 5DKLA 4F3LA 2RCXA 4L9FA 5A92A 3T4JA 4KUKA 1S67L 1JTDA 4KG2A 3PAEA 4EUVA 1TS8A 2Y2QA 3Q1FA 3F1OB 5CTNA 3RXXA 3HVFA 2KLIA 1YLWA 4MN6A 3LI9A 4PM7A 3BY9A 2IKEA 2XK1A 2OV5A 1TVFA 4DMZA 4E3LA 2J80A 1WQKA 3LYXA 3UY6A 1UWNX 3JVUA 2VLGA 2B9KA 2HDRA 2OAQ1 3F1NB 3K2NA 3PTEA 4DE0A 3ULFA 3NOPC 4LRXC 5TBMA 3T12B 3M6HA 1XJ6A 4WLAA 2VV7A 3IQAA 4ME4A 1LL9A 3BWLA 5EV0A 4EETB 3UB5P 1XXMA 2UV0E 3T4LA 5KSHA 5GLDA 3S7OA 3NCKA 2QJ7A 3GECA 1SH1A 2WYXA 3Q7VB 2XLNA 1PWCA 1ERMA 4UEYA 2EA9A 1EW0A 2K2XA 4O7DA 5FATA 5TR7A 3SH9A 2ZOIA 3C7UA 5CGSA 3ZNTA 3LGOA 1OMEA 1XJ2A 4LV2A 1XFQA 1ZUFA 1PWDA 3WRZA 4PM5A 3PBRA 2D02A 4HP9A 4PPRA 4R1GA 1MZUA 4EBLA 4CLCA 1ATXA 4OONA 3IF6C 2G2UA 4HQAA 1T19A 3P7NA 5TJJA 5DVAA 3BEBA 5EECA 3OC2A 3BFCA 2W3HA 5CHMA 2XRNA 3BM6A 4BWIA 2HP5A 3ZHHA 2V8FA 4JKTA 4A5RA 4QY5A 5I94A 1STZA 1RGYA 2WGWA 4WBGA 3Q7ZA 3ZDJA 4Q0HA 3ZGAB 4KZ8A 3MFXA 4AFIA 1GA0A 2B95A 4II7A 3LUQA 1G68A 3O5YA 3B3XA 1K25A 3OLOA 2ZQ8A 2D01A 5A8BA 5EVIB 3DWKA 1GA9A 4RQ9A 1PI5A 1VHMA 1KE0A 3F1OA 4OH0A 3P09A 2OAP1 2O9CA 3E4OA 1J3WA 1ZKJA 1NWZA 1YM1A 4X56A 3UE6A 1YSPA 3PBSA 3F1NA 3MJQA 4P6BA 2CMNA 1N9OA 2J3TD 1XGIA 3CPTB 5CGWA 4BBTA 1SZVA 3PBTA 2EX2A 4U3TA 3G2ZA 3LMSB 3MFDA 4LGWA 3G30A 1YQSA 4YWZA 4WL9A 5F82A 1O7EA 1ES3A 1OT9A 3VFHA 3Q7VA 5IU1A 4EEPA 1GL9B 4WELA 5FI2A 4EWFA 1WE4A 2H9XA 4HJ4A 5FQIA 1F2KA 4Z9QA 3NC8A 3S1YA 3D72A 2R78A 2E8IA 4LCMA 3QHYA 3ITBA 1W8QA 2PDRA 3CAXA 4EEUA 4JGOA 3TE8A 5DKKA 3N6IA 1YT4A 2HPBA 3LR3A 4MBKA 2WGVA 4HBTA 1ZLIB 5HAPA 1DJBA 3S7QA 2Z6DA 3BFDA 1N9NA 3LIDA 4MN5A 1XJ4A 2Y2HA 1XKZA 1IKGA 2V0UA 4X68A 1CQAA 3FV7A 4XXRA 4EU0A 4YFMA 3FZCA 4KQDA 4Y13A 4ZRRA 4LV0A 4JXGA 1TDGA 3O87A 4FUWA 3ZVWA 4GN2A 3S7NA 4JGRA 5E2FA 2DCFA 4ZDXA 4E3KA 5CEDA 1P97A 4JGQA 1T1BA 2L1MA 2DNSA 1D6BA 4FSFA 1Y28A 5A90A 2EWVA 4X6TA 1YLYA 2X71A 4ZJ1A 3QNBA 3ZVTA 2QZ6A 4YOFA 1VB6A 2HP9A 3OPRA 2DMWA 1K56A 3HUNA 3EGDC 1K6RA 5EVIA 3VOLA 3T1SA 2XEPA 4ETXA 4R3JA 3C2WA 1KE4A 2WADA 4DRTA 1ZG6A 5GLAA 1SKOB 4KQOA 1DP8A 1DP6A 4ZAMA 4UQIS 1H8MA 4HJ3A 5GHXA 2K2NA 4N92A 3NIAA 1GKUB 1FIKA 2VV6A 3FWLA 3T4TA 3VSLA 1MXOA 5E2HA 4OPQA 3W8KA 3CPTA 4OPZA 3IWIA 2Q9NA 5HPIA 3M2KA 1S66L 3ZCZA 4FH2A 4JPMA 2I9VA 3MZFA 4QB8A 3TJZC 2FZ0A 1I5QA 1NLZA 5IT5A 4ZJ3A 1TS0A 3QP4A 1HTZA 3UMDA 3SS5A 4KG5A 5K5BA 4OOMA 1D06A 3MQOA 2O99A 4DKIA 4R0QA 4KZ6A 1DJAA 5GL9A 2B02A 4UA6A 2HJ9C 1K55C 2UWXA 3C7VA 1FCMA 4H8RA 4NK3A 2HJEA 4L9EA 3A3DA 3NDEA 3U4LP 3BFFA 1LSWA 1OJGA 1F9IA 2G7UA 1TDLA 3NULA 5EOEA 4DXBA 3H82B 3A3EA 1PW1A 1IEMA 4B4ZA 1P0ZA 1YLTA 1H8YA 3C38A 3IXDA 3ZNYA 1ACFA 5HX9A 3ZYTA 5EFWA 3HUOA 5EE8A 5FEFA 3E98A 2PU2A 1RP5A 4PHTA 4O8GA 4GJ4A 2EWWA 2Y55A 3BYDA 4FOFA 2Z2MB 4ETZA 1K57A 3M6BA 3DW0A 1DJCA 1S6RA 2XA7S 5CX7A 2EX9A 2J8YA 2ZMAA 3H7WB 1YLZA 2QKPA 1ONHA 4GKUA 4E6XA 5TGFA 3IF6B 5JYPA 3MZEA 1H5OA 3T4KA 1B8WA 1PZOA 4L0LA 2Z2LB 5IHVA 2XSSA 3FKWA 1SKOA 4I3JA 1H8ZA 4PMAA 5L8MA 3LIFA 3NJAA 1WA9A 3HLGA 3VP2A 4I3IA 1OPXA 3UN7A 4MN7A 5HSQA 5D3OA 5AQAA 2Y2PA 3MXQA 3UDXA 3WS0A 2V1AA 1MWUA 4DJ3A 2Y2LA 2HF6A 1IYOA 1FSWA 3PBNA 1Y54A 1TEMA 3HJIA 4JBFA 1NZUA 3IWQA 3PR6A 1W63M 1GCEA 2O0YA 2DRWA 4R4RA 3UE0A 2PD7A 2XD1A 3OCNA 1L0DA 4PM8A 1TF1A 1JTGA 3L7HA 5A93A 1T1AA 2EX8A 1K56D 1E4DA 3UDIA 5EVID 1OTIA 1Q2PA 1W8YA 2IA2A 1FR6A 4QJGA 3MMHA 2ZOHA 4Y0TA 2M1CA 3H82A 3W4OA 1SCWA 1XX2A 4IVKA 3S7PA 1JWZA 2WAEA 4D2OA 4HHDA 5AQ7A 2VGJA 2XFSA 2QWSA 4NXEA 2XDMA 4QD4A 1ALQA 2JBFA 1EROA 4ARZB 1LI0A 1XA1A 2ZM8A 3EOIA 5L07A 3EQUA 3ZG8B 2VGKA 2FH5A 2Y2OA 4UQIM 3H7WA 1H0MA 1VEUB 3D4FA 3A0VA 4JF5A 3L9KA 5CEBA 4HNBA 3T1RA 4UA9A 3IF6A 2SH1A 2ZC5B 3EWKA 5EM1A 1MWRA 2WK0A 4JLFA 2JR3A 4WYYA 3RJUA 4BENA 3W2ZA 3IS2B 4E3MA 1GHPA 2ZL1B 5EPHA 4WUJA 2PR5A 4WF0A 3IBJA 4H6JB 4P87A 4OOYA 4IUKA 3MXRA 3IXBA 3BLSA 2LB5A 3V50A 5HARA 1LSXA 1CJFA 1S0WA 3PBQA 2HDUA 5DFXA 2J9OA 2Y2JA 3A0RA 3IBRA 3LIBA 1JWPA 3DAVA 5FDSA 4RYEA 5A91A 4S2KA 1L3LA 1GSWA 1EWZA 1RGZA 5CTMA 1AHLA 3E2KA 4GD6A 3UPNA 4BD1A 3WS5A 5BOHA 3MR0A 3WS2A 2NUPC 1LI9A 4MCWA 1E3UA 2P08A 3V67A 3K3CA 2ZQDA 3MYVA 2BTFP 1NZOA 3SW1A 1K0KA 1L0FA 2VEAA 4B4XA 3D3OA 1NLYA 3CJMA 1T18A 5F69A 2XA7M 1CF0A 4OLDA 1DRMA 4GZBA 1K6SA 4HESA 4Y0OA 3VP3A 3UMEA 2ZLYA 3PXPA 5EVLA 1EL6A 4DE3A 3W4QA 3IT9A 3MS6A 5FQQA 2J3TC 1ZC2A 1K54C 3KSIA 2FFYA 1G6OA 4BD0A 3V3SA 2Y2MA 1KGGA 2V20A 5F5YA 2WZXA 4HY8A 2W3DA 4OVDA 4GB7A 4ARZA 2A2LA 3UDFA 5HD5A 1LT0A 2INWA 5CECA 3DTMA 3HLDA 3CMZA 1Z99A 1VEUA 3G35A 3OZHA 3RFBA 3IH8A 4UA7A 5KZHA 4D60A 2XR0A 3IS2A 3CI6A 3NBLA 2ZL1A 3JVVA 4C75A 1BYWA 4H6JA 2X01A 1G28A 2RL3A 4B88A 3KYQA 4I38A 5CERA 3MKEA 2L0WA 4OOLA 4GCZA 1CK3A 1ESIA 2JN7A 3C5AA 5KSCA 1KVLA 1YSQA 1VQQA 1M40A 1OTEA 4BL2A 1YPRA 3LICA 2RNGA 3V39A 5FDHA 3EEAA 2Y79A 4KZ5A 3CHWP 1PIOA 1FR1A 4C6YA 3UNWA 1KGEA 3IWOA 2Y2NA 3U2AA 1MWSA 4RVAA 1YMSA 4ID4A 4I3AA 2HP6A 4JGPA 4KZ7A 4LRZE 4EXOA 1BDSA 1IYPA 4B9OA 2HZ5A 4JXVA 4MMNA 2GX5A 3C4PA 1ES2A 2A24B 3E4QA 4HJ6A 2V8CA 3RTYA 4S2IA 4KZBA 2IWDA 2YKHA 2E8JA 3B47A 2QPNA 4OQGA 3KSFA 1GHIA 2Y8HA 3ITAA 1E25A 2XQZA 2JE5A 3BW6A 5DTKA 4K0XA 2V1BA 4EQIA 1BLSA 1K55A 5FAQA 4WN5A 3CWFA 3GR2A 3UE1A 4GNUA 3QP2A 3C30A 2J9PA 3HJKA 1N9LA 2VZWA 4WM9A 1HD8A 1Z6FA 4DE2A 3DWZA 2JKRM 4KZ9A 1ZTUA 3CUEC 1FQGA 4LLOB 1E3UD 3CG5A 1SHVA 5DJUA 3T1XA 3LI8A 5FSRA 3QP1A 3OPLA 3RH8B 3CITA 2P74A 3HLFA 1F5MA 5L2FA 4S2NC 1XJ3A 3BY8A 1S1ZA 3MQQA 2PD8A 2WGIA 4HEFA 1N9BA 4JF6A 3VE4A 4X25A 4CLCD 3LY3A 2MN3A 3OOVA 4RX3A 4OKPA 4S2MA 4FCFA 3ISGA 2EXAA 4XUZA 2ZJ9A 1DP9A 3VSKA 4LV1A 2JKGA 4P6ZS 3AGDA 1MPLA 5J7EA 2WKPA 4PAUA 4DDSA 2W1TB 5HZHA 4BBVA 5DF9A 5FL3A 2KX6A 4R3BA 3LO7A 1V9ZA 5FQMA 4B93A 5F83A 3Q82A 4QU3A 4N9KA 4U0XA 4OQIA 1F98A 2J3WA 2H5SA 2PBDP 4IVIA 3VFFA 4I5SA 4E04A 2A24A 5FQJA 3BQ8A 5AVEA 2XF3A 4UHUA 5EM0A 5I5LA 2WKQA 4U0TA 1BSGA 3FKVA 3R7WB 5L09A 3DTKA 2MUBA 4OLGA 1KOUA 1HVBA 3W4PA 3T1QB 3HLCA 4Z1WA 4BJPA 5DJTA 4IJGA 3IHBA 5CGXA 3N8SA 2PBYA 2BDSA 3T4OA 1WXNA 3VP1A 4LV3A 5HWTA 4OQHA 2JTOA 3OPPA 3V5MA 1FCOA 2JKRI 4S2LA 3CZDA 4G3KA 3QP8A 3M2JA 5HFOA 2O9AA 5U47A 4BLMA 4KG6A 1Z09A 5EVIC 2I72A 3PHYA 5EOOA 5DTSA 4GOGA 2FFFB 3BRMA 1CEFA 1UGUA 4Y7PA 1OTAA 4BMWA 1SKFA 2VJWA 1LLBA 2VK3A 3D9YA 4EQ1A 5HWVA 4PM9A 4P0MA 2QJ5A 1L2SA 3A3JA 2WKRA 1APFA 4R6LA 3UPOA 1IKIA 3ICYA 4PM6A 1KDSA 3GVBA 3T4SA 4KUOA 2Y2IA 4LPZA 3HL9A 3NHQA 4R4SA 5AJGA 4DDYA 3TW8A 3UE3A 3GMWA 1FOFA 4Q0JA 2PT7A 3UO9A 4ZJ2A 4EESA 5AVFA 2YKFA 3HCYA 3ZG9B 4XT2B 2Y2KA 3C8CA 1C3BA 5CXWA 4K08A 2W1TA 1EI5A 2Y4AA 5HL6A 4BL3A 1S4RA 3E0YA 4HI4A 5MC7A 3O3VA 1SHIA 1CI9A 4F94A 2HDQA 1AXBA 4NXBA 2W3FA 3MKFA 3IXHA 3HLWA 2CC1A 1XP4A 1WYBA 3FPVA 4ZTKA 1ZHHB 1MBLA 4K91A 4EW7A 3UB9A 1IFQA 2H10A 3QP6A 3NOTC 3AGEA 3ZQ5A 1LL5A 1ODVA 2KOIA 3R7WA 2QMIA 3IXGA 1W7FA 1S1YA 5J3WA 3VP4A 3GRJA 3BJNA 1LL8A 1XFNA 5E2EA 2QHKA 3ZG7B 3VMAA 2GNXA 3A3IA 3N8RA 4EUZA 2W27A 3G6OA 4YIRA 2HGVA 1PRQA 4KZAA 4WZ5C 3WS1A 4CPKA 1K54A 2ZQAA 3O86A 4UAAA 1HLUP 4S2OA 3BQAA 5IS1A 4E3IA 2ZMFA 4P6ZM 2ZMVA 4QWOA 4NXGA 2GJ3A 1NYMA 3LFVA 1N4OA 1YMXA 2Z6CA 1T1CA 4PKYA 5FAPA 3WS4A 2ZQ9A 3HBRA 2V0WA 3GQZA 3UB6A 3IX8A 3KSGA 5DTTA 2QSFA 4WMCA 5FI6A 4E3JA 2Y2GA 1OTBA 4HOIA 4IBRA 2W3EA 3HLBA 3HREA 1ES4A 4R70A 1XA7A 1HZOA 4YNRA 4M4XA 2OLVA 4XT2A 3VP0A 2X02A 1PWGA 1BUEA 2PRFA 3I7JA 1PI4A 3TG9A 3NECA 3V3RA 1IYSA 4MNRA 3QNCA 4FD8A 5DF7A 2VKSA 2W0NA 2WKIA 2HDSA 4MLLA 2Q9MA 2M7UA 4DF6A 3OCLA 3MQ0A 3LR5A 1WYCA 1FILA 4RA7A 5F1GA 3D4UB 5JYOA 1QMFA 3ZFZA 2V2FF 2XXLA 3MZDA 4IEDA 1ONGA 2ZC4B 4R23A 1VETB 3R4KA 3KYEA 4M3KA 4S2PA 3MXSA 4Y0UA 1SDNA 2H0TA 4Y2FA 1NYYA 3IF5A 3JYIA 1JNUA 1ZG4A 4GV5A 2ZQCA 1K38A 5CHJA 4QPRA 3QP5A 5C5KA 4HH3A 1I2WA 2OWHA 1A0KA 1G5UA 2JKFA 4Q8IA 5FEGA 2Y59A 3WRTA 2K31A 4X53A 4LENA 4NEED 4I39A 4X69A 1BZAA 2MJ6A 1YLPA 2PHYA 4C3QA 5HDDA 5FA7A 3MCXA 4P85A 1DY6A 3LCEA 1AWIA 4GHIB 3F1PB 2PYPA 5HL1A 1KGFA 3N4IA 2IKDA 3CUEA 1SDEA 4QHCA 2PAVP 5HD3A 2EFUA 1ZLHB 4IUHA 4OP5A 3VOYA 5E43A 2G2WA 2K7SA 1PZPA 4EBPA 4JXWA 1D7EA 5CHUA 1I2SA 1YKDA 3FG8A 4BBUA 4S2NA 1OT6A 3ZG5A 1KE3A 1O07A 1PYYA 2ZM0A 4DJ2A 5G4ZA 3TOIA 5J4EA 1OJ5A 3DTIA 3MF0A 2M7VA 2VX8A 4Y5FA 2WZZA 4K0WA 5M18A 1MKMA 2H28A 1CI8A 2VGLS 1ZUEA 5HDCA 3RXWA 3IHAA 2EFXA 1YAXA 1TS7A 2QYBA 4R38A 4Y17A 3PBOA 1LSVA 4CLCC 4XUXA 3NDGA 5FAOA 1MY8A 5G4YA 1FSYA 4WZ4A 4S2JA 5GLBA 3B33A 4IBXA 1J9MA 4MDZA 4HP4A 3CLOA 4X55A 3HUMA 3FYZA 1LHYA 4CLCE 3C4OA 4WMCD 1BULA 1VETA 1MWTA 4LCLA 3EEHA 4GLQA 3PYPA 3AGFA 5GHZA 3K3DA 4E3NA 1P9RA 2JC7A 4EERA 2WKHA 4KENB 1P9WA 3Q81A 4GD8A 3UPPA 4PKYG 4WEJA 1S4SA 1MC0A 3VOZA 1U60A 4DE1A 4WEKA 4HBUA 4EBNA 5LBRA
chains in the Genus database with same CATH topology
3DBAA 3H7WA 2XRNA 2O9AA 3A0VA 4BWIA 4HNBA 1TD5A 4G3WA 3A0SA 3PHYA 1STZA 3KO6A 2SH1A 3EWKA 4Q0HA 4Q0IA 2JR3A 1UGUA 4R3AA 1OTAA 4BMWA 4GHIA 3F1PA 3MFXA 3W2ZA 4AFIA 3IS2B 2VJWA 3NOUC 4II7A 4WUJA 2PR5A 1TS6A 3LUQA 3O5YA 3IBJA 4H6JB 4WF0A 3UB7A 3OLOA 4EQ1A 5HWVA 2D01A 3VE3A 5A8BA 2QJ5A 4IUKA 2WKRA 1APFA 2LB5A 2VV8A 1V9YA 4R6LA 4O0PA 4G3VA 1LSXA 4RQ9A 3LIEA 3ICYA 3PBQA 1VHMA 3F1OA 4IHQA 5DFXA 3A0RA 3T4SA 3IBRA 4KUOA 3LIBA 4CQHA 4LPZA 3GDIA 1W63Q 3NHQA 3OBFA 5AJGA 2OAP1 2O9CA 3LR4A 3E4OA 3TW8A 1NWZA 3UE6A 1GSWA 1YSPA 3PBSA 3UE3A 3F1NA 3MJQA 4Q0JA 2PT7A 1AHLA 2CMNA 1NRJA 4EESA 1H3QA 1N9OA 5AVFA 2J3TD 2YKFA 3HCYA 4XT2B 3C8CA 2KDKA 4HIAA 4K08A 2W1TA 3MR0A 2W1RA 4NXFA 4BBTA 3E4PA 3PBTA 5HL6A 3LMSB 1S4RA 2PR6A 2NUPC 3E0YA 4HI4A 5MC7A 4MCWA 2P08A 1SHIA 4YWZA 3V67A 4WL9A 3FPWA 4NXBA 3K3CA 1OT9A 2W3FA 3MYVA 5IU1A 4EEPA 3LIAA 4WELA 3SW1A 1GSVA 5DFYA 2H9XA 2VEAA 4LRYC 4HJ4A 3D3OA 1NLYA 2PYRA 5F69A 1T18A 3D72A 2ZBBA 1OTDA 3FPVA 2R78A 2XA7M 1ZHHB 2PDRA 4EW7A 3CAXA 3UB9A 1IFQA 4EEUA 4JGOA 2HV1A 1DRMA 3TE8A 5DKKA 2VA0A 3UMEA 5KIZA 3PXPA 3NOTC 3ZQ5A 3LR3A 1ODVA 2KOIA 1IOUA 3VV4A 1ZLIB 3R7WA 3S7QA 3B42A 3LR0A 2J3TC 2Z6DA 1N9NA 3LIDA 3KSIA 4MN5A 1XJ4A 2JHEA 1S1YA 4HH2A 1UWPX 5J3WA 1G6OA 2JKTM 3BJNA 1LL8A 1XFNA 2V0UA 2QHKA 4EU0A 2L4RA 2BASA 5F5YA 4HY8A 2W3DA 4KQDA 4L9GA 4ZRRA 2A2LA 2OOLA 4GS9B 4ARZA 3H9WA 2GNXA 2OWJA 5HD5A 1LT0A 2INWA 2W27A 3S7NA 3G6OA 4YIRA 2HGVA 4JGRA 1X0OA 5F6AA 1Z99A 3TRCA 1P97A 2NUTC 3RFBA 3BQAA 4JGQA 1T1BA 2L1MA 5IS1A 1D6BA 4FSFA 1Y28A 2EWVA 3KYZA 2ZMFA 2QSHA 4P6ZM 3UB8A 3KEZA 2ZMVA 4NXGA 2GJ3A 4Y3IA 3IS2A 3LFVA 3CI6A 4YOFA 3JVVA 1VB6A 1BYWA 2P7JA 4H6JA 2DMWA 2Z6CA 3KX0X 1T1CA 4PKYA 1G28A 3EGDC 3KYQA 3VOLA 4ETXA 4I38A 4F3LB 2DLAA 3C2WA 2V0WA 2L0WA 4OOLA 3UB6A 4GCZA 2JN7A 3KSGA 3P01A 2QSFA 2VGLM 1GSXA 4KQOA 1YSQA 1DP8A 1OTEA 1DP6A 3FC7A 4UQIS 1H8MA 4HJ3A 1OTBA 4HOIA 2W3EA 3LICA 2K2NA 2RNGA 5HDSA 2VV6A 3T50A 4R70A 5HWWA 3EEAA 2Y79A 4YNRA 3T4TA 4M4XA 4XT2A 5TBMB 5HPIA 1S66L 3T4QA 2I9VA 3TJZC 2FZ0A 3U2AA 5HPFA 1NLZA 3EQVA 5IT5A 4I3AA 1TS0A 4JGPA 3UMDA 4LRZE 4EXOA 5K5BA 4OOMA 1BDSA 1D06A 3MQOA 4B9OA 2O99A 2VKSA 2GX5A 4MMNA 2W0NA 2A24B 3E4QA 2B02A 2HJ9C 4HJ6A 2M7UA 3RTYA 3OCLA 3MQ0A 3LR5A 2YKHA 2HJEA 4L9EA 3B47A 2GZAA 1LSWA 3D4UB 3KSFA 3KSHA 1OJGA 1F9IA 2Y8HA 2G7UA 2XXLA 3R4KA 3BW6A 3H82B 2JKTI 2V1BA 5F68A 4Y2FA 4WN5A 4CLCB 3CWFA 1P0ZA 2V9AA 3C38A 1JNUA 4NKPA 2QSGA 3ZYTA 4GV5A 4GS9A 5EFWA 3C30A 3HJKA 1N9LA 3E98A 4QPRA 2XROA 5C5KA 4PHTA 2VZWA 4HH3A 4O8GA 4GJ4A 2EWWA 4FOFA 4DN0A 2OWHA 4ETZA 2JKRM 2XA7S 1ZTUA 5CX7A 3CUEC 2W3GA 3H7WB 2K31A 2LB9A 4NEED 4LLOB 4I39A 2QKPA 2MJ6A 2O9BA 2PHYA 5DJUA 3LI8A 5HDDA 3MCXA 3EGXC 4O01A 4GHIB 3F1PB 1H5OA 2PYPA 3RH8B 3T4KA 3CITA 1F5MA 2IKDA 4GW9A 1B8WA 2B18A 3CUEA 2P04A 5DKLA 4F3LA 4L0LA 4L9FA 1XJ3A 2XSSA 3BY8A 5HD3A 3T4JA 1S1ZA 4KUKA 1S67L 1ZLHB 3MQQA 4IUHA 4EUVA 4I3JA 1TS8A 2PD8A 3F1OB 2K7SA 3VE4A 2KLIA 4CLCD 4MN6A 5L8MA 3LI9A 2MN3A 3OOVA 1D7EA 3LIFA 3NJAA 3BY9A 2IKEA 1YKDA 1WA9A 4DMZA 2J80A 3FG8A 1WQKA 3LYXA 1DP9A 1UWNX 3JVUA 4BBUA 4I3IA 1OPXA 2VLGA 1OT6A 2B9KA 2OAQ1 4P6ZS 3F1NB 3K2NA 4MN7A 5HSQA 3ULFA 3NOPC 3MXQA 5J7EA 4LRXC 2WKPA 5TBMA 4PAUA 1XJ6A 4DJ2A 4WLAA 5G4ZA 2VV7A 4ME4A 2W1TB 2V1AA 5HZHA 3BWLA 4BBVA 4EETB 5J4EA 4DJ3A 1OJ5A 2HF6A 3MF0A 5DF9A 5FL3A 2KX6A 2VX8A 2M7VA 3PBNA 4Y5FA 3T4LA 3HJIA 5KSHA 1V9ZA 4B93A 3S7OA 3PR6A 2QJ7A 1W63M 1MKMA 2H28A 3GECA 1SH1A 2O0YA 2VGLS 1F98A 2J3WA 1ZUEA 5HDCA 4UEYA 1YAXA 2EA9A 4I5SA 1TS7A 2PD7A 2A24A 4E04A 2QYBA 1EW0A 3OCNA 4R38A 2K2XA 1TF1A 3PBOA 1LSVA 3BQ8A 4CLCC 2ZOIA 5AVEA 1T1AA 5G4YA 3B33A 5I5LA 1OTIA 2WKQA 4MDZA 1XJ2A 2IA2A 4HP4A 3CLOA 1XFQA 1ZUFA 3PBRA 4CLCE 3MMHA 3R7WB 2ZOHA 2D02A 2M1CA 3H82A 4HP9A 3EEHA 2MUBA 4GLQA 1MZUA 3PYPA 1KOUA 3S7PA 3K3DA 4CLCA 4HHDA 1P9RA 4EERA 4Z1WA 4BJPA 5DJTA 4IJGA 1P9WA 1ATXA 2QWSA 4NXEA 2BDSA 4ARZB 4PKYG 3T4OA 1WXNA 4HQAA 1T19A 5HWTA 4WEJA 1S4SA 3P7NA 5TJJA 2JTOA 2JKRI 3EOIA 3OC2A 1MC0A 3EQUA 4G3KA 4WEKA 2FH5A 2W3HA 5LBRA 4UQIM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZHH B;  3C38 A;  3C30 A;  2HJ9 C;  2HJE A; 
#chains in the Genus database with same CATH topology
 3DBA A;  3P98 A;  3G4P A;  1TD5 A;  4G3W A;  3A0S A;  1PNE A;  3KO6 A;  3SH7 A;  4Q0I A;  2ZQ7 A;  4R3A A;  4GHI A;  3S4X A;  3F1P A;  5KMW A;  4MEZ A;  1ESU A;  2JCH A;  3NOU C;  4KZ4 A;  1MKI A;  1JVJ A;  1TS6 A;  3UB7 A;  1BLP A;  2Y91 A;  1GHM A;  3VE3 A;  2ZC3 B;  4RX2 A;  5GHY A;  5HAQ A;  2VV8 A;  1V9Y A;  4O0P A;  4G3V A;  1H5X A;  3LIE A;  4IHQ A;  1QME A;  3MBZ A;  1NRF A;  4FH4 A;  3IH9 A;  4CQH A;  4E3O A;  1W5D A;  3GDI A;  1W63 Q;  3OBF A;  5HAI A;  3SZT A;  1ERQ A;  3LR4 A;  2XD5 A;  1BLH A;  2ZD8 A;  4EV4 A;  4X1L A;  1NRJ A;  1H3Q A;  2EX6 A;  3BEC A;  5CRF A;  2KDK A;  4HIA A;  3LEZ A;  2W1R A;  4NXF A;  5TFQ A;  3E4P A;  3A3F A;  2PR6 A;  3N7W A;  2IWB A;  4JF4 A;  3FPW A;  1NXY A;  3LIA A;  5AQB A;  3BFE A;  4GDB A;  1GSV A;  5DFY A;  3MSH A;  4LRY C;  4OP8 A;  4N1H A;  2IWC A;  2H0Y A;  2PYR A;  2V1Z A;  1OTD A;  2ZBB A;  2BLS A;  1XGJ A;  4MBF A;  2J7V A;  1L0E A;  2HV1 A;  3TSG A;  2VA0 A;  5KIZ A;  3N8L A;  4MBH A;  1IYQ A;  1IOU A;  3VV4 A;  3PAG A;  3G32 A;  2R9X A;  3B42 A;  3LR0 A;  1XPB A;  3NY4 A;  2ZC7 A;  1G6A A;  2JHE A;  3GSG A;  4HH2 A;  1UWP X;  1KVM A;  3DTE A;  2XH9 A;  2JKT M;  4E6W A;  2P9V B;  3GV9 A;  3LY4 A;  2L4R A;  2BAS A;  2OSU A;  4KQR A;  4L9G A;  5HW3 A;  2OOL A;  4GS9 B;  2WAF A;  3H9W A;  5AQ9 A;  2OWJ A;  3SS3 A;  4X1M A;  1RCJ A;  1X0O A;  1CEG A;  4Y15 A;  5F6A A;  3TRC A;  2NUT C;  3E2L A;  4QY6 A;  3OPH A;  3KYZ A;  2ACG A;  2QSH A;  3UB8 A;  3KEZ A;  5FQ9 A;  3G2Y A;  4Y3I A;  2WKE A;  5DF8 A;  5GLC A;  4DXC A;  4ESP A;  2AVX A;  2P7J A;  4WZ5 A;  4ZBE A;  3KX0 X;  4KQQ A;  3HLE A;  3IX3 A;  4N1X A;  2DLA A;  4F3L B;  2A3U A;  4OQ0 A;  3P01 A;  2VGL M;  4NG2 A;  1GSX A;  3JPU A;  5FAS A;  1D1J A;  1NJ4 A;  2C6W B;  4JXS A;  3NI9 A;  3FC7 A;  3G34 A;  1JWV A;  5HDS A;  4NET A;  5EUA A;  3T50 A;  5HWW A;  5E2G A;  4OPY A;  2Q0O A;  3WWX A;  2XGN A;  5TBM B;  3SH8 A;  2XFT A;  3T4Q A;  1FCN A;  3IF4 A;  5G18 A;  2B5R A;  1IEL A;  4GDN A;  3G31 A;  2OLU A;  5HPF A;  3EQV A;  1L0G A;  1M6K A;  3BLM A;  5EVE A;  5L10 A;  4N9L A;  4KZ3 A;  1NY0 A;  1K4E A;  2GZA A;  3O88 A;  3KSH A;  2ZC6 B;  3SOI A;  5M1A A;  3IX4 A;  1K57 C;  2JKT I;  3BFG A;  5F68 A;  2A49 A;  5FI7 A;  4CLC B;  2P9V A;  2V9A A;  5FQK A;  4FTX A;  2GDN A;  2PU4 A;  3GTC A;  4NKP A;  2QSG A;  4GS9 A;  1KDW A;  2C5W B;  1PFL A;  1Y4O A;  2XRO A;  1BLC A;  1Q2Q A;  4DN0 A;  2WUQ A;  5F1F A;  5J8X A;  4YIN A;  1ES5 A;  1VM1 A;  1W79 A;  2W3G A;  1BT5 A;  2LB9 A;  3S22 A;  1BTL A;  3ZG0 A;  1PW8 A;  4OPR A;  3LEQ A;  4CJN A;  2O9B A;  2WGW B;  2ZM2 A;  2R9W A;  3EGX C;  2EXB A;  3SS4 A;  4LFU A;  2BG1 A;  4O01 A;  4BQM A;  1K4F A;  1YLJ A;  4GW9 A;  2B18 A;  3Q07 A;  2P04 A;  5M19 A;  5DKL A;  4F3L A;  2RCX A;  4L9F A;  5A92 A;  3T4J A;  4KUK A;  1S67 L;  1JTD A;  4KG2 A;  3PAE A;  4EUV A;  1TS8 A;  2Y2Q A;  3Q1F A;  3F1O B;  5CTN A;  3RXX A;  3HVF A;  2KLI A;  1YLW A;  4MN6 A;  3LI9 A;  4PM7 A;  3BY9 A;  2IKE A;  2XK1 A;  2OV5 A;  1TVF A;  4DMZ A;  4E3L A;  2J80 A;  1WQK A;  3LYX A;  3UY6 A;  1UWN X;  3JVU A;  2VLG A;  2B9K A;  2HDR A;  2OAQ 1;  3F1N B;  3K2N A;  3PTE A;  4DE0 A;  3ULF A;  3NOP C;  4LRX C;  5TBM A;  3T12 B;  3M6H A;  1XJ6 A;  4WLA A;  2VV7 A;  3IQA A;  4ME4 A;  1LL9 A;  3BWL A;  5EV0 A;  4EET B;  3UB5 P;  1XXM A;  2UV0 E;  3T4L A;  5KSH A;  5GLD A;  3S7O A;  3NCK A;  2QJ7 A;  3GEC A;  1SH1 A;  2WYX A;  3Q7V B;  2XLN A;  1PWC A;  1ERM A;  4UEY A;  2EA9 A;  1EW0 A;  2K2X A;  4O7D A;  5FAT A;  5TR7 A;  3SH9 A;  2ZOI A;  3C7U A;  5CGS A;  3ZNT A;  3LGO A;  1OME A;  1XJ2 A;  4LV2 A;  1XFQ A;  1ZUF A;  1PWD A;  3WRZ A;  4PM5 A;  3PBR A;  2D02 A;  4HP9 A;  4PPR A;  4R1G A;  1MZU A;  4EBL A;  4CLC A;  1ATX A;  4OON A;  3IF6 C;  2G2U A;  4HQA A;  1T19 A;  3P7N A;  5TJJ A;  5DVA A;  3BEB A;  5EEC A;  3OC2 A;  3BFC A;  2W3H A;  5CHM A;  2XRN A;  3BM6 A;  4BWI A;  2HP5 A;  3ZHH A;  2V8F A;  4JKT A;  4A5R A;  4QY5 A;  5I94 A;  1STZ A;  1RGY A;  2WGW A;  4WBG A;  3Q7Z A;  3ZDJ A;  4Q0H A;  3ZGA B;  4KZ8 A;  3MFX A;  4AFI A;  1GA0 A;  2B95 A;  4II7 A;  3LUQ A;  1G68 A;  3O5Y A;  3B3X A;  1K25 A;  3OLO A;  2ZQ8 A;  2D01 A;  5A8B A;  5EVI B;  3DWK A;  1GA9 A;  4RQ9 A;  1PI5 A;  1VHM A;  1KE0 A;  3F1O A;  4OH0 A;  3P09 A;  2OAP 1;  2O9C A;  3E4O A;  1J3W A;  1ZKJ A;  1NWZ A;  1YM1 A;  4X56 A;  3UE6 A;  1YSP A;  3PBS A;  3F1N A;  3MJQ A;  4P6B A;  2CMN A;  1N9O A;  2J3T D;  1XGI A;  3CPT B;  5CGW A;  4BBT A;  1SZV A;  3PBT A;  2EX2 A;  4U3T A;  3G2Z A;  3LMS B;  3MFD A;  4LGW A;  3G30 A;  1YQS A;  4YWZ A;  4WL9 A;  5F82 A;  1O7E A;  1ES3 A;  1OT9 A;  3VFH A;  3Q7V A;  5IU1 A;  4EEP A;  1GL9 B;  4WEL A;  5FI2 A;  4EWF A;  1WE4 A;  2H9X A;  4HJ4 A;  5FQI A;  1F2K A;  4Z9Q A;  3NC8 A;  3S1Y A;  3D72 A;  2R78 A;  2E8I A;  4LCM A;  3QHY A;  3ITB A;  1W8Q A;  2PDR A;  3CAX A;  4EEU A;  4JGO A;  3TE8 A;  5DKK A;  3N6I A;  1YT4 A;  2HPB A;  3LR3 A;  4MBK A;  2WGV A;  4HBT A;  1ZLI B;  5HAP A;  1DJB A;  3S7Q A;  2Z6D A;  3BFD A;  1N9N A;  3LID A;  4MN5 A;  1XJ4 A;  2Y2H A;  1XKZ A;  1IKG A;  2V0U A;  4X68 A;  1CQA A;  3FV7 A;  4XXR A;  4EU0 A;  4YFM A;  3FZC A;  4KQD A;  4Y13 A;  4ZRR A;  4LV0 A;  4JXG A;  1TDG A;  3O87 A;  4FUW A;  3ZVW A;  4GN2 A;  3S7N A;  4JGR A;  5E2F A;  2DCF A;  4ZDX A;  4E3K A;  5CED A;  1P97 A;  4JGQ A;  1T1B A;  2L1M A;  2DNS A;  1D6B A;  4FSF A;  1Y28 A;  5A90 A;  2EWV A;  4X6T A;  1YLY A;  2X71 A;  4ZJ1 A;  3QNB A;  3ZVT A;  2QZ6 A;  4YOF A;  1VB6 A;  2HP9 A;  3OPR A;  2DMW A;  1K56 A;  3HUN A;  3EGD C;  1K6R A;  5EVI A;  3VOL A;  3T1S A;  2XEP A;  4ETX A;  4R3J A;  3C2W A;  1KE4 A;  2WAD A;  4DRT A;  1ZG6 A;  5GLA A;  1SKO B;  4KQO A;  1DP8 A;  1DP6 A;  4ZAM A;  4UQI S;  1H8M A;  4HJ3 A;  5GHX A;  2K2N A;  4N92 A;  3NIA A;  1GKU B;  1FIK A;  2VV6 A;  3FWL A;  3T4T A;  3VSL A;  1MXO A;  5E2H A;  4OPQ A;  3W8K A;  3CPT A;  4OPZ A;  3IWI A;  2Q9N A;  5HPI A;  3M2K A;  1S66 L;  3ZCZ A;  4FH2 A;  4JPM A;  2I9V A;  3MZF A;  4QB8 A;  3TJZ C;  2FZ0 A;  1I5Q A;  1NLZ A;  5IT5 A;  4ZJ3 A;  1TS0 A;  3QP4 A;  1HTZ A;  3UMD A;  3SS5 A;  4KG5 A;  5K5B A;  4OOM A;  1D06 A;  3MQO A;  2O99 A;  4DKI A;  4R0Q A;  4KZ6 A;  1DJA A;  5GL9 A;  2B02 A;  4UA6 A;  2HJ9 C;  1K55 C;  2UWX A;  3C7V A;  1FCM A;  4H8R A;  4NK3 A;  2HJE A;  4L9E A;  3A3D A;  3NDE A;  3U4L P;  3BFF A;  1LSW A;  1OJG A;  1F9I A;  2G7U A;  1TDL A;  3NUL A;  5EOE A;  4DXB A;  3H82 B;  3A3E A;  1PW1 A;  1IEM A;  4B4Z A;  1P0Z A;  1YLT A;  1H8Y A;  3C38 A;  3IXD A;  3ZNY A;  1ACF A;  5HX9 A;  3ZYT A;  5EFW A;  3HUO A;  5EE8 A;  5FEF A;  3E98 A;  2PU2 A;  1RP5 A;  4PHT A;  4O8G A;  4GJ4 A;  2EWW A;  2Y55 A;  3BYD A;  4FOF A;  2Z2M B;  4ETZ A;  1K57 A;  3M6B A;  3DW0 A;  1DJC A;  1S6R A;  2XA7 S;  5CX7 A;  2EX9 A;  2J8Y A;  2ZMA A;  3H7W B;  1YLZ A;  2QKP A;  1ONH A;  4GKU A;  4E6X A;  5TGF A;  3IF6 B;  5JYP A;  3MZE A;  1H5O A;  3T4K A;  1B8W A;  1PZO A;  4L0L A;  2Z2L B;  5IHV A;  2XSS A;  3FKW A;  1SKO A;  4I3J A;  1H8Z A;  4PMA A;  5L8M A;  3LIF A;  3NJA A;  1WA9 A;  3HLG A;  3VP2 A;  4I3I A;  1OPX A;  3UN7 A;  4MN7 A;  5HSQ A;  5D3O A;  5AQA A;  2Y2P A;  3MXQ A;  3UDX A;  3WS0 A;  2V1A A;  1MWU A;  4DJ3 A;  2Y2L A;  2HF6 A;  1IYO A;  1FSW A;  3PBN A;  1Y54 A;  1TEM A;  3HJI A;  4JBF A;  1NZU A;  3IWQ A;  3PR6 A;  1W63 M;  1GCE A;  2O0Y A;  2DRW A;  4R4R A;  3UE0 A;  2PD7 A;  2XD1 A;  3OCN A;  1L0D A;  4PM8 A;  1TF1 A;  1JTG A;  3L7H A;  5A93 A;  1T1A A;  2EX8 A;  1K56 D;  1E4D A;  3UDI A;  5EVI D;  1OTI A;  1Q2P A;  1W8Y A;  2IA2 A;  1FR6 A;  4QJG A;  3MMH A;  2ZOH A;  4Y0T A;  2M1C A;  3H82 A;  3W4O A;  1SCW A;  1XX2 A;  4IVK A;  3S7P A;  1JWZ A;  2WAE A;  4D2O A;  4HHD A;  5AQ7 A;  2VGJ A;  2XFS A;  2QWS A;  4NXE A;  2XDM A;  4QD4 A;  1ALQ A;  2JBF A;  1ERO A;  4ARZ B;  1LI0 A;  1XA1 A;  2ZM8 A;  3EOI A;  5L07 A;  3EQU A;  3ZG8 B;  2VGK A;  2FH5 A;  2Y2O A;  4UQI M;  3H7W A;  1H0M A;  1VEU B;  3D4F A;  3A0V A;  4JF5 A;  3L9K A;  5CEB A;  4HNB A;  3T1R A;  4UA9 A;  3IF6 A;  2SH1 A;  2ZC5 B;  3EWK A;  5EM1 A;  1MWR A;  2WK0 A;  4JLF A;  2JR3 A;  4WYY A;  3RJU A;  4BEN A;  3W2Z A;  3IS2 B;  4E3M A;  1GHP A;  2ZL1 B;  5EPH A;  4WUJ A;  2PR5 A;  4WF0 A;  3IBJ A;  4H6J B;  4P87 A;  4OOY A;  4IUK A;  3MXR A;  3IXB A;  3BLS A;  2LB5 A;  3V50 A;  5HAR A;  1LSX A;  1CJF A;  1S0W A;  3PBQ A;  2HDU A;  5DFX A;  2J9O A;  2Y2J A;  3A0R A;  3IBR A;  3LIB A;  1JWP A;  3DAV A;  5FDS A;  4RYE A;  5A91 A;  4S2K A;  1L3L A;  1GSW A;  1EWZ A;  1RGZ A;  5CTM A;  1AHL A;  3E2K A;  4GD6 A;  3UPN A;  4BD1 A;  3WS5 A;  5BOH A;  3MR0 A;  3WS2 A;  2NUP C;  1LI9 A;  4MCW A;  1E3U A;  2P08 A;  3V67 A;  3K3C A;  2ZQD A;  3MYV A;  2BTF P;  1NZO A;  3SW1 A;  1K0K A;  1L0F A;  2VEA A;  4B4X A;  3D3O A;  1NLY A;  3CJM A;  1T18 A;  5F69 A;  2XA7 M;  1CF0 A;  4OLD A;  1DRM A;  4GZB A;  1K6S A;  4HES A;  4Y0O A;  3VP3 A;  3UME A;  2ZLY A;  3PXP A;  5EVL A;  1EL6 A;  4DE3 A;  3W4Q A;  3IT9 A;  3MS6 A;  5FQQ A;  2J3T C;  1ZC2 A;  1K54 C;  3KSI A;  2FFY A;  1G6O A;  4BD0 A;  3V3S A;  2Y2M A;  1KGG A;  2V20 A;  5F5Y A;  2WZX A;  4HY8 A;  2W3D A;  4OVD A;  4GB7 A;  4ARZ A;  2A2L A;  3UDF A;  5HD5 A;  1LT0 A;  2INW A;  5CEC A;  3DTM A;  3HLD A;  3CMZ A;  1Z99 A;  1VEU A;  3G35 A;  3OZH A;  3RFB A;  3IH8 A;  4UA7 A;  5KZH A;  4D60 A;  2XR0 A;  3IS2 A;  3CI6 A;  3NBL A;  2ZL1 A;  3JVV A;  4C75 A;  1BYW A;  4H6J A;  2X01 A;  1G28 A;  2RL3 A;  4B88 A;  3KYQ A;  4I38 A;  5CER A;  3MKE A;  2L0W A;  4OOL A;  4GCZ A;  1CK3 A;  1ESI A;  2JN7 A;  3C5A A;  5KSC A;  1KVL A;  1YSQ A;  1VQQ A;  1M40 A;  1OTE A;  4BL2 A;  1YPR A;  3LIC A;  2RNG A;  3V39 A;  5FDH A;  3EEA A;  2Y79 A;  4KZ5 A;  3CHW P;  1PIO A;  1FR1 A;  4C6Y A;  3UNW A;  1KGE A;  3IWO A;  2Y2N A;  3U2A A;  1MWS A;  4RVA A;  1YMS A;  4ID4 A;  4I3A A;  2HP6 A;  4JGP A;  4KZ7 A;  4LRZ E;  4EXO A;  1BDS A;  1IYP A;  4B9O A;  2HZ5 A;  4JXV A;  4MMN A;  2GX5 A;  3C4P A;  1ES2 A;  2A24 B;  3E4Q A;  4HJ6 A;  2V8C A;  3RTY A;  4S2I A;  4KZB A;  2IWD A;  2YKH A;  2E8J A;  3B47 A;  2QPN A;  4OQG A;  3KSF A;  1GHI A;  2Y8H A;  3ITA A;  1E25 A;  2XQZ A;  2JE5 A;  3BW6 A;  5DTK A;  4K0X A;  2V1B A;  4EQI A;  1BLS A;  1K55 A;  5FAQ A;  4WN5 A;  3CWF A;  3GR2 A;  3UE1 A;  4GNU A;  3QP2 A;  3C30 A;  2J9P A;  3HJK A;  1N9L A;  2VZW A;  4WM9 A;  1HD8 A;  1Z6F A;  4DE2 A;  3DWZ A;  2JKR M;  4KZ9 A;  1ZTU A;  3CUE C;  1FQG A;  4LLO B;  1E3U D;  3CG5 A;  1SHV A;  5DJU A;  3T1X A;  3LI8 A;  5FSR A;  3QP1 A;  3OPL A;  3RH8 B;  3CIT A;  2P74 A;  3HLF A;  1F5M A;  5L2F A;  4S2N C;  1XJ3 A;  3BY8 A;  1S1Z A;  3MQQ A;  2PD8 A;  2WGI A;  4HEF A;  1N9B A;  4JF6 A;  3VE4 A;  4X25 A;  4CLC D;  3LY3 A;  2MN3 A;  3OOV A;  4RX3 A;  4OKP A;  4S2M A;  4FCF A;  3ISG A;  2EXA A;  4XUZ A;  2ZJ9 A;  1DP9 A;  3VSK A;  4LV1 A;  2JKG A;  4P6Z S;  3AGD A;  1MPL A;  5J7E A;  2WKP A;  4PAU A;  4DDS A;  2W1T B;  5HZH A;  4BBV A;  5DF9 A;  5FL3 A;  2KX6 A;  4R3B A;  3LO7 A;  1V9Z A;  5FQM A;  4B93 A;  5F83 A;  3Q82 A;  4QU3 A;  4N9K A;  4U0X A;  4OQI A;  1F98 A;  2J3W A;  2H5S A;  2PBD P;  4IVI A;  3VFF A;  4I5S A;  4E04 A;  2A24 A;  5FQJ A;  3BQ8 A;  5AVE A;  2XF3 A;  4UHU A;  5EM0 A;  5I5L A;  2WKQ A;  4U0T A;  1BSG A;  3FKV A;  3R7W B;  5L09 A;  3DTK A;  2MUB A;  4OLG A;  1KOU A;  1HVB A;  3W4P A;  3T1Q B;  3HLC A;  4Z1W A;  4BJP A;  5DJT A;  4IJG A;  3IHB A;  5CGX A;  3N8S A;  2PBY A;  2BDS A;  3T4O A;  1WXN A;  3VP1 A;  4LV3 A;  5HWT A;  4OQH A;  2JTO A;  3OPP A;  3V5M A;  1FCO A;  2JKR I;  4S2L A;  3CZD A;  4G3K A;  3QP8 A;  3M2J A;  5HFO A;  2O9A A;  5U47 A;  4BLM A;  4KG6 A;  1Z09 A;  5EVI C;  2I72 A;  3PHY A;  5EOO A;  5DTS A;  4GOG A;  2FFF B;  3BRM A;  1CEF A;  1UGU A;  4Y7P A;  1OTA A;  4BMW A;  1SKF A;  2VJW A;  1LLB A;  2VK3 A;  3D9Y A;  4EQ1 A;  5HWV A;  4PM9 A;  4P0M A;  2QJ5 A;  1L2S A;  3A3J A;  2WKR A;  1APF A;  4R6L A;  3UPO A;  1IKI A;  3ICY A;  4PM6 A;  1KDS A;  3GVB A;  3T4S A;  4KUO A;  2Y2I A;  4LPZ A;  3HL9 A;  3NHQ A;  4R4S A;  5AJG A;  4DDY A;  3TW8 A;  3UE3 A;  3GMW A;  1FOF A;  4Q0J A;  2PT7 A;  3UO9 A;  4ZJ2 A;  4EES A;  5AVF A;  2YKF A;  3HCY A;  3ZG9 B;  4XT2 B;  2Y2K A;  3C8C A;  1C3B A;  5CXW A;  4K08 A;  2W1T A;  1EI5 A;  2Y4A A;  5HL6 A;  4BL3 A;  1S4R A;  3E0Y A;  4HI4 A;  5MC7 A;  3O3V A;  1SHI A;  1CI9 A;  4F94 A;  2HDQ A;  1AXB A;  4NXB A;  2W3F A;  3MKF A;  3IXH A;  3HLW A;  2CC1 A;  1XP4 A;  1WYB A;  3FPV A;  4ZTK A;  1ZHH B;  1MBL A;  4K91 A;  4EW7 A;  3UB9 A;  1IFQ A;  2H10 A;  3QP6 A;  3NOT C;  3AGE A;  3ZQ5 A;  1LL5 A;  1ODV A;  2KOI A;  3R7W A;  2QMI A;  3IXG A;  1W7F A;  1S1Y A;  5J3W A;  3VP4 A;  3GRJ A;  3BJN A;  1LL8 A;  1XFN A;  5E2E A;  2QHK A;  3ZG7 B;  3VMA A;  2GNX A;  3A3I A;  3N8R A;  4EUZ A;  2W27 A;  3G6O A;  4YIR A;  2HGV A;  1PRQ A;  4KZA A;  4WZ5 C;  3WS1 A;  4CPK A;  1K54 A;  2ZQA A;  3O86 A;  4UAA A;  1HLU P;  4S2O A;  3BQA A;  5IS1 A;  4E3I A;  2ZMF A;  4P6Z M;  2ZMV A;  4QWO A;  4NXG A;  2GJ3 A;  1NYM A;  3LFV A;  1N4O A;  1YMX A;  2Z6C A;  1T1C A;  4PKY A;  5FAP A;  3WS4 A;  2ZQ9 A;  3HBR A;  2V0W A;  3GQZ A;  3UB6 A;  3IX8 A;  3KSG A;  5DTT A;  2QSF A;  4WMC A;  5FI6 A;  4E3J A;  2Y2G A;  1OTB A;  4HOI A;  4IBR A;  2W3E A;  3HLB A;  3HRE A;  1ES4 A;  4R70 A;  1XA7 A;  1HZO A;  4YNR A;  4M4X A;  2OLV A;  4XT2 A;  3VP0 A;  2X02 A;  1PWG A;  1BUE A;  2PRF A;  3I7J A;  1PI4 A;  3TG9 A;  3NEC A;  3V3R A;  1IYS A;  4MNR A;  3QNC A;  4FD8 A;  5DF7 A;  2VKS A;  2W0N A;  2WKI A;  2HDS A;  4MLL A;  2Q9M A;  2M7U A;  4DF6 A;  3OCL A;  3MQ0 A;  3LR5 A;  1WYC A;  1FIL A;  4RA7 A;  5F1G A;  3D4U B;  5JYO A;  1QMF A;  3ZFZ A;  2V2F F;  2XXL A;  3MZD A;  4IED A;  1ONG A;  2ZC4 B;  4R23 A;  1VET B;  3R4K A;  3KYE A;  4M3K A;  4S2P A;  3MXS A;  4Y0U A;  1SDN A;  2H0T A;  4Y2F A;  1NYY A;  3IF5 A;  3JYI A;  1JNU A;  1ZG4 A;  4GV5 A;  2ZQC A;  1K38 A;  5CHJ A;  4QPR A;  3QP5 A;  5C5K A;  4HH3 A;  1I2W A;  2OWH A;  1A0K A;  1G5U A;  2JKF A;  4Q8I A;  5FEG A;  2Y59 A;  3WRT A;  2K31 A;  4X53 A;  4LEN A;  4NEE D;  4I39 A;  4X69 A;  1BZA A;  2MJ6 A;  1YLP A;  2PHY A;  4C3Q A;  5HDD A;  5FA7 A;  3MCX A;  4P85 A;  1DY6 A;  3LCE A;  1AWI A;  4GHI B;  3F1P B;  2PYP A;  5HL1 A;  1KGF A;  3N4I A;  2IKD A;  3CUE A;  1SDE A;  4QHC A;  2PAV P;  5HD3 A;  2EFU A;  1ZLH B;  4IUH A;  4OP5 A;  3VOY A;  5E43 A;  2G2W A;  2K7S A;  1PZP A;  4EBP A;  4JXW A;  1D7E A;  5CHU A;  1I2S A;  1YKD A;  3FG8 A;  4BBU A;  4S2N A;  1OT6 A;  3ZG5 A;  1KE3 A;  1O07 A;  1PYY A;  2ZM0 A;  4DJ2 A;  5G4Z A;  3TOI A;  5J4E A;  1OJ5 A;  3DTI A;  3MF0 A;  2M7V A;  2VX8 A;  4Y5F A;  2WZZ A;  4K0W A;  5M18 A;  1MKM A;  2H28 A;  1CI8 A;  2VGL S;  1ZUE A;  5HDC A;  3RXW A;  3IHA A;  2EFX A;  1YAX A;  1TS7 A;  2QYB A;  4R38 A;  4Y17 A;  3PBO A;  1LSV A;  4CLC C;  4XUX A;  3NDG A;  5FAO A;  1MY8 A;  5G4Y A;  1FSY A;  4WZ4 A;  4S2J A;  5GLB A;  3B33 A;  4IBX A;  1J9M A;  4MDZ A;  4HP4 A;  3CLO A;  4X55 A;  3HUM A;  3FYZ A;  1LHY A;  4CLC E;  3C4O A;  4WMC D;  1BUL A;  1VET A;  1MWT A;  4LCL A;  3EEH A;  4GLQ A;  3PYP A;  3AGF A;  5GHZ A;  3K3D A;  4E3N A;  1P9R A;  2JC7 A;  4EER A;  2WKH A;  4KEN B;  1P9W A;  3Q81 A;  4GD8 A;  3UPP A;  4PKY G;  4WEJ A;  1S4S A;  1MC0 A;  3VOZ A;  1U60 A;  4DE1 A;  4WEK A;  4HBU A;  4EBN A;  5LBR A; 
#chains in the Genus database with same CATH homology
 3DBA A;  3H7W A;  2XRN A;  2O9A A;  3A0V A;  4BWI A;  4HNB A;  1TD5 A;  4G3W A;  3A0S A;  3PHY A;  1STZ A;  3KO6 A;  2SH1 A;  3EWK A;  4Q0H A;  4Q0I A;  2JR3 A;  1UGU A;  4R3A A;  1OTA A;  4BMW A;  4GHI A;  3F1P A;  3MFX A;  3W2Z A;  4AFI A;  3IS2 B;  2VJW A;  3NOU C;  4II7 A;  4WUJ A;  2PR5 A;  1TS6 A;  3LUQ A;  3O5Y A;  3IBJ A;  4H6J B;  4WF0 A;  3UB7 A;  3OLO A;  4EQ1 A;  5HWV A;  2D01 A;  3VE3 A;  5A8B A;  2QJ5 A;  4IUK A;  2WKR A;  1APF A;  2LB5 A;  2VV8 A;  1V9Y A;  4R6L A;  4O0P A;  4G3V A;  1LSX A;  4RQ9 A;  3LIE A;  3ICY A;  3PBQ A;  1VHM A;  3F1O A;  4IHQ A;  5DFX A;  3A0R A;  3T4S A;  3IBR A;  4KUO A;  3LIB A;  4CQH A;  4LPZ A;  3GDI A;  1W63 Q;  3NHQ A;  3OBF A;  5AJG A;  2OAP 1;  2O9C A;  3LR4 A;  3E4O A;  3TW8 A;  1NWZ A;  3UE6 A;  1GSW A;  1YSP A;  3PBS A;  3UE3 A;  3F1N A;  3MJQ A;  4Q0J A;  2PT7 A;  1AHL A;  2CMN A;  1NRJ A;  4EES A;  1H3Q A;  1N9O A;  5AVF A;  2J3T D;  2YKF A;  3HCY A;  4XT2 B;  3C8C A;  2KDK A;  4HIA A;  4K08 A;  2W1T A;  3MR0 A;  2W1R A;  4NXF A;  4BBT A;  3E4P A;  3PBT A;  5HL6 A;  3LMS B;  1S4R A;  2PR6 A;  2NUP C;  3E0Y A;  4HI4 A;  5MC7 A;  4MCW A;  2P08 A;  1SHI A;  4YWZ A;  3V67 A;  4WL9 A;  3FPW A;  4NXB A;  3K3C A;  1OT9 A;  2W3F A;  3MYV A;  5IU1 A;  4EEP A;  3LIA A;  4WEL A;  3SW1 A;  1GSV A;  5DFY A;  2H9X A;  2VEA A;  4LRY C;  4HJ4 A;  3D3O A;  1NLY A;  2PYR A;  5F69 A;  1T18 A;  3D72 A;  2ZBB A;  1OTD A;  3FPV A;  2R78 A;  2XA7 M;  1ZHH B;  2PDR A;  4EW7 A;  3CAX A;  3UB9 A;  1IFQ A;  4EEU A;  4JGO A;  2HV1 A;  1DRM A;  3TE8 A;  5DKK A;  2VA0 A;  3UME A;  5KIZ A;  3PXP A;  3NOT C;  3ZQ5 A;  3LR3 A;  1ODV A;  2KOI A;  1IOU A;  3VV4 A;  1ZLI B;  3R7W A;  3S7Q A;  3B42 A;  3LR0 A;  2J3T C;  2Z6D A;  1N9N A;  3LID A;  3KSI A;  4MN5 A;  1XJ4 A;  2JHE A;  1S1Y A;  4HH2 A;  1UWP X;  5J3W A;  1G6O A;  2JKT M;  3BJN A;  1LL8 A;  1XFN A;  2V0U A;  2QHK A;  4EU0 A;  2L4R A;  2BAS A;  5F5Y A;  4HY8 A;  2W3D A;  4KQD A;  4L9G A;  4ZRR A;  2A2L A;  2OOL A;  4GS9 B;  4ARZ A;  3H9W A;  2GNX A;  2OWJ A;  5HD5 A;  1LT0 A;  2INW A;  2W27 A;  3S7N A;  3G6O A;  4YIR A;  2HGV A;  4JGR A;  1X0O A;  5F6A A;  1Z99 A;  3TRC A;  1P97 A;  2NUT C;  3RFB A;  3BQA A;  4JGQ A;  1T1B A;  2L1M A;  5IS1 A;  1D6B A;  4FSF A;  1Y28 A;  2EWV A;  3KYZ A;  2ZMF A;  2QSH A;  4P6Z M;  3UB8 A;  3KEZ A;  2ZMV A;  4NXG A;  2GJ3 A;  4Y3I A;  3IS2 A;  3LFV A;  3CI6 A;  4YOF A;  3JVV A;  1VB6 A;  1BYW A;  2P7J A;  4H6J A;  2DMW A;  2Z6C A;  3KX0 X;  1T1C A;  4PKY A;  1G28 A;  3EGD C;  3KYQ A;  3VOL A;  4ETX A;  4I38 A;  4F3L B;  2DLA A;  3C2W A;  2V0W A;  2L0W A;  4OOL A;  3UB6 A;  4GCZ A;  2JN7 A;  3KSG A;  3P01 A;  2QSF A;  2VGL M;  1GSX A;  4KQO A;  1YSQ A;  1DP8 A;  1OTE A;  1DP6 A;  3FC7 A;  4UQI S;  1H8M A;  4HJ3 A;  1OTB A;  4HOI A;  2W3E A;  3LIC A;  2K2N A;  2RNG A;  5HDS A;  2VV6 A;  3T50 A;  4R70 A;  5HWW A;  3EEA A;  2Y79 A;  4YNR A;  3T4T A;  4M4X A;  4XT2 A;  5TBM B;  5HPI A;  1S66 L;  3T4Q A;  2I9V A;  3TJZ C;  2FZ0 A;  3U2A A;  5HPF A;  1NLZ A;  3EQV A;  5IT5 A;  4I3A A;  1TS0 A;  4JGP A;  3UMD A;  4LRZ E;  4EXO A;  5K5B A;  4OOM A;  1BDS A;  1D06 A;  3MQO A;  4B9O A;  2O99 A;  2VKS A;  2GX5 A;  4MMN A;  2W0N A;  2A24 B;  3E4Q A;  2B02 A;  2HJ9 C;  4HJ6 A;  2M7U A;  3RTY A;  3OCL A;  3MQ0 A;  3LR5 A;  2YKH A;  2HJE A;  4L9E A;  3B47 A;  2GZA A;  1LSW A;  3D4U B;  3KSF A;  3KSH A;  1OJG A;  1F9I A;  2Y8H A;  2G7U A;  2XXL A;  3R4K A;  3BW6 A;  3H82 B;  2JKT I;  2V1B A;  5F68 A;  4Y2F A;  4WN5 A;  4CLC B;  3CWF A;  1P0Z A;  2V9A A;  3C38 A;  1JNU A;  4NKP A;  2QSG A;  3ZYT A;  4GV5 A;  4GS9 A;  5EFW A;  3C30 A;  3HJK A;  1N9L A;  3E98 A;  4QPR A;  2XRO A;  5C5K A;  4PHT A;  2VZW A;  4HH3 A;  4O8G A;  4GJ4 A;  2EWW A;  4FOF A;  4DN0 A;  2OWH A;  4ETZ A;  2JKR M;  2XA7 S;  1ZTU A;  5CX7 A;  3CUE C;  2W3G A;  3H7W B;  2K31 A;  2LB9 A;  4NEE D;  4LLO B;  4I39 A;  2QKP A;  2MJ6 A;  2O9B A;  2PHY A;  5DJU A;  3LI8 A;  5HDD A;  3MCX A;  3EGX C;  4O01 A;  4GHI B;  3F1P B;  1H5O A;  2PYP A;  3RH8 B;  3T4K A;  3CIT A;  1F5M A;  2IKD A;  4GW9 A;  1B8W A;  2B18 A;  3CUE A;  2P04 A;  5DKL A;  4F3L A;  4L0L A;  4L9F A;  1XJ3 A;  2XSS A;  3BY8 A;  5HD3 A;  3T4J A;  1S1Z A;  4KUK A;  1S67 L;  1ZLH B;  3MQQ A;  4IUH A;  4EUV A;  4I3J A;  1TS8 A;  2PD8 A;  3F1O B;  2K7S A;  3VE4 A;  2KLI A;  4CLC D;  4MN6 A;  5L8M A;  3LI9 A;  2MN3 A;  3OOV A;  1D7E A;  3LIF A;  3NJA A;  3BY9 A;  2IKE A;  1YKD A;  1WA9 A;  4DMZ A;  2J80 A;  3FG8 A;  1WQK A;  3LYX A;  1DP9 A;  1UWN X;  3JVU A;  4BBU A;  4I3I A;  1OPX A;  2VLG A;  1OT6 A;  2B9K A;  2OAQ 1;  4P6Z S;  3F1N B;  3K2N A;  4MN7 A;  5HSQ A;  3ULF A;  3NOP C;  3MXQ A;  5J7E A;  4LRX C;  2WKP A;  5TBM A;  4PAU A;  1XJ6 A;  4DJ2 A;  4WLA A;  5G4Z A;  2VV7 A;  4ME4 A;  2W1T B;  2V1A A;  5HZH A;  3BWL A;  4BBV A;  4EET B;  5J4E A;  4DJ3 A;  1OJ5 A;  2HF6 A;  3MF0 A;  5DF9 A;  5FL3 A;  2KX6 A;  2VX8 A;  2M7V A;  3PBN A;  4Y5F A;  3T4L A;  3HJI A;  5KSH A;  1V9Z A;  4B93 A;  3S7O A;  3PR6 A;  2QJ7 A;  1W63 M;  1MKM A;  2H28 A;  3GEC A;  1SH1 A;  2O0Y A;  2VGL S;  1F98 A;  2J3W A;  1ZUE A;  5HDC A;  4UEY A;  1YAX A;  2EA9 A;  4I5S A;  1TS7 A;  2PD7 A;  2A24 A;  4E04 A;  2QYB A;  1EW0 A;  3OCN A;  4R38 A;  2K2X A;  1TF1 A;  3PBO A;  1LSV A;  3BQ8 A;  4CLC C;  2ZOI A;  5AVE A;  1T1A A;  5G4Y A;  3B33 A;  5I5L A;  1OTI A;  2WKQ A;  4MDZ A;  1XJ2 A;  2IA2 A;  4HP4 A;  3CLO A;  1XFQ A;  1ZUF A;  3PBR A;  4CLC E;  3MMH A;  3R7W B;  2ZOH A;  2D02 A;  2M1C A;  3H82 A;  4HP9 A;  3EEH A;  2MUB A;  4GLQ A;  1MZU A;  3PYP A;  1KOU A;  3S7P A;  3K3D A;  4CLC A;  4HHD A;  1P9R A;  4EER A;  4Z1W A;  4BJP A;  5DJT A;  4IJG A;  1P9W A;  1ATX A;  2QWS A;  4NXE A;  2BDS A;  4ARZ B;  4PKY G;  3T4O A;  1WXN A;  4HQA A;  1T19 A;  5HWT A;  4WEJ A;  1S4S A;  3P7N A;  5TJJ A;  2JTO A;  2JKR I;  3EOI A;  3OC2 A;  1MC0 A;  3EQU A;  4G3K A;  4WEK A;  2FH5 A;  2W3H A;  5LBR A;  4UQI M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...