2HJ9C

Crystal structure of the autoinducer-2-bound form of vibrio harveyi luxp complexed with the periplasmic domain of luxq
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
219
structure length
210
Chain Sequence
SKQQTSALIHNIFDSHFAAIQIHHDSNSKSEVIRDFYTDRDTDVLNFFFLSIDQSDPSHTPEFRFLTDHKGIIWDDGNAHFYGVNDLILDSLANRVSFSNNWYYINVMTSIGSRHMLVRRVPILDPSTGEVLGFSFNAVVLDNNFALMEKLKSESNVDNVVLVANSVPLANSLIGDEPYNVADVLQRLLVIETPIVVNAVTTELCLLTVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-induced asymmetry in histidine sensor kinase complex regulates quorum sensing.
pubmed doi rcsb
source organism Vibrio harveyi
molecule tags Signaling protein
molecule keywords Autoinducer 2-binding periplasmic protein luxP
total genus 67
structure length 210
sequence length 219
chains with identical sequence D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.20.100 Mainly Beta Single Sheet Anthopleurin-A Anthopleurin-A 2hj9C02
3.30.450.220 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2hj9C01
2HJEA 1ZHHB 3C38A 2HJ9C 3C30A
chains in the Genus database with same CATH superfamily
2AVXA 1LL9A 3MKEA 2EFXA 3IS2B 1N9NA 2JHEA 2R9XA 3F1OB 1TD5A 3OLOA 2WAFA 4X53A 1SDNA 3E4QA 5DF8A 4CLCB 4R3JA 3O87A 4DE1A 3QNCA 3MZFA 3Q81A 1JNUA 5TBMA 2JCHA 2X02A 2K7SA 1H8ZA 3U2AA 2O9BA 2JN7A 5FAPA 5A92A 1DP8A 3GECA 3S4XA 4RA7A 4HJ4A 2NUPC 4LRXC 1ZHHB 2G2UA 5L07A 1ERMA 3D4FA 5IHVA 4IVIA 4GS9B 3A0SA 3VE4A 4L9FA 1WYBA 2EWVA 3BECA 1YMXA 1ALQA 3VE3A 3N8RA 3IHBA 4RYEA 3A0RA 1G6AA 4X25A 4EEPA 4OQIA 3IWOA 5DF7A 4CLCC 4GCZA 5HL6A 4EBLA 1G5UA 1XPBA 4RQ9A 5J4EA 1NLYA 4XT2B 4QD4A 1S0WA 1KGFA 4C3QA 1XA1A 1P0ZA 1MKIA 1AWIA 1JWPA 1XGIA 2Y2MA 4UA7A 2PBDP 3Q7ZA 2HF6A 1HZOA 4MLLA 4Y17A 1HLUP 5MC7A 3P98A 4L9EA 3MCXA 2RL3A 4HP9A 3D9YA 1IFQA 1BLHA 3MJQA 4WMCA 3WS4A 3M6BA 3T1RA 4EW7A 5HD5A 1SDEA 5FL3A 4P87A 4KUKA 1F5MA 3KSIA 3H82A 1XA7A 3G31A 2A24A 5KMWA 4IUHA 5FSRA 3MQQA 1T1CA 4OKPA 1Y28A 1JVJA 2IWBA 1VETB 3LICA 2ZM8A 2GDNA 3UE1A 1TS6A 2HP9A 3G35A 4DE2A 3OOVA 3WS2A 3UB9A 3HBRA 1VQQA 4JXSA 4NEED 3NIAA 3EEHA 4WZ5C 4OQ0A 3UMEA 1Z99A 1UWPX 3O88A 4BMWA 1N9OA 4N9LA 4L0LA 2BLSA 4Y0TA 4I5SA 3DWKA 2XXLA 2K2XA 3ZQ5A 4NXEA 5EVIB 3G6OA 5CEBA 3T50A 3BFGA 3VV4A 3P09A 3BWLA 2FFFB 2M1CA 4Y7PA 2WKRA 3RXWA 4IEDA 2R78A 4LV1A 5FQJA 5F5YA 4G3KA 3PR6A 4WELA 4E3NA 5JYOA 3EEAA 2JKGA 1K4EA 3S1YA 2EFUA 4WL9A 3JYIA 3OPPA 4P6BA 3BFDA 3KSHA 1L3LA 5U47A 4OOMA 5CGXA 4WUJA 4IHQA 2DLAA 1K55C 4WLAA 2INWA 5GLAA 3UE3A 3N8LA 4MN7A 5HX9A 2P9VB 3UB8A 5AQAA 1K56D 3NJAA 3HUNA 1KVLA 3UY6A 4Q0HA 3M6HA 3DAVA 5A93A 4XUXA 2VLGA 1BULA 3D72A 3K3DA 3ITBA 2XA7M 2V0WA 2VK3A 3BM6A 1MWTA 1WE4A 4HH3A 4BD1A 1F98A 1J3WA 4FH4A 3S22A 5C5KA 2WGIA 5EM0A 2B02A 5CHJA 4RVAA 1PI5A 2J7VA 4LV2A 4JPMA 1XXMA 3LCEA 2DMWA 3SS5A 2BASA 1PWCA 2GX5A 3NDEA 4Y0UA 5HAPA 3VP0A 3R4KA 2V20A 2OAP1 3GRJA 2PD8A 3CUEC 3CZDA 2XSSA 3W4OA 4PMAA 1U60A 4R3AA 4R70A 3ZGAB 4R4SA 3T12B 3MMHA 1HTZA 2VJWA 2IA2A 1APFA 2VGKA 3TJZC 2OOLA 5EECA 3ZNYA 1NLZA 2VX8A 1K57C 1ZLHB 3LMSB 2PR5A 3VFHA 1QMEA 1XJ6A 4QU3A 3LIBA 3ZG0A 1KGEA 5FI2A 2ZBBA 3AGEA 2ZC7A 3IXDA 3PYPA 4F3LB 3NOTC 4IVKA 3ZG5A 2ZQ9A 3I7JA 1G68A 4KENB 1MWUA 1GCEA 3FPVA 4WZ4A 3A3FA 3GTCA 1XJ3A 5FDSA 4JF6A 2J9PA 4FD8A 4WF0A 4Z1WA 3PAGA 4C75A 2B5RA 5CTNA 1S1ZA 4PKYG 2WKQA 4FOFA 4MN6A 3G32A 3RTYA 2QWSA 4KZ3A 4AFIA 2ZOIA 1OTEA 3NI9A 4R1GA 5HDSA 3LI8A 4NXGA 2ZQCA 5DFXA 4DKIA 1KGGA 5TFQA 4PKYA 2C6WB 2VV6A 1FCOA 1K56A 1E25A 2BTFP 3HJKA 4OVDA 2VV7A 4DE0A 4HI4A 4D2OA 2EWWA 3NDGA 1T18A 3MFXA 5HFOA 1FR6A 3CHWP 2W1RA 4E6WA 1ODVA 1CF0A 3M2KA 3VOLA 4I3IA 4LCLA 4EBPA 1BT5A 4BD0A 1E3UD 4IUKA 3LFVA 4O7DA 1T19A 4ME4A 5HD3A 2A3UA 5FQIA 1ZG6A 1YLYA 1VEUB 4LLOB 2M7VA 3L7HA 4EV4A 2HDQA 3RXXA 4ARZA 1FQGA 4G3WA 1H5OA 1L0FA 2PDRA 4Y13A 1T1AA 4MBFA 2V8CA 3DTMA 3O86A 1CK3A 2B95A 4KG2A 3IF6B 4WN5A 4F3LA 1RP5A 4ZJ3A 1PIOA 3P7NA 2LB5A 3C5AA 1D7EA 4MBHA 2ZL1B 4OOLA 3R7WA 1DP9A 4HH2A 4QPRA 3NCKA 3OPHA 4UEYA 3CWFA 1H0MA 4ETZA 4R4RA 3GSGA 3MBZA 4KG6A 3ZFZA 2R9WA 4P0MA 3ITAA 4KZ9A 3U4LP 1WXNA 4XT2A 1PRQA 3A3EA 3D3OA 3ICYA 4K08A 3LR3A 2QZ6A 5HDDA 2HJEA 1AXBA 3IX3A 1IKIA 1N4OA 2WGWA 4WEKA 3TE8A 5G4YA 5M1AA 2J3WA 3E98A 4EUVA 3BQ8A 1K54A 1YKDA 4X1MA 3TW8A 4YIRA 3C2WA 4B9OA 1CEGA 3IBRA 4PAUA 5HPIA 3W8KA 2WUQA 4HP4A 2Y2OA 2A2LA 3EGDC 2J3TC 3V3RA 5HAQA 1TF1A 5J7EA 4CLCA 1JWVA 2Y2GA 1NWZA 4P6ZS 3NECA 2ZC5B 3PAEA 5HZHA 3CPTA 3UB7A 3C38A 4R38A 1GHMA 2PAVP 1KE4A 3KX0X 3OBFA 1OT9A 5L09A 1FOFA 3LEZA 3BY9A 2Y2KA 3NC8A 2KOIA 5HWWA 5FA7A 1LHYA 3UDXA 5AVFA 4E3JA 2JE5A 4JXWA 3HL9A 4MN5A 4HBTA 3W2ZA 1ACFA 3Q7VA 1GSVA 1BLPA 1LL5A 1S6RA 4Y2FA 1HD8A 1C3BA 2WZZA 2EX9A 5AQBA 1RCJA 4IJGA 4LCMA 3S7OA 1ZUFA 3HLEA 4KZ8A 3JVUA 2QMIA 4H6JB 2XROA 4Q0IA 3C30A 1ES4A 2OAQ1 1PWDA 4WYYA 2K2NA 1PFLA 3MS6A 4OPRA 4E3IA 1ZTUA 3GMWA 1PW8A 5IS1A 2LB9A 1K54C 4R0QA 4KG5A 5EM1A 3SH9A 4EETB 4DE3A 4HJ3A 5FDHA 2B9KA 4X56A 3C7UA 4QWOA 1EL6A 1SZVA 1OMEA 4E04A 5FATA 5FQQA 4LRZE 1SHIA 3F1PA 2ZQ7A 4BL2A 2EA9A 3HLDA 2Z6DA 1JTGA 1EROA 3G2YA 3KYQA 3ZG7B 2IKDA 3MR0A 4BBUA 2MJ6A 1YSPA 5EVIA 1OTIA 3UE0A 3BY8A 4Q8IA 2ACGA 4QY5A 1O7EA 3BW6A 4JXGA 5JYPA 4LV0A 1LT0A 4CQHA 4X55A 4S2MA 2HPBA 1W63M 2HP6A 3IXGA 2KLIA 3TOIA 1XP4A 3PBRA 4BQMA 3FC7A 3WRZA 1KVMA 1K0KA 3ISGA 4XXRA 2ZQDA 4Y5FA 1RGZA 1GL9B 5KZHA 2Q9NA 4EUZA 5FAQA 1F9IA 4X69A 4R6LA 3S7QA 3BFEA 2Z2LB 4LPZA 5KSCA 4MEZA 1IYQA 2QJ7A 2QSGA 4I3JA 1NZUA 4DJ3A 2H5SA 1EI5A 4FTXA 4EQ1A 3BEBA 3IF6C 3P01A 3QP2A 4JGQA 4OLDA 3MFDA 2V0UA 4GW9A 2VKSA 5DKKA 2Y2LA 3IX4A 1FR1A 4NETA 2HDUA 2QPNA 1ATXA 2Z2MB 2P7JA 1FCMA 4PM7A 5FI6A 3G34A 5GLBA 1PZPA 2HGVA 3HLWA 3ZNTA 3FWLA 5EE8A 3EQUA 1NYYA 4GHIA 4OP8A 3OPLA 3LIDA 1ZLIB 1G28A 3IF5A 1CI8A 4R23A 4UA6A 1BTLA 3HUMA 4U0XA 3CITA 4DF6A 4ZRRA 4HOIA 3R7WB 3F1NA 5GL9A 2ZQAA 3LR4A 2V9AA 5F1GA 3NHQA 1W8YA 3PXPA 4JF4A 2FH5A 3DTIA 3BFCA 4GHIB 4P85A 4S2PA 4GOGA 1S67L 4EERA 1K38A 2GNXA 2SH1A 4ZJ1A 2XH9A 1FSYA 2G7UA 2JBFA 3BRMA 5DKLA 2W3DA 5IU1A 3MYVA 4E3LA 1BZAA 3E4OA 3EGXC 1VHMA 1BUEA 3FKVA 2FZ0A 5F82A 1TEMA 3T4QA 4O8GA 4KZ4A 1GSWA 3QHYA 1STZA 2KX6A 3UB6A 3W4QA 4S2NA 1Y54A 4EQIA 4U3TA 2VZWA 5CERA 4JLFA 1L2SA 4K91A 3C8CA 4QY6A 4FCFA 5GLDA 4PM9A 5AJGA 3QP8A 1ES2A 5AVEA 4E3OA 2OWJA 1YM1A 1SH1A 5HARA 5L8MA 1LSWA 5HSQA 5L10A 3GV9A 1BDSA 2XDMA 2D02A 4Y3IA 1XGJA 3E2KA 5HL1A 2H0TA 1YQSA 2V1AA 2VEAA 2FFYA 4HNBA 2QJ5A 4HEFA 2Y2HA 3N4IA 2UWXA 3LO7A 3WWXA 4GZBA 1WQKA 3UPOA 3ZCZA 1NRFA 3WRTA 1H3QA 1NZOA 1TS0A 5CHUA 3TRCA 3A3JA 2ZOHA 3UN7A 1FIKA 4KZAA 3QP6A 4BBTA 4RX3A 3RJUA 5AQ7A 4QB8A 4GB7A 4MBKA 2WZXA 1YAXA 4ZJ2A 4GLQA 4OONA 4DDSA 2XD1A 4KZBA 1MZUA 2GJ3A 2E8IA 5FQMA 4UA9A 3DWZA 3HLCA 4E3MA 3C4PA 3IHAA 3MXRA 2JC7A 4B88A 3VP2A 2V8FA 2XFTA 3V39A 3VMAA 1K6SA 1SKFA 2H10A 4X68A 3TSGA 4OPQA 4YINA 1BSGA 5FEFA 3IXHA 2ZC6B 1IOUA 4H8RA 4CLCD 2Y8HA 3DBAA 1MKMA 2Y2JA 1T1BA 1DJCA 5F69A 5EOOA 4X6TA 1KE0A 4M4XA 3T1SA 4EBNA 1PWGA 4JGOA 3ZG9B 3PBSA 3KO6A 3LI9A 1MXOA 1OTDA 2YKFA 5HW3A 2BG1A 3A3DA 3G4PA 3WS1A 4LFUA 3V67A 1DY6A 1GHPA 4BBVA 4ID4A 4WZ5A 3CG5A 3Q1FA 5HWTA 1FCNA 1S66L 3KSFA 5FI7A 3ZYTA 3UB5P 3CI6A 3TG9A 2WGVA 2ZJ9A 3N7WA 1S1YA 1YMSA 3PHYA 3T4LA 1P9WA 5FASA 4EESA 2H28A 4N9KA 3OPRA 3V5MA 2OSUA 4YOFA 1X0OA 5DFYA 1ONHA 1O07A 3A3IA 5KIZA 4HY8A 3LIEA 3N6IA 1V9YA 2W3HA 1NRJA 3IF4A 3B42A 1MC0A 4CPKA 1JTDA 4B4XA 1IYPA 1SCWA 1WA9A 4NXBA 2OLUA 2Y2QA 2MN3A 3UMDA 5F6AA 1XJ4A 2QHKA 5EVEA 2HZ5A 3DW0A 3HLGA 1GSXA 2X01A 5A8BA 2W1TB 4BLMA 1CQAA 2RNGA 2Q9MA 3BLMA 2GZAA 4GD8A 3S7PA 3VSKA 4GS9A 4LRYC 2QYBA 1OPXA 2DNSA 5DTKA 1PW1A 1H8MA 1UGUA 5DJTA 1GHIA 1IYOA 5CRFA 1Z6FA 2WAEA 1NY0A 4N92A 2MUBA 4OP5A 2P08A 1I2SA 2D01A 4JF5A 3IWIA 4O0PA 3IWQA 3LR0A 3PBNA 1FILA 5DJUA 1VEUA 4WBGA 4JKTA 3LY4A 4K0XA 1KDSA 3K2NA 1YLWA 5J8XA 3EQVA 4E6XA 2JR3A 2PD7A 3ZG8B 5CTMA 1AHLA 1W5DA 2WKEA 1E3UA 3F1NB 4GKUA 2ZLYA 3JPUA 3QP1A 1K4FA 4N1HA 4PPRA 1L0GA 2PHYA 5HAIA 3FKWA 3SH7A 2WKIA 2BDSA 1YPRA 1LI9A 3ZVTA 3C4OA 3IX8A 5I94A 4HJ6A 4H6JA 3ULFA 2VA0A 2ZM2A 2L1MA 3L9KA 3BFFA 3K3CA 2Y2PA 5D3OA 2ZMFA 4E3KA 5CGSA 1XJ2A 1TDLA 2J3TD 5DF9A 1E4DA 4EWFA 3SH8A 4Y15A 4FSFA 4I38A 3MXSA 3LR5A 3BYDA 3OCLA 1OT6A 2PRFA 2WK0A 2XFSA 1FSWA 2KDKA 5GHZA 2Y59A 3MQOA 3UDIA 3CJMA 5HPFA 4S2OA 4MDZA 2JTOA 1K55A 5LBRA 3T4KA 1BYWA 2JKFA 4PHTA 5DVAA 2P74A 3IBJA 1LLBA 1MWRA 5F83A 1YLZA 3B33A 2CMNA 1XFQA 3UO9A 1MBLA 2C5WB 4PM5A 3DTKA 1V9ZA 5EOEA 3H7WB 3JVVA 5EVID 1Q2QA 2B18A 3T1QB 2Y2IA 1YT4A 1H8YA 1P9RA 3QNBA 5E2GA 3FYZA 1ONGA 3VP1A 4YFMA 5KSHA 5CXWA 2ZL1A 1B8WA 2ZM0A 4DXCA 1LSXA 3VFFA 2VGJA 4OQHA 3VSLA 5TBMB 2Z6CA 2Q0OA 4S2KA 3PBTA 2WADA 1HVBA 1NYMA 2PU2A 3DTEA 2WKHA 4KZ6A 3WS5A 3H9WA 1YLPA 4KQQA 4NK3A 1MWSA 1KE3A 4I3AA 3VOZA 1L0DA 1Z09A 5IT5A 1K25A 1IELA 3F1PB 2XK1A 2H9XA 1BLSA 3V50A 4BWIA 4QJGA 2P9VA 3E0YA 1CI9A 4BL3A 5EVLA 1GA0A 3GR2A 4B93A 2A24B 3MQ0A 2M7UA 3SS4A 2PYPA 4HBUA 4KZ7A 3OC2A 1LSVA 3UPNA 4YNRA 4K0WA 3WS0A 1ERQA 3EWKA 3ZVWA 5EUAA 5J3WA 2L4RA 3E2LA 5FQKA 1M40A 3N8SA 2O9CA 4MNRA 1ZC2A 4F94A 2EX2A 1LL8A 2OLVA 1A0KA 1D6BA 2VGLS 3E4PA 1OJ5A 2IWCA 3D4UB 5M18A 1W79A 4UQIS 2A49A 4NXFA 3MZDA 1MY8A 4S2JA 5TGFA 4CJNA 2YKHA 2E8JA 2W27A 3VP3A 5K5BA 3G30A 1SKOB 1PI4A 5HWVA 1VM1A 4DN0A 2QSHA 2CC1A 2UV0E 4XUZA 4EU0A 3NOUC 5E2EA 1DRMA 1D1JA 5BOHA 3EOIA 1G6OA 3LYXA 4PM6A 2O0YA 2HV1A 1GKUB 1ESUA 2XF3A 3IH8A 5M19A 3NOPC 4U0TA 3W4PA 3UNWA 4OPYA 5CX7A 1ZKJA 1ZUEA 4GV5A 1S4RA 1J9MA 5TR7A 4MMNA 5E43A 5EPHA 2J8YA 3A0VA 1VB6A 3C7VA 3NY4A 4GD6A 1Y4OA 2W1TA 2ZMAA 1N9BA 3FZCA 3QP4A 3FG8A 3H82B 2I9VA 5GLCA 3HUOA 1ESIA 3CAXA 5CEDA 4WM9A 1L0EA 4WEJA 1VETA 2VGLM 3FPWA 3T4JA 2XA7S 3H7WA 4BENA 2DRWA 1ES5A 3IQAA 5F1FA 2XD5A 4OLGA 3O5YA 3S7NA 3MF0A 5G4ZA 3KYEA 3HLBA 2IKEA 4PM8A 4DDYA 4A5RA 2OV5A 3VOYA 5L2FA 5A91A 1JWZA 2H0YA 4UAAA 2W0NA 5DTTA 1BLCA 4I39A 4S2NC 3IS2A 4ETXA 1DP6A 4R3BA 4Y0OA 2IWDA 4KZ5A 4BJPA 3LY3A 3AGFA 4ARZB 1DJAA 3HJIA 3CPTB 2O9AA 2J80A 1OJGA 4P6ZM 2G2WA 4DMZA 5G18A 2Y55A 1EW0A 1ES3A 3VP4A 3SOIA 4B4ZA 1Q2PA 4JGPA 3V3SA 1I5QA 1NJ4A 3MXQA 1SHVA 4ZAMA 3ZHHA 2Y79A 3ZDJA 2Y2NA 2PBYA 1WYCA 1IYSA 3B47A 1ZG4A 2HJ9C 1I2WA 4O01A 1XFNA 3OCNA 3HCYA 4G3VA 5FAOA 5F68A 2ZMVA 2V1BA 4OQGA 4OPZA 3GDIA 1D06A 1P97A 4RX2A 4GNUA 5E2FA 2WYXA 1W63Q 1CJFA 1TS7A 2W3EA 2X71A 4MCWA 4ZBEA 3MSHA 3F1OA 3OZHA 4QHCA 3G2ZA 2ZC4B 4GJ4A 4GDNA 1F2KA 1YLTA 4ESPA 2I72A 4GN2A 4ZTKA 2O99A 2JKTI 4IBRA 2PYRA 3GVBA 2EXBA 1YSQA 3BQAA 3T4SA 2Y91A 3NULA 1IKGA 2HDSA 2Y4AA 2WKPA 1MPLA 4Q0JA 2XQZA 4C6YA 3HLFA 1DJBA 4X1LA 2ZQ8A 1IEMA 2EXAA 4ZDXA 1TS8A 3HREA 5TJJA 4GDBA 3Q7VB 1PYYA 4Z9QA 2XGNA 1EWZA 4JXVA 2PT7A 4S2LA 2PU4A 1RGYA 4HQAA 4HHDA 3KEZA 2XLNA 3PBOA 3KYZA 3Q07A 2JKTM 2HP5A 3CUEA 1PNEA 4HIAA 3FV7A 1KDWA 3BLSA 2WGWB 2P04A 1OTBA 4IBXA 3KSGA 3HVFA 1W7FA 3CMZA 4D60A 4FUWA 4YWZA 3PTEA 5I5LA 3LUQA 1S4SA 3O3VA 1K57A 4KQOA 3GQZA 4CLCE 3QP5A 5EVIC 1K6RA 3SW1A 2XRNA 4JBFA 1N9LA 2QSFA 2J9OA 4DXBA 1KOUA 1QMFA 3UPPA 5DTSA 3AGDA 1LI0A 5CHMA 3NBLA 4LV3A 4EEUA 1TDGA 4N1XA 2W3GA 3IT9A 4M3KA 4EXOA 2PR6A 3SZTA 5CECA 1TVFA 2XR0A 3IF6A 3SS3A 1SKOA 4LGWA 2XEPA 3LIAA 2V1ZA 3T4TA 5A90A 3UDFA 2HDRA 3LGOA 4II7A 1GA9A 2V2FF 3B3XA 4OOYA 2RCXA 4LENA 4DRTA 2W3FA 3RH8B 4KUOA 2ZD8A 1XKZA 2QKPA 4S2IA 1OTAA 2OWHA 3PBQA 4UHUA 1YLJA 1CEFA 3IH9A 3T1XA 1H5XA 1NXYA 4FH2A 2JKRM 3IXBA 1XX2A 3MZEA 4L9GA 1PZOA 4HESA 3UE6A 5HDCA 4KQRA 1UWNX 5AQ9A 3MKFA 5EFWA 4WMCD 3M2JA 4OH0A 2DCFA 4DJ2A 2NUTC 5FQ9A 2VV8A 1W8QA 2ZC3B 5E2HA 5FEGA 1M6KA 2EX8A 4KQDA 5GHXA 2EX6A 3Q82A 3T4OA 4NKPA 4NG2A 4UQIM 5CGWA 3LIFA 5EV0A 3BJNA 3LEQA 2JKRI 3CLOA 3RFBA 4JGRA 5GHYA 2K31A 2L0WA
chains in the Genus database with same CATH topology
2QJ5A 2PDRA 4UQIS 4NXFA 1T1AA 2YKHA 3IS2B 1N9NA 2JHEA 2W27A 1WQKA 3F1OB 1TD5A 3OLOA 3E4QA 4CLCB 1H3QA 1TS0A 5K5BA 1JNUA 4WN5A 5TBMA 3TRCA 4F3LA 5HWVA 4DN0A 2QSHA 2ZOHA 3P7NA 4EU0A 3NOUC 1DRMA 2K7SA 2LB5A 3EOIA 3U2AA 2O9BA 4BBTA 1D7EA 1G6OA 3LYXA 2O0YA 2HV1A 2JN7A 4OOLA 1DP8A 3GECA 3R7WA 1DP9A 4HJ4A 4HH2A 4QPRA 2NUPC 4LRXC 1YAXA 4UEYA 1ZHHB 3CWFA 3NOPC 4GLQA 4ETZA 1MZUA 2GJ3A 5CX7A 4GS9B 1ZUEA 4GV5A 3A0SA 1S4RA 3VE4A 1WXNA 4XT2A 4L9FA 2EWVA 4MMNA 3A0VA 3D3OA 3ICYA 1VB6A 4K08A 3LR3A 5HDDA 2HJEA 2W1TA 3VE3A 4WEKA 3TE8A 5G4YA 3A0RA 2J3WA 4EEPA 3FG8A 3E98A 3H82B 4EUVA 3BQ8A 1YKDA 2I9VA 3TW8A 4YIRA 3C2WA 4B9OA 4CLCC 3IBRA 4GCZA 5HL6A 4PAUA 3CAXA 4RQ9A 5HPIA 5J4EA 4HP4A 1NLYA 2A2LA 4XT2B 3EGDC 4WEJA 2VGLM 2J3TC 1TF1A 5J7EA 3FPWA 1IOUA 4CLCA 3T4JA 4CLCD 2Y8HA 3DBAA 1P0ZA 1MKMA 2XA7S 3H7WA 1NWZA 4P6ZS 1T1BA 2HF6A 3O5YA 3S7NA 3MF0A 5G4ZA 5F69A 5HZHA 2IKEA 3UB7A 3C38A 4R38A 5MC7A 4M4XA 4JGOA 3PBSA 4L9EA 3MCXA 3KO6A 3LI9A 3KX0X 1OTDA 2YKFA 3OBFA 1OT9A 4HP9A 3BY9A 2KOIA 3V67A 5HWWA 1IFQA 2W0NA 4I39A 4BBVA 5AVFA 3MJQA 5HWTA 1S66L 3KSFA 3IS2A 4ETXA 3ZYTA 1DP6A 4EW7A 4MN5A 3W2ZA 3CI6A 5HD5A 1GSVA 5FL3A 1S1YA 3PHYA 3T4LA 1P9WA 4KUKA 4EESA 2H28A 1F5MA 4Y2FA 3KSIA 4BJPA 4YOFA 1X0OA 4ARZB 3HJIA 5DFYA 3H82A 4IJGA 3S7OA 1ZUFA 2A24A 2O9AA 3JVUA 2J80A 4IUHA 5KIZA 4HY8A 3LIEA 3MQQA 1V9YA 4H6JB 2W3HA 1NRJA 1OJGA 1T1CA 4P6ZM 4DMZA 3B42A 1MC0A 1Y28A 2XROA 1WA9A 4Q0IA 1EW0A 3LICA 4NXBA 2MN3A 3C30A 3UMDA 1TS6A 5F6AA 2OAQ1 1XJ4A 2QHKA 3OOVA 4JGPA 2K2NA 3MXQA 3UB9A 1GSXA 2Y79A 5A8BA 2W1TB 4NEED 1ZTUA 3EEHA 5IS1A 3B47A 3UMEA 2HJ9C 2LB9A 1Z99A 2RNGA 1UWPX 4BMWA 1N9OA 2GZAA 4L0LA 4O01A 4I5SA 3S7PA 4EETB 4HJ3A 2B9KA 4GS9A 4LRYC 2QYBA 2XXLA 2K2XA 1OPXA 1XFNA 1H8MA 5DJTA 1UGUA 3OCNA 4NXEA 3ZQ5A 3HCYA 4G3VA 4E04A 3G6OA 3T50A 4LRZE 2MUBA 1SHIA 2P08A 2D01A 3VV4A 3F1PA 5F68A 2ZMVA 3BWLA 4O0PA 2V1BA 2M1CA 2EA9A 2WKRA 3GDIA 1D06A 3LR0A 1P97A 3PBNA 2Z6DA 2R78A 1W63Q 3KYQA 5DJUA 2IKDA 1TS7A 2W3EA 3MR0A 5F5YA 4MCWA 4BBUA 2MJ6A 1YSPA 4G3KA 3PR6A 4WELA 3K2NA 3F1OA 1OTIA 3EQVA 3EEAA 3BY8A 2JR3A 2PD7A 3BW6A 4WL9A 4GJ4A 1AHLA 3F1NB 3KSHA 1LT0A 4CQHA 4OOMA 4WUJA 4IHQA 2DLAA 1W63M 2O99A 4WLAA 2INWA 2JKTI 2KLIA 2PHYA 2PYRA 3PBRA 2BDSA 3UE3A 1YSQA 3BQAA 3FC7A 4MN7A 3T4SA 3UB8A 4HJ6A 4Y5FA 4H6JA 3ULFA 2VA0A 2WKPA 2L1MA 4Q0JA 3NJAA 3K3CA 2ZMFA 4Q0HA 1F9IA 1XJ2A 2J3TD 4R6LA 5DF9A 3S7QA 2VLGA 3D72A 1TS8A 4LPZA 4FSFA 4I38A 3LR5A 5TJJA 3OCLA 3K3DA 1OT6A 2QJ7A 2XA7M 2QSGA 2V0WA 4I3JA 2KDKA 4HH3A 3MQOA 2PT7A 5HPFA 4DJ3A 1F98A 4MDZA 4HQAA 2JTOA 4EQ1A 4HHDA 3KEZA 5C5KA 5LBRA 3T4KA 3PBOA 1BYWA 3KYZA 2B02A 3P01A 4PHTA 4JGQA 2JKTM 2V0UA 4GW9A 3CUEA 2DMWA 2VKSA 5DKKA 3IBJA 4HIAA 2CMNA 1ATXA 2BASA 3B33A 1XFQA 2P7JA 2GX5A 2P04A 1V9ZA 3H7WB 3JVVA 3R4KA 1OTBA 2HGVA 2OAP1 3KSGA 2B18A 2PD8A 3EQUA 3CUEC 4GHIA 4YWZA 2XSSA 4R3AA 5I5LA 3LIDA 3LUQA 4R70A 1S4SA 1ZLIB 4KQOA 1G28A 3MMHA 4CLCE 1P9RA 2VJWA 2IA2A 1APFA 3SW1A 2XRNA 3TJZC 5KSHA 1N9LA 2OOLA 2QSFA 1NLZA 2VX8A 1KOUA 1ZLHB 3LMSB 1B8WA 3CITA 2PR5A 4ZRRA 4HOIA 3R7WB 4EEUA 3F1NA 1LSXA 2W3GA 1XJ6A 3LIBA 3LR4A 4EXOA 2V9AA 2ZBBA 2PR6A 3NHQA 3PYPA 4F3LB 3PXPA 3NOTC 5TBMB 2Z6CA 2FH5A 3PBTA 3LIAA 4GHIB 3T4TA 3FPVA 4HNBA 1S67L 4EERA 1XJ3A 2GNXA 3H9WA 4II7A 2SH1A 4I3AA 4WF0A 4Z1WA 2G7UA 5IT5A 1S1ZA 4PKYG 2WKQA 2W3FA 4FOFA 3RH8B 3F1PB 4KUOA 4MN6A 5DKLA 2W3DA 2H9XA 5IU1A 3RTYA 3MYVA 2QKPA 2QWSA 3E4OA 4AFIA 2ZOIA 3EGXC 4BWIA 1OTEA 1VHMA 1OTAA 2FZ0A 2OWHA 3LI8A 3PBQA 5HDSA 3E0YA 4NXGA 3T4QA 4O8GA 5DFXA 4PKYA 2VV6A 1GSWA 2JKRM 4B93A 1STZA 2KX6A 3UB6A 3HJKA 4L9GA 2A24B 2VV7A 3MQ0A 2M7UA 4HI4A 2VZWA 3UE6A 5HDCA 2EWWA 2PYPA 1UWNX 1T18A 3MFXA 3OC2A 5EFWA 3C8CA 2W1RA 1LSVA 4YNRA 1ODVA 4DJ2A 2NUTC 3EWKA 5J3WA 3VOLA 4I3IA 5AJGA 2VV8A 5AVEA 2L4RA 2OWJA 1SH1A 4IUKA 2O9CA 3LFVA 1T19A 4ME4A 5L8MA 1LSWA 4KQDA 5HD3A 5HSQA 3T4OA 4NKPA 4UQIM 1LL8A 1BDSA 3LIFA 3BJNA 2D02A 4LLOB 2M7VA 2JKRI 3CLOA 4Y3IA 3RFBA 1D6BA 2VGLS 3E4PA 1OJ5A 4ARZA 4JGRA 4G3WA 2V1AA 3D4UB 1H5OA 2VEAA 2K31A 2L0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJE A;  1ZHH B;  3C38 A;  2HJ9 C;  3C30 A; 
#chains in the Genus database with same CATH topology
 2AVX A;  1LL9 A;  3MKE A;  2EFX A;  3IS2 B;  1N9N A;  2JHE A;  2R9X A;  3F1O B;  1TD5 A;  3OLO A;  2WAF A;  4X53 A;  1SDN A;  3E4Q A;  5DF8 A;  4CLC B;  4R3J A;  3O87 A;  4DE1 A;  3QNC A;  3MZF A;  3Q81 A;  1JNU A;  5TBM A;  2JCH A;  2X02 A;  2K7S A;  1H8Z A;  3U2A A;  2O9B A;  2JN7 A;  5FAP A;  5A92 A;  1DP8 A;  3GEC A;  3S4X A;  4RA7 A;  4HJ4 A;  2NUP C;  4LRX C;  1ZHH B;  2G2U A;  5L07 A;  1ERM A;  3D4F A;  5IHV A;  4IVI A;  4GS9 B;  3A0S A;  3VE4 A;  4L9F A;  1WYB A;  2EWV A;  3BEC A;  1YMX A;  1ALQ A;  3VE3 A;  3N8R A;  3IHB A;  4RYE A;  3A0R A;  1G6A A;  4X25 A;  4EEP A;  4OQI A;  3IWO A;  5DF7 A;  4CLC C;  4GCZ A;  5HL6 A;  4EBL A;  1G5U A;  1XPB A;  4RQ9 A;  5J4E A;  1NLY A;  4XT2 B;  4QD4 A;  1S0W A;  1KGF A;  4C3Q A;  1XA1 A;  1P0Z A;  1MKI A;  1AWI A;  1JWP A;  1XGI A;  2Y2M A;  4UA7 A;  2PBD P;  3Q7Z A;  2HF6 A;  1HZO A;  4MLL A;  4Y17 A;  1HLU P;  5MC7 A;  3P98 A;  4L9E A;  3MCX A;  2RL3 A;  4HP9 A;  3D9Y A;  1IFQ A;  1BLH A;  3MJQ A;  4WMC A;  3WS4 A;  3M6B A;  3T1R A;  4EW7 A;  5HD5 A;  1SDE A;  5FL3 A;  4P87 A;  4KUK A;  1F5M A;  3KSI A;  3H82 A;  1XA7 A;  3G31 A;  2A24 A;  5KMW A;  4IUH A;  5FSR A;  3MQQ A;  1T1C A;  4OKP A;  1Y28 A;  1JVJ A;  2IWB A;  1VET B;  3LIC A;  2ZM8 A;  2GDN A;  3UE1 A;  1TS6 A;  2HP9 A;  3G35 A;  4DE2 A;  3OOV A;  3WS2 A;  3UB9 A;  3HBR A;  1VQQ A;  4JXS A;  4NEE D;  3NIA A;  3EEH A;  4WZ5 C;  4OQ0 A;  3UME A;  1Z99 A;  1UWP X;  3O88 A;  4BMW A;  1N9O A;  4N9L A;  4L0L A;  2BLS A;  4Y0T A;  4I5S A;  3DWK A;  2XXL A;  2K2X A;  3ZQ5 A;  4NXE A;  5EVI B;  3G6O A;  5CEB A;  3T50 A;  3BFG A;  3VV4 A;  3P09 A;  3BWL A;  2FFF B;  2M1C A;  4Y7P A;  2WKR A;  3RXW A;  4IED A;  2R78 A;  4LV1 A;  5FQJ A;  5F5Y A;  4G3K A;  3PR6 A;  4WEL A;  4E3N A;  5JYO A;  3EEA A;  2JKG A;  1K4E A;  3S1Y A;  2EFU A;  4WL9 A;  3JYI A;  3OPP A;  4P6B A;  3BFD A;  3KSH A;  1L3L A;  5U47 A;  4OOM A;  5CGX A;  4WUJ A;  4IHQ A;  2DLA A;  1K55 C;  4WLA A;  2INW A;  5GLA A;  3UE3 A;  3N8L A;  4MN7 A;  5HX9 A;  2P9V B;  3UB8 A;  5AQA A;  1K56 D;  3NJA A;  3HUN A;  1KVL A;  3UY6 A;  4Q0H A;  3M6H A;  3DAV A;  5A93 A;  4XUX A;  2VLG A;  1BUL A;  3D72 A;  3K3D A;  3ITB A;  2XA7 M;  2V0W A;  2VK3 A;  3BM6 A;  1MWT A;  1WE4 A;  4HH3 A;  4BD1 A;  1F98 A;  1J3W A;  4FH4 A;  3S22 A;  5C5K A;  2WGI A;  5EM0 A;  2B02 A;  5CHJ A;  4RVA A;  1PI5 A;  2J7V A;  4LV2 A;  4JPM A;  1XXM A;  3LCE A;  2DMW A;  3SS5 A;  2BAS A;  1PWC A;  2GX5 A;  3NDE A;  4Y0U A;  5HAP A;  3VP0 A;  3R4K A;  2V20 A;  2OAP 1;  3GRJ A;  2PD8 A;  3CUE C;  3CZD A;  2XSS A;  3W4O A;  4PMA A;  1U60 A;  4R3A A;  4R70 A;  3ZGA B;  4R4S A;  3T12 B;  3MMH A;  1HTZ A;  2VJW A;  2IA2 A;  1APF A;  2VGK A;  3TJZ C;  2OOL A;  5EEC A;  3ZNY A;  1NLZ A;  2VX8 A;  1K57 C;  1ZLH B;  3LMS B;  2PR5 A;  3VFH A;  1QME A;  1XJ6 A;  4QU3 A;  3LIB A;  3ZG0 A;  1KGE A;  5FI2 A;  2ZBB A;  3AGE A;  2ZC7 A;  3IXD A;  3PYP A;  4F3L B;  3NOT C;  4IVK A;  3ZG5 A;  2ZQ9 A;  3I7J A;  1G68 A;  4KEN B;  1MWU A;  1GCE A;  3FPV A;  4WZ4 A;  3A3F A;  3GTC A;  1XJ3 A;  5FDS A;  4JF6 A;  2J9P A;  4FD8 A;  4WF0 A;  4Z1W A;  3PAG A;  4C75 A;  2B5R A;  5CTN A;  1S1Z A;  4PKY G;  2WKQ A;  4FOF A;  4MN6 A;  3G32 A;  3RTY A;  2QWS A;  4KZ3 A;  4AFI A;  2ZOI A;  1OTE A;  3NI9 A;  4R1G A;  5HDS A;  3LI8 A;  4NXG A;  2ZQC A;  5DFX A;  4DKI A;  1KGG A;  5TFQ A;  4PKY A;  2C6W B;  2VV6 A;  1FCO A;  1K56 A;  1E25 A;  2BTF P;  3HJK A;  4OVD A;  2VV7 A;  4DE0 A;  4HI4 A;  4D2O A;  2EWW A;  3NDG A;  1T18 A;  3MFX A;  5HFO A;  1FR6 A;  3CHW P;  2W1R A;  4E6W A;  1ODV A;  1CF0 A;  3M2K A;  3VOL A;  4I3I A;  4LCL A;  4EBP A;  1BT5 A;  4BD0 A;  1E3U D;  4IUK A;  3LFV A;  4O7D A;  1T19 A;  4ME4 A;  5HD3 A;  2A3U A;  5FQI A;  1ZG6 A;  1YLY A;  1VEU B;  4LLO B;  2M7V A;  3L7H A;  4EV4 A;  2HDQ A;  3RXX A;  4ARZ A;  1FQG A;  4G3W A;  1H5O A;  1L0F A;  2PDR A;  4Y13 A;  1T1A A;  4MBF A;  2V8C A;  3DTM A;  3O86 A;  1CK3 A;  2B95 A;  4KG2 A;  3IF6 B;  4WN5 A;  4F3L A;  1RP5 A;  4ZJ3 A;  1PIO A;  3P7N A;  2LB5 A;  3C5A A;  1D7E A;  4MBH A;  2ZL1 B;  4OOL A;  3R7W A;  1DP9 A;  4HH2 A;  4QPR A;  3NCK A;  3OPH A;  4UEY A;  3CWF A;  1H0M A;  4ETZ A;  4R4R A;  3GSG A;  3MBZ A;  4KG6 A;  3ZFZ A;  2R9W A;  4P0M A;  3ITA A;  4KZ9 A;  3U4L P;  1WXN A;  4XT2 A;  1PRQ A;  3A3E A;  3D3O A;  3ICY A;  4K08 A;  3LR3 A;  2QZ6 A;  5HDD A;  2HJE A;  1AXB A;  3IX3 A;  1IKI A;  1N4O A;  2WGW A;  4WEK A;  3TE8 A;  5G4Y A;  5M1A A;  2J3W A;  3E98 A;  4EUV A;  3BQ8 A;  1K54 A;  1YKD A;  4X1M A;  3TW8 A;  4YIR A;  3C2W A;  4B9O A;  1CEG A;  3IBR A;  4PAU A;  5HPI A;  3W8K A;  2WUQ A;  4HP4 A;  2Y2O A;  2A2L A;  3EGD C;  2J3T C;  3V3R A;  5HAQ A;  1TF1 A;  5J7E A;  4CLC A;  1JWV A;  2Y2G A;  1NWZ A;  4P6Z S;  3NEC A;  2ZC5 B;  3PAE A;  5HZH A;  3CPT A;  3UB7 A;  3C38 A;  4R38 A;  1GHM A;  2PAV P;  1KE4 A;  3KX0 X;  3OBF A;  1OT9 A;  5L09 A;  1FOF A;  3LEZ A;  3BY9 A;  2Y2K A;  3NC8 A;  2KOI A;  5HWW A;  5FA7 A;  1LHY A;  3UDX A;  5AVF A;  4E3J A;  2JE5 A;  4JXW A;  3HL9 A;  4MN5 A;  4HBT A;  3W2Z A;  1ACF A;  3Q7V A;  1GSV A;  1BLP A;  1LL5 A;  1S6R A;  4Y2F A;  1HD8 A;  1C3B A;  2WZZ A;  2EX9 A;  5AQB A;  1RCJ A;  4IJG A;  4LCM A;  3S7O A;  1ZUF A;  3HLE A;  4KZ8 A;  3JVU A;  2QMI A;  4H6J B;  2XRO A;  4Q0I A;  3C30 A;  1ES4 A;  2OAQ 1;  1PWD A;  4WYY A;  2K2N A;  1PFL A;  3MS6 A;  4OPR A;  4E3I A;  1ZTU A;  3GMW A;  1PW8 A;  5IS1 A;  2LB9 A;  1K54 C;  4R0Q A;  4KG5 A;  5EM1 A;  3SH9 A;  4EET B;  4DE3 A;  4HJ3 A;  5FDH A;  2B9K A;  4X56 A;  3C7U A;  4QWO A;  1EL6 A;  1SZV A;  1OME A;  4E04 A;  5FAT A;  5FQQ A;  4LRZ E;  1SHI A;  3F1P A;  2ZQ7 A;  4BL2 A;  2EA9 A;  3HLD A;  2Z6D A;  1JTG A;  1ERO A;  3G2Y A;  3KYQ A;  3ZG7 B;  2IKD A;  3MR0 A;  4BBU A;  2MJ6 A;  1YSP A;  5EVI A;  1OTI A;  3UE0 A;  3BY8 A;  4Q8I A;  2ACG A;  4QY5 A;  1O7E A;  3BW6 A;  4JXG A;  5JYP A;  4LV0 A;  1LT0 A;  4CQH A;  4X55 A;  4S2M A;  2HPB A;  1W63 M;  2HP6 A;  3IXG A;  2KLI A;  3TOI A;  1XP4 A;  3PBR A;  4BQM A;  3FC7 A;  3WRZ A;  1KVM A;  1K0K A;  3ISG A;  4XXR A;  2ZQD A;  4Y5F A;  1RGZ A;  1GL9 B;  5KZH A;  2Q9N A;  4EUZ A;  5FAQ A;  1F9I A;  4X69 A;  4R6L A;  3S7Q A;  3BFE A;  2Z2L B;  4LPZ A;  5KSC A;  4MEZ A;  1IYQ A;  2QJ7 A;  2QSG A;  4I3J A;  1NZU A;  4DJ3 A;  2H5S A;  1EI5 A;  4FTX A;  4EQ1 A;  3BEB A;  3IF6 C;  3P01 A;  3QP2 A;  4JGQ A;  4OLD A;  3MFD A;  2V0U A;  4GW9 A;  2VKS A;  5DKK A;  2Y2L A;  3IX4 A;  1FR1 A;  4NET A;  2HDU A;  2QPN A;  1ATX A;  2Z2M B;  2P7J A;  1FCM A;  4PM7 A;  5FI6 A;  3G34 A;  5GLB A;  1PZP A;  2HGV A;  3HLW A;  3ZNT A;  3FWL A;  5EE8 A;  3EQU A;  1NYY A;  4GHI A;  4OP8 A;  3OPL A;  3LID A;  1ZLI B;  1G28 A;  3IF5 A;  1CI8 A;  4R23 A;  4UA6 A;  1BTL A;  3HUM A;  4U0X A;  3CIT A;  4DF6 A;  4ZRR A;  4HOI A;  3R7W B;  3F1N A;  5GL9 A;  2ZQA A;  3LR4 A;  2V9A A;  5F1G A;  3NHQ A;  1W8Y A;  3PXP A;  4JF4 A;  2FH5 A;  3DTI A;  3BFC A;  4GHI B;  4P85 A;  4S2P A;  4GOG A;  1S67 L;  4EER A;  1K38 A;  2GNX A;  2SH1 A;  4ZJ1 A;  2XH9 A;  1FSY A;  2G7U A;  2JBF A;  3BRM A;  5DKL A;  2W3D A;  5IU1 A;  3MYV A;  4E3L A;  1BZA A;  3E4O A;  3EGX C;  1VHM A;  1BUE A;  3FKV A;  2FZ0 A;  5F82 A;  1TEM A;  3T4Q A;  4O8G A;  4KZ4 A;  1GSW A;  3QHY A;  1STZ A;  2KX6 A;  3UB6 A;  3W4Q A;  4S2N A;  1Y54 A;  4EQI A;  4U3T A;  2VZW A;  5CER A;  4JLF A;  1L2S A;  4K91 A;  3C8C A;  4QY6 A;  4FCF A;  5GLD A;  4PM9 A;  5AJG A;  3QP8 A;  1ES2 A;  5AVE A;  4E3O A;  2OWJ A;  1YM1 A;  1SH1 A;  5HAR A;  5L8M A;  1LSW A;  5HSQ A;  5L10 A;  3GV9 A;  1BDS A;  2XDM A;  2D02 A;  4Y3I A;  1XGJ A;  3E2K A;  5HL1 A;  2H0T A;  1YQS A;  2V1A A;  2VEA A;  2FFY A;  4HNB A;  2QJ5 A;  4HEF A;  2Y2H A;  3N4I A;  2UWX A;  3LO7 A;  3WWX A;  4GZB A;  1WQK A;  3UPO A;  3ZCZ A;  1NRF A;  3WRT A;  1H3Q A;  1NZO A;  1TS0 A;  5CHU A;  3TRC A;  3A3J A;  2ZOH A;  3UN7 A;  1FIK A;  4KZA A;  3QP6 A;  4BBT A;  4RX3 A;  3RJU A;  5AQ7 A;  4QB8 A;  4GB7 A;  4MBK A;  2WZX A;  1YAX A;  4ZJ2 A;  4GLQ A;  4OON A;  4DDS A;  2XD1 A;  4KZB A;  1MZU A;  2GJ3 A;  2E8I A;  5FQM A;  4UA9 A;  3DWZ A;  3HLC A;  4E3M A;  3C4P A;  3IHA A;  3MXR A;  2JC7 A;  4B88 A;  3VP2 A;  2V8F A;  2XFT A;  3V39 A;  3VMA A;  1K6S A;  1SKF A;  2H10 A;  4X68 A;  3TSG A;  4OPQ A;  4YIN A;  1BSG A;  5FEF A;  3IXH A;  2ZC6 B;  1IOU A;  4H8R A;  4CLC D;  2Y8H A;  3DBA A;  1MKM A;  2Y2J A;  1T1B A;  1DJC A;  5F69 A;  5EOO A;  4X6T A;  1KE0 A;  4M4X A;  3T1S A;  4EBN A;  1PWG A;  4JGO A;  3ZG9 B;  3PBS A;  3KO6 A;  3LI9 A;  1MXO A;  1OTD A;  2YKF A;  5HW3 A;  2BG1 A;  3A3D A;  3G4P A;  3WS1 A;  4LFU A;  3V67 A;  1DY6 A;  1GHP A;  4BBV A;  4ID4 A;  4WZ5 A;  3CG5 A;  3Q1F A;  5HWT A;  1FCN A;  1S66 L;  3KSF A;  5FI7 A;  3ZYT A;  3UB5 P;  3CI6 A;  3TG9 A;  2WGV A;  2ZJ9 A;  3N7W A;  1S1Y A;  1YMS A;  3PHY A;  3T4L A;  1P9W A;  5FAS A;  4EES A;  2H28 A;  4N9K A;  3OPR A;  3V5M A;  2OSU A;  4YOF A;  1X0O A;  5DFY A;  1ONH A;  1O07 A;  3A3I A;  5KIZ A;  4HY8 A;  3LIE A;  3N6I A;  1V9Y A;  2W3H A;  1NRJ A;  3IF4 A;  3B42 A;  1MC0 A;  4CPK A;  1JTD A;  4B4X A;  1IYP A;  1SCW A;  1WA9 A;  4NXB A;  2OLU A;  2Y2Q A;  2MN3 A;  3UMD A;  5F6A A;  1XJ4 A;  2QHK A;  5EVE A;  2HZ5 A;  3DW0 A;  3HLG A;  1GSX A;  2X01 A;  5A8B A;  2W1T B;  4BLM A;  1CQA A;  2RNG A;  2Q9M A;  3BLM A;  2GZA A;  4GD8 A;  3S7P A;  3VSK A;  4GS9 A;  4LRY C;  2QYB A;  1OPX A;  2DNS A;  5DTK A;  1PW1 A;  1H8M A;  1UGU A;  5DJT A;  1GHI A;  1IYO A;  5CRF A;  1Z6F A;  2WAE A;  1NY0 A;  4N92 A;  2MUB A;  4OP5 A;  2P08 A;  1I2S A;  2D01 A;  4JF5 A;  3IWI A;  4O0P A;  3IWQ A;  3LR0 A;  3PBN A;  1FIL A;  5DJU A;  1VEU A;  4WBG A;  4JKT A;  3LY4 A;  4K0X A;  1KDS A;  3K2N A;  1YLW A;  5J8X A;  3EQV A;  4E6X A;  2JR3 A;  2PD7 A;  3ZG8 B;  5CTM A;  1AHL A;  1W5D A;  2WKE A;  1E3U A;  3F1N B;  4GKU A;  2ZLY A;  3JPU A;  3QP1 A;  1K4F A;  4N1H A;  4PPR A;  1L0G A;  2PHY A;  5HAI A;  3FKW A;  3SH7 A;  2WKI A;  2BDS A;  1YPR A;  1LI9 A;  3ZVT A;  3C4O A;  3IX8 A;  5I94 A;  4HJ6 A;  4H6J A;  3ULF A;  2VA0 A;  2ZM2 A;  2L1M A;  3L9K A;  3BFF A;  3K3C A;  2Y2P A;  5D3O A;  2ZMF A;  4E3K A;  5CGS A;  1XJ2 A;  1TDL A;  2J3T D;  5DF9 A;  1E4D A;  4EWF A;  3SH8 A;  4Y15 A;  4FSF A;  4I38 A;  3MXS A;  3LR5 A;  3BYD A;  3OCL A;  1OT6 A;  2PRF A;  2WK0 A;  2XFS A;  1FSW A;  2KDK A;  5GHZ A;  2Y59 A;  3MQO A;  3UDI A;  3CJM A;  5HPF A;  4S2O A;  4MDZ A;  2JTO A;  1K55 A;  5LBR A;  3T4K A;  1BYW A;  2JKF A;  4PHT A;  5DVA A;  2P74 A;  3IBJ A;  1LLB A;  1MWR A;  5F83 A;  1YLZ A;  3B33 A;  2CMN A;  1XFQ A;  3UO9 A;  1MBL A;  2C5W B;  4PM5 A;  3DTK A;  1V9Z A;  5EOE A;  3H7W B;  3JVV A;  5EVI D;  1Q2Q A;  2B18 A;  3T1Q B;  2Y2I A;  1YT4 A;  1H8Y A;  1P9R A;  3QNB A;  5E2G A;  3FYZ A;  1ONG A;  3VP1 A;  4YFM A;  5KSH A;  5CXW A;  2ZL1 A;  1B8W A;  2ZM0 A;  4DXC A;  1LSX A;  3VFF A;  2VGJ A;  4OQH A;  3VSL A;  5TBM B;  2Z6C A;  2Q0O A;  4S2K A;  3PBT A;  2WAD A;  1HVB A;  1NYM A;  2PU2 A;  3DTE A;  2WKH A;  4KZ6 A;  3WS5 A;  3H9W A;  1YLP A;  4KQQ A;  4NK3 A;  1MWS A;  1KE3 A;  4I3A A;  3VOZ A;  1L0D A;  1Z09 A;  5IT5 A;  1K25 A;  1IEL A;  3F1P B;  2XK1 A;  2H9X A;  1BLS A;  3V50 A;  4BWI A;  4QJG A;  2P9V A;  3E0Y A;  1CI9 A;  4BL3 A;  5EVL A;  1GA0 A;  3GR2 A;  4B93 A;  2A24 B;  3MQ0 A;  2M7U A;  3SS4 A;  2PYP A;  4HBU A;  4KZ7 A;  3OC2 A;  1LSV A;  3UPN A;  4YNR A;  4K0W A;  3WS0 A;  1ERQ A;  3EWK A;  3ZVW A;  5EUA A;  5J3W A;  2L4R A;  3E2L A;  5FQK A;  1M40 A;  3N8S A;  2O9C A;  4MNR A;  1ZC2 A;  4F94 A;  2EX2 A;  1LL8 A;  2OLV A;  1A0K A;  1D6B A;  2VGL S;  3E4P A;  1OJ5 A;  2IWC A;  3D4U B;  5M18 A;  1W79 A;  4UQI S;  2A49 A;  4NXF A;  3MZD A;  1MY8 A;  4S2J A;  5TGF A;  4CJN A;  2YKH A;  2E8J A;  2W27 A;  3VP3 A;  5K5B A;  3G30 A;  1SKO B;  1PI4 A;  5HWV A;  1VM1 A;  4DN0 A;  2QSH A;  2CC1 A;  2UV0 E;  4XUZ A;  4EU0 A;  3NOU C;  5E2E A;  1DRM A;  1D1J A;  5BOH A;  3EOI A;  1G6O A;  3LYX A;  4PM6 A;  2O0Y A;  2HV1 A;  1GKU B;  1ESU A;  2XF3 A;  3IH8 A;  5M19 A;  3NOP C;  4U0T A;  3W4P A;  3UNW A;  4OPY A;  5CX7 A;  1ZKJ A;  1ZUE A;  4GV5 A;  1S4R A;  1J9M A;  5TR7 A;  4MMN A;  5E43 A;  5EPH A;  2J8Y A;  3A0V A;  1VB6 A;  3C7V A;  3NY4 A;  4GD6 A;  1Y4O A;  2W1T A;  2ZMA A;  1N9B A;  3FZC A;  3QP4 A;  3FG8 A;  3H82 B;  2I9V A;  5GLC A;  3HUO A;  1ESI A;  3CAX A;  5CED A;  4WM9 A;  1L0E A;  4WEJ A;  1VET A;  2VGL M;  3FPW A;  3T4J A;  2XA7 S;  3H7W A;  4BEN A;  2DRW A;  1ES5 A;  3IQA A;  5F1F A;  2XD5 A;  4OLG A;  3O5Y A;  3S7N A;  3MF0 A;  5G4Z A;  3KYE A;  3HLB A;  2IKE A;  4PM8 A;  4DDY A;  4A5R A;  2OV5 A;  3VOY A;  5L2F A;  5A91 A;  1JWZ A;  2H0Y A;  4UAA A;  2W0N A;  5DTT A;  1BLC A;  4I39 A;  4S2N C;  3IS2 A;  4ETX A;  1DP6 A;  4R3B A;  4Y0O A;  2IWD A;  4KZ5 A;  4BJP A;  3LY3 A;  3AGF A;  4ARZ B;  1DJA A;  3HJI A;  3CPT B;  2O9A A;  2J80 A;  1OJG A;  4P6Z M;  2G2W A;  4DMZ A;  5G18 A;  2Y55 A;  1EW0 A;  1ES3 A;  3VP4 A;  3SOI A;  4B4Z A;  1Q2P A;  4JGP A;  3V3S A;  1I5Q A;  1NJ4 A;  3MXQ A;  1SHV A;  4ZAM A;  3ZHH A;  2Y79 A;  3ZDJ A;  2Y2N A;  2PBY A;  1WYC A;  1IYS A;  3B47 A;  1ZG4 A;  2HJ9 C;  1I2W A;  4O01 A;  1XFN A;  3OCN A;  3HCY A;  4G3V A;  5FAO A;  5F68 A;  2ZMV A;  2V1B A;  4OQG A;  4OPZ A;  3GDI A;  1D06 A;  1P97 A;  4RX2 A;  4GNU A;  5E2F A;  2WYX A;  1W63 Q;  1CJF A;  1TS7 A;  2W3E A;  2X71 A;  4MCW A;  4ZBE A;  3MSH A;  3F1O A;  3OZH A;  4QHC A;  3G2Z A;  2ZC4 B;  4GJ4 A;  4GDN A;  1F2K A;  1YLT A;  4ESP A;  2I72 A;  4GN2 A;  4ZTK A;  2O99 A;  2JKT I;  4IBR A;  2PYR A;  3GVB A;  2EXB A;  1YSQ A;  3BQA A;  3T4S A;  2Y91 A;  3NUL A;  1IKG A;  2HDS A;  2Y4A A;  2WKP A;  1MPL A;  4Q0J A;  2XQZ A;  4C6Y A;  3HLF A;  1DJB A;  4X1L A;  2ZQ8 A;  1IEM A;  2EXA A;  4ZDX A;  1TS8 A;  3HRE A;  5TJJ A;  4GDB A;  3Q7V B;  1PYY A;  4Z9Q A;  2XGN A;  1EWZ A;  4JXV A;  2PT7 A;  4S2L A;  2PU4 A;  1RGY A;  4HQA A;  4HHD A;  3KEZ A;  2XLN A;  3PBO A;  3KYZ A;  3Q07 A;  2JKT M;  2HP5 A;  3CUE A;  1PNE A;  4HIA A;  3FV7 A;  1KDW A;  3BLS A;  2WGW B;  2P04 A;  1OTB A;  4IBX A;  3KSG A;  3HVF A;  1W7F A;  3CMZ A;  4D60 A;  4FUW A;  4YWZ A;  3PTE A;  5I5L A;  3LUQ A;  1S4S A;  3O3V A;  1K57 A;  4KQO A;  3GQZ A;  4CLC E;  3QP5 A;  5EVI C;  1K6R A;  3SW1 A;  2XRN A;  4JBF A;  1N9L A;  2QSF A;  2J9O A;  4DXB A;  1KOU A;  1QMF A;  3UPP A;  5DTS A;  3AGD A;  1LI0 A;  5CHM A;  3NBL A;  4LV3 A;  4EEU A;  1TDG A;  4N1X A;  2W3G A;  3IT9 A;  4M3K A;  4EXO A;  2PR6 A;  3SZT A;  5CEC A;  1TVF A;  2XR0 A;  3IF6 A;  3SS3 A;  1SKO A;  4LGW A;  2XEP A;  3LIA A;  2V1Z A;  3T4T A;  5A90 A;  3UDF A;  2HDR A;  3LGO A;  4II7 A;  1GA9 A;  2V2F F;  3B3X A;  4OOY A;  2RCX A;  4LEN A;  4DRT A;  2W3F A;  3RH8 B;  4KUO A;  2ZD8 A;  1XKZ A;  2QKP A;  4S2I A;  1OTA A;  2OWH A;  3PBQ A;  4UHU A;  1YLJ A;  1CEF A;  3IH9 A;  3T1X A;  1H5X A;  1NXY A;  4FH2 A;  2JKR M;  3IXB A;  1XX2 A;  3MZE A;  4L9G A;  1PZO A;  4HES A;  3UE6 A;  5HDC A;  4KQR A;  1UWN X;  5AQ9 A;  3MKF A;  5EFW A;  4WMC D;  3M2J A;  4OH0 A;  2DCF A;  4DJ2 A;  2NUT C;  5FQ9 A;  2VV8 A;  1W8Q A;  2ZC3 B;  5E2H A;  5FEG A;  1M6K A;  2EX8 A;  4KQD A;  5GHX A;  2EX6 A;  3Q82 A;  3T4O A;  4NKP A;  4NG2 A;  4UQI M;  5CGW A;  3LIF A;  5EV0 A;  3BJN A;  3LEQ A;  2JKR I;  3CLO A;  3RFB A;  4JGR A;  5GHY A;  2K31 A;  2L0W A; 
#chains in the Genus database with same CATH homology
 2QJ5 A;  2PDR A;  4UQI S;  4NXF A;  1T1A A;  2YKH A;  3IS2 B;  1N9N A;  2JHE A;  2W27 A;  1WQK A;  3F1O B;  1TD5 A;  3OLO A;  3E4Q A;  4CLC B;  1H3Q A;  1TS0 A;  5K5B A;  1JNU A;  4WN5 A;  5TBM A;  3TRC A;  4F3L A;  5HWV A;  4DN0 A;  2QSH A;  2ZOH A;  3P7N A;  4EU0 A;  3NOU C;  1DRM A;  2K7S A;  2LB5 A;  3EOI A;  3U2A A;  2O9B A;  4BBT A;  1D7E A;  1G6O A;  3LYX A;  2O0Y A;  2HV1 A;  2JN7 A;  4OOL A;  1DP8 A;  3GEC A;  3R7W A;  1DP9 A;  4HJ4 A;  4HH2 A;  4QPR A;  2NUP C;  4LRX C;  1YAX A;  4UEY A;  1ZHH B;  3CWF A;  3NOP C;  4GLQ A;  4ETZ A;  1MZU A;  2GJ3 A;  5CX7 A;  4GS9 B;  1ZUE A;  4GV5 A;  3A0S A;  1S4R A;  3VE4 A;  1WXN A;  4XT2 A;  4L9F A;  2EWV A;  4MMN A;  3A0V A;  3D3O A;  3ICY A;  1VB6 A;  4K08 A;  3LR3 A;  5HDD A;  2HJE A;  2W1T A;  3VE3 A;  4WEK A;  3TE8 A;  5G4Y A;  3A0R A;  2J3W A;  4EEP A;  3FG8 A;  3E98 A;  3H82 B;  4EUV A;  3BQ8 A;  1YKD A;  2I9V A;  3TW8 A;  4YIR A;  3C2W A;  4B9O A;  4CLC C;  3IBR A;  4GCZ A;  5HL6 A;  4PAU A;  3CAX A;  4RQ9 A;  5HPI A;  5J4E A;  4HP4 A;  1NLY A;  2A2L A;  4XT2 B;  3EGD C;  4WEJ A;  2VGL M;  2J3T C;  1TF1 A;  5J7E A;  3FPW A;  1IOU A;  4CLC A;  3T4J A;  4CLC D;  2Y8H A;  3DBA A;  1P0Z A;  1MKM A;  2XA7 S;  3H7W A;  1NWZ A;  4P6Z S;  1T1B A;  2HF6 A;  3O5Y A;  3S7N A;  3MF0 A;  5G4Z A;  5F69 A;  5HZH A;  2IKE A;  3UB7 A;  3C38 A;  4R38 A;  5MC7 A;  4M4X A;  4JGO A;  3PBS A;  4L9E A;  3MCX A;  3KO6 A;  3LI9 A;  3KX0 X;  1OTD A;  2YKF A;  3OBF A;  1OT9 A;  4HP9 A;  3BY9 A;  2KOI A;  3V67 A;  5HWW A;  1IFQ A;  2W0N A;  4I39 A;  4BBV A;  5AVF A;  3MJQ A;  5HWT A;  1S66 L;  3KSF A;  3IS2 A;  4ETX A;  3ZYT A;  1DP6 A;  4EW7 A;  4MN5 A;  3W2Z A;  3CI6 A;  5HD5 A;  1GSV A;  5FL3 A;  1S1Y A;  3PHY A;  3T4L A;  1P9W A;  4KUK A;  4EES A;  2H28 A;  1F5M A;  4Y2F A;  3KSI A;  4BJP A;  4YOF A;  1X0O A;  4ARZ B;  3HJI A;  5DFY A;  3H82 A;  4IJG A;  3S7O A;  1ZUF A;  2A24 A;  2O9A A;  3JVU A;  2J80 A;  4IUH A;  5KIZ A;  4HY8 A;  3LIE A;  3MQQ A;  1V9Y A;  4H6J B;  2W3H A;  1NRJ A;  1OJG A;  1T1C A;  4P6Z M;  4DMZ A;  3B42 A;  1MC0 A;  1Y28 A;  2XRO A;  1WA9 A;  4Q0I A;  1EW0 A;  3LIC A;  4NXB A;  2MN3 A;  3C30 A;  3UMD A;  1TS6 A;  5F6A A;  2OAQ 1;  1XJ4 A;  2QHK A;  3OOV A;  4JGP A;  2K2N A;  3MXQ A;  3UB9 A;  1GSX A;  2Y79 A;  5A8B A;  2W1T B;  4NEE D;  1ZTU A;  3EEH A;  5IS1 A;  3B47 A;  3UME A;  2HJ9 C;  2LB9 A;  1Z99 A;  2RNG A;  1UWP X;  4BMW A;  1N9O A;  2GZA A;  4L0L A;  4O01 A;  4I5S A;  3S7P A;  4EET B;  4HJ3 A;  2B9K A;  4GS9 A;  4LRY C;  2QYB A;  2XXL A;  2K2X A;  1OPX A;  1XFN A;  1H8M A;  5DJT A;  1UGU A;  3OCN A;  4NXE A;  3ZQ5 A;  3HCY A;  4G3V A;  4E04 A;  3G6O A;  3T50 A;  4LRZ E;  2MUB A;  1SHI A;  2P08 A;  2D01 A;  3VV4 A;  3F1P A;  5F68 A;  2ZMV A;  3BWL A;  4O0P A;  2V1B A;  2M1C A;  2EA9 A;  2WKR A;  3GDI A;  1D06 A;  3LR0 A;  1P97 A;  3PBN A;  2Z6D A;  2R78 A;  1W63 Q;  3KYQ A;  5DJU A;  2IKD A;  1TS7 A;  2W3E A;  3MR0 A;  5F5Y A;  4MCW A;  4BBU A;  2MJ6 A;  1YSP A;  4G3K A;  3PR6 A;  4WEL A;  3K2N A;  3F1O A;  1OTI A;  3EQV A;  3EEA A;  3BY8 A;  2JR3 A;  2PD7 A;  3BW6 A;  4WL9 A;  4GJ4 A;  1AHL A;  3F1N B;  3KSH A;  1LT0 A;  4CQH A;  4OOM A;  4WUJ A;  4IHQ A;  2DLA A;  1W63 M;  2O99 A;  4WLA A;  2INW A;  2JKT I;  2KLI A;  2PHY A;  2PYR A;  3PBR A;  2BDS A;  3UE3 A;  1YSQ A;  3BQA A;  3FC7 A;  4MN7 A;  3T4S A;  3UB8 A;  4HJ6 A;  4Y5F A;  4H6J A;  3ULF A;  2VA0 A;  2WKP A;  2L1M A;  4Q0J A;  3NJA A;  3K3C A;  2ZMF A;  4Q0H A;  1F9I A;  1XJ2 A;  2J3T D;  4R6L A;  5DF9 A;  3S7Q A;  2VLG A;  3D72 A;  1TS8 A;  4LPZ A;  4FSF A;  4I38 A;  3LR5 A;  5TJJ A;  3OCL A;  3K3D A;  1OT6 A;  2QJ7 A;  2XA7 M;  2QSG A;  2V0W A;  4I3J A;  2KDK A;  4HH3 A;  3MQO A;  2PT7 A;  5HPF A;  4DJ3 A;  1F98 A;  4MDZ A;  4HQA A;  2JTO A;  4EQ1 A;  4HHD A;  3KEZ A;  5C5K A;  5LBR A;  3T4K A;  3PBO A;  1BYW A;  3KYZ A;  2B02 A;  3P01 A;  4PHT A;  4JGQ A;  2JKT M;  2V0U A;  4GW9 A;  3CUE A;  2DMW A;  2VKS A;  5DKK A;  3IBJ A;  4HIA A;  2CMN A;  1ATX A;  2BAS A;  3B33 A;  1XFQ A;  2P7J A;  2GX5 A;  2P04 A;  1V9Z A;  3H7W B;  3JVV A;  3R4K A;  1OTB A;  2HGV A;  2OAP 1;  3KSG A;  2B18 A;  2PD8 A;  3EQU A;  3CUE C;  4GHI A;  4YWZ A;  2XSS A;  4R3A A;  5I5L A;  3LID A;  3LUQ A;  4R70 A;  1S4S A;  1ZLI B;  4KQO A;  1G28 A;  3MMH A;  4CLC E;  1P9R A;  2VJW A;  2IA2 A;  1APF A;  3SW1 A;  2XRN A;  3TJZ C;  5KSH A;  1N9L A;  2OOL A;  2QSF A;  1NLZ A;  2VX8 A;  1KOU A;  1ZLH B;  3LMS B;  1B8W A;  3CIT A;  2PR5 A;  4ZRR A;  4HOI A;  3R7W B;  4EEU A;  3F1N A;  1LSX A;  2W3G A;  1XJ6 A;  3LIB A;  3LR4 A;  4EXO A;  2V9A A;  2ZBB A;  2PR6 A;  3NHQ A;  3PYP A;  4F3L B;  3PXP A;  3NOT C;  5TBM B;  2Z6C A;  2FH5 A;  3PBT A;  3LIA A;  4GHI B;  3T4T A;  3FPV A;  4HNB A;  1S67 L;  4EER A;  1XJ3 A;  2GNX A;  3H9W A;  4II7 A;  2SH1 A;  4I3A A;  4WF0 A;  4Z1W A;  2G7U A;  5IT5 A;  1S1Z A;  4PKY G;  2WKQ A;  2W3F A;  4FOF A;  3RH8 B;  3F1P B;  4KUO A;  4MN6 A;  5DKL A;  2W3D A;  2H9X A;  5IU1 A;  3RTY A;  3MYV A;  2QKP A;  2QWS A;  3E4O A;  4AFI A;  2ZOI A;  3EGX C;  4BWI A;  1OTE A;  1VHM A;  1OTA A;  2FZ0 A;  2OWH A;  3LI8 A;  3PBQ A;  5HDS A;  3E0Y A;  4NXG A;  3T4Q A;  4O8G A;  5DFX A;  4PKY A;  2VV6 A;  1GSW A;  2JKR M;  4B93 A;  1STZ A;  2KX6 A;  3UB6 A;  3HJK A;  4L9G A;  2A24 B;  2VV7 A;  3MQ0 A;  2M7U A;  4HI4 A;  2VZW A;  3UE6 A;  5HDC A;  2EWW A;  2PYP A;  1UWN X;  1T18 A;  3MFX A;  3OC2 A;  5EFW A;  3C8C A;  2W1R A;  1LSV A;  4YNR A;  1ODV A;  4DJ2 A;  2NUT C;  3EWK A;  5J3W A;  3VOL A;  4I3I A;  5AJG A;  2VV8 A;  5AVE A;  2L4R A;  2OWJ A;  1SH1 A;  4IUK A;  2O9C A;  3LFV A;  1T19 A;  4ME4 A;  5L8M A;  1LSW A;  4KQD A;  5HD3 A;  5HSQ A;  3T4O A;  4NKP A;  4UQI M;  1LL8 A;  1BDS A;  3LIF A;  3BJN A;  2D02 A;  4LLO B;  2M7V A;  2JKR I;  3CLO A;  4Y3I A;  3RFB A;  1D6B A;  2VGL S;  3E4P A;  1OJ5 A;  4ARZ A;  4JGR A;  4G3W A;  2V1A A;  3D4U B;  1H5O A;  2VEA A;  2K31 A;  2L0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...