1CR8A

Low density lipoprotein receptor-related protein complement repeat 8
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
42
structure length
42
Chain Sequence
PGGCHTDEFQCRLDGLCIPLRWRCDGDTDCMDSSDEKSCEGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of complement-like repeat CR8 from the low density lipoprotein receptor-related protein.
pubmed doi rcsb
molecule keywords PROTEIN (LOW DENSITY LIPOPROTEIN RECEPTOR RELATED PROTEIN)
molecule tags Lipid binding protein
source organism Homo sapiens
total genus 7
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 1998-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 1cr8A00
1D2LA 1LDRA 1K7BA 1CR8A 2JM4A 1XFEA 1J8EA 1F5YA 2LGPA 2M96A 2FYLB 1LDLA 1JRFA 2KNYA 2FYJA 2I1PA 2M0PA 2FCWB 2KNXA 2M7PA 1N7DA 1D2JA
chains in the Genus database with same CATH superfamily
1D2LA 1LDRA 1K7BA 1CR8A 2JM4A 1XFEA 1J8EA 1F5YA 2LGPA 2M96A 2FYLB 1LDLA 1JRFA 2KNYA 2FYJA 2I1PA 2M0PA 2FCWB 2KNXA 2M7PA 1N7DA 1D2JA
chains in the Genus database with same CATH topology
1D2LA 1LDRA 1K7BA 1CR8A 2JM4A 1XFEA 1J8EA 1F5YA 2LGPA 2M96A 2FYLB 1LDLA 1JRFA 2KNYA 2FYJA 2I1PA 2M0PA 2FCWB 2KNXA 2M7PA 1N7DA 1D2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D2L A;  1LDR A;  1K7B A;  1CR8 A;  2JM4 A;  1XFE A;  1J8E A;  1F5Y A;  2LGP A;  2M96 A;  2FYL B;  1LDL A;  1JRF A;  2KNY A;  2FYJ A;  2I1P A;  2M0P A;  2FCW B;  2KNX A;  2M7P A;  1N7D A;  1D2J A; 
#chains in the Genus database with same CATH topology
 1D2L A;  1LDR A;  1K7B A;  1CR8 A;  2JM4 A;  1XFE A;  1J8E A;  1F5Y A;  2LGP A;  2M96 A;  2FYL B;  1LDL A;  1JRF A;  2KNY A;  2FYJ A;  2I1P A;  2M0P A;  2FCW B;  2KNX A;  2M7P A;  1N7D A;  1D2J A; 
#chains in the Genus database with same CATH homology
 1D2L A;  1LDR A;  1K7B A;  1CR8 A;  2JM4 A;  1XFE A;  1J8E A;  1F5Y A;  2LGP A;  2M96 A;  2FYL B;  1LDL A;  1JRF A;  2KNY A;  2FYJ A;  2I1P A;  2M0P A;  2FCW B;  2KNX A;  2M7P A;  1N7D A;  1D2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...