1J8EA

Crystal structure of ligand-binding repeat cr7 from lrp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
44
structure length
44
Chain Sequence
GSHSCSSTQFKCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcium coordination and pH dependence of the calcium affinity of ligand-binding repeat CR7 from the LRP. Comparison with related domains from the LRP and the LDL receptor.
pubmed doi rcsb
molecule keywords LOW-DENSITY LIPOPROTEIN RECEPTOR-RELATED PROTEIN 1
molecule tags Signaling protein
source organism Homo sapiens
total genus 14
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2001-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 1j8eA00
2FCWB 2M96A 1F5YA 1LDRA 2FYJA 1JRFA 1CR8A 1XFEA 1D2JA 2JM4A 1K7BA 2M0PA 2FYLB 1LDLA 2I1PA 2LGPA 1D2LA 2M7PA 2KNXA 1N7DA 1J8EA 2KNYA
chains in the Genus database with same CATH superfamily
2FCWB 2M96A 1F5YA 1LDRA 2FYJA 1JRFA 1CR8A 1XFEA 1D2JA 2JM4A 1K7BA 2M0PA 2FYLB 1LDLA 2I1PA 2LGPA 1D2LA 2M7PA 2KNXA 1N7DA 1J8EA 2KNYA
chains in the Genus database with same CATH topology
2FCWB 2M96A 1F5YA 1LDRA 2FYJA 1JRFA 1CR8A 1XFEA 1D2JA 2JM4A 1K7BA 2M0PA 2FYLB 1LDLA 2I1PA 2LGPA 1D2LA 2M7PA 2KNXA 1N7DA 1J8EA 2KNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCW B;  2M96 A;  1F5Y A;  1LDR A;  2FYJ A;  1JRF A;  1CR8 A;  1XFE A;  1D2J A;  2JM4 A;  1K7B A;  2M0P A;  2FYL B;  1LDL A;  2I1P A;  2LGP A;  1D2L A;  2M7P A;  2KNX A;  1N7D A;  1J8E A;  2KNY A; 
#chains in the Genus database with same CATH topology
 2FCW B;  2M96 A;  1F5Y A;  1LDR A;  2FYJ A;  1JRF A;  1CR8 A;  1XFE A;  1D2J A;  2JM4 A;  1K7B A;  2M0P A;  2FYL B;  1LDL A;  2I1P A;  2LGP A;  1D2L A;  2M7P A;  2KNX A;  1N7D A;  1J8E A;  2KNY A; 
#chains in the Genus database with same CATH homology
 2FCW B;  2M96 A;  1F5Y A;  1LDR A;  2FYJ A;  1JRF A;  1CR8 A;  1XFE A;  1D2J A;  2JM4 A;  1K7B A;  2M0P A;  2FYL B;  1LDL A;  2I1P A;  2LGP A;  1D2L A;  2M7P A;  2KNX A;  1N7D A;  1J8E A;  2KNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...