2KNYA

Fusion construct of cr17 from lrp-1 and apoe residues 130-149
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
80
structure length
80
Chain Sequence
GSKLEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYNSTGSGSGSGSTEELRVRLASHLRKLRKRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the minimal interface between ApoE and LRP.
pubmed doi rcsb
molecule keywords LRP-1, linker, Apo-E
molecule tags Metal binding protein
source organism Homo sapiens
total genus 8
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 2knyA00
2I1PA 2LGPA 1J8EA 1D2JA 1F5YA 1K7BA 2M96A 1LDRA 1LDLA 2M7PA 2FYJA 1XFEA 2JM4A 1D2LA 2FCWB 2M0PA 1N7DA 2KNYA 1CR8A 2FYLB 1JRFA 2KNXA
chains in the Genus database with same CATH superfamily
2I1PA 2LGPA 1J8EA 1D2JA 1F5YA 1K7BA 2M96A 1LDRA 1LDLA 2M7PA 2FYJA 1XFEA 2JM4A 1D2LA 2FCWB 2M0PA 1N7DA 2KNYA 1CR8A 2FYLB 1JRFA 2KNXA
chains in the Genus database with same CATH topology
2I1PA 2LGPA 1J8EA 1D2JA 1F5YA 1K7BA 2M96A 1LDRA 1LDLA 2M7PA 2FYJA 1XFEA 2JM4A 1D2LA 2FCWB 2M0PA 1N7DA 2KNYA 1CR8A 2FYLB 1JRFA 2KNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I1P A;  2LGP A;  1J8E A;  1D2J A;  1F5Y A;  1K7B A;  2M96 A;  1LDR A;  1LDL A;  2M7P A;  2FYJ A;  1XFE A;  2JM4 A;  1D2L A;  2FCW B;  2M0P A;  1N7D A;  2KNY A;  1CR8 A;  2FYL B;  1JRF A;  2KNX A; 
#chains in the Genus database with same CATH topology
 2I1P A;  2LGP A;  1J8E A;  1D2J A;  1F5Y A;  1K7B A;  2M96 A;  1LDR A;  1LDL A;  2M7P A;  2FYJ A;  1XFE A;  2JM4 A;  1D2L A;  2FCW B;  2M0P A;  1N7D A;  2KNY A;  1CR8 A;  2FYL B;  1JRF A;  2KNX A; 
#chains in the Genus database with same CATH homology
 2I1P A;  2LGP A;  1J8E A;  1D2J A;  1F5Y A;  1K7B A;  2M96 A;  1LDR A;  1LDL A;  2M7P A;  2FYJ A;  1XFE A;  2JM4 A;  1D2L A;  2FCW B;  2M0P A;  1N7D A;  2KNY A;  1CR8 A;  2FYL B;  1JRF A;  2KNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...