1LDLA

Three-dimensional structure of a cysteine-rich repeat from the low-density lipoprotein receptor
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
46
structure length
46
Chain Sequence
AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of a cysteine-rich repeat from the low-density lipoprotein receptor.
pubmed doi rcsb
molecule keywords LOW-DENSITY LIPOPROTEIN RECEPTOR
molecule tags Binding protein
source organism Homo sapiens
total genus 2
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1995-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 1ldlA00
2M96A 1N7DA 2FCWB 2KNYA 2JM4A 1D2LA 2I1PA 1LDRA 1D2JA 2LGPA 2FYLB 2FYJA 1LDLA 1J8EA 1CR8A 2KNXA 1JRFA 1XFEA 1K7BA 1F5YA 2M7PA 2M0PA
chains in the Genus database with same CATH superfamily
2M96A 1N7DA 2FCWB 2KNYA 2JM4A 1D2LA 2I1PA 1LDRA 1D2JA 2LGPA 2FYLB 2FYJA 1LDLA 1J8EA 1CR8A 2KNXA 1JRFA 1XFEA 1K7BA 1F5YA 2M7PA 2M0PA
chains in the Genus database with same CATH topology
2M96A 1N7DA 2FCWB 2KNYA 2JM4A 1D2LA 2I1PA 1LDRA 1D2JA 2LGPA 2FYLB 2FYJA 1LDLA 1J8EA 1CR8A 2KNXA 1JRFA 1XFEA 1K7BA 1F5YA 2M7PA 2M0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M96 A;  1N7D A;  2FCW B;  2KNY A;  2JM4 A;  1D2L A;  2I1P A;  1LDR A;  1D2J A;  2LGP A;  2FYL B;  2FYJ A;  1LDL A;  1J8E A;  1CR8 A;  2KNX A;  1JRF A;  1XFE A;  1K7B A;  1F5Y A;  2M7P A;  2M0P A; 
#chains in the Genus database with same CATH topology
 2M96 A;  1N7D A;  2FCW B;  2KNY A;  2JM4 A;  1D2L A;  2I1P A;  1LDR A;  1D2J A;  2LGP A;  2FYL B;  2FYJ A;  1LDL A;  1J8E A;  1CR8 A;  2KNX A;  1JRF A;  1XFE A;  1K7B A;  1F5Y A;  2M7P A;  2M0P A; 
#chains in the Genus database with same CATH homology
 2M96 A;  1N7D A;  2FCW B;  2KNY A;  2JM4 A;  1D2L A;  2I1P A;  1LDR A;  1D2J A;  2LGP A;  2FYL B;  2FYJ A;  1LDL A;  1J8E A;  1CR8 A;  2KNX A;  1JRF A;  1XFE A;  1K7B A;  1F5Y A;  2M7P A;  2M0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...