The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
11
|
sequence length |
45
|
structure length |
45
|
Chain Sequence |
GSPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
NMR solution structure of complement-like repeat CR3 from the low density lipoprotein receptor-related protein. Evidence for specific binding to the receptor binding domain of human alpha(2)-macroglobulin.
pubmed doi rcsb |
molecule tags |
Signaling protein
|
source organism |
Homo sapiens
|
molecule keywords |
LIPOPROTEIN RECEPTOR RELATED PROTEIN
|
total genus |
11
|
structure length |
45
|
sequence length |
45
|
ec nomenclature | |
pdb deposition date | 1999-09-24 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00057 | Ldl_recept_a | Low-density lipoprotein receptor domain class A |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | Low-density Lipoprotein Receptor | Low-density Lipoprotein Receptor |
#chains in the Genus database with same CATH superfamily 1LDL A; 2KNY A; 2M96 A; 2M0P A; 2FYL B; 1D2L A; 2LGP A; 1JRF A; 2JM4 A; 2FYJ A; 2KNX A; 1D2J A; 1J8E A; 2M7P A; 1F5Y A; 1K7B A; 1XFE A; 2FCW B; 1LDR A; 1N7D A; 1CR8 A; 2I1P A; #chains in the Genus database with same CATH topology 1LDL A; 2KNY A; 2M96 A; 2M0P A; 2FYL B; 1D2L A; 2LGP A; 1JRF A; 2JM4 A; 2FYJ A; 2KNX A; 1D2J A; 1J8E A; 2M7P A; 1F5Y A; 1K7B A; 1XFE A; 2FCW B; 1LDR A; 1N7D A; 1CR8 A; 2I1P A; #chains in the Genus database with same CATH homology 1LDL A; 2KNY A; 2M96 A; 2M0P A; 2FYL B; 1D2L A; 2LGP A; 1JRF A; 2JM4 A; 2FYJ A; 2KNX A; 1D2J A; 1J8E A; 2M7P A; 1F5Y A; 1K7B A; 1XFE A; 2FCW B; 1LDR A; 1N7D A; 1CR8 A; 2I1P A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...