1T6T1

Putative protein from aquifex aeolicus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
108
structure length
108
Chain Sequence
b'PRNLSEWIKELKKASREAVILVEGKNDKKALSKFSIKNVIDLSGKRYADVVDMLEGKWEKVILLFDLDTHGERINQKMKELLSSQGFLVDENFRNFLKKWNIIHIEEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative protein
publication title putative protein from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 39
structure length 108
sequence length 108
chains with identical sequence 2
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 1t6t100
1EQNA 4O6PB 4EDKA 1D3YA 4EDRA 1DDEA 1VDDA 2V1CA 2AU3A 3VE5A 3VDUA 4EE1A 4EDVA 4O6OA 4EDTA 5GUJA 2Q2EA 4EDGA 3VDPA 4JCVA 2ZBKA 4E2KA 1T6T1 1DD9A 3B39A
chains in the Genus database with same CATH superfamily
1EQNA 4O6PB 4EDKA 1D3YA 4EDRA 1DDEA 1VDDA 2V1CA 2AU3A 3VE5A 3VDUA 4EE1A 4EDVA 4O6OA 4EDTA 5GUJA 2Q2EA 2I5RA 4EDGA 3VDPA 2FCJA 4JCVA 2ZBKA 4E2KA 1T6T1 1DD9A 3B39A
chains in the Genus database with same CATH topology
1EQNA 4O6PB 4EDKA 1D3YA 4EDRA 1DDEA 1VDDA 2V1CA 2AU3A 3VE5A 3VDUA 4EE1A 4EDVA 4O6OA 4EDTA 5GUJA 2Q2EA 4EDGA 3VDPA 4JCVA 2ZBKA 4E2KA 1T6T1 1DD9A 3B39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQN A;  4O6P B;  4EDK A;  1D3Y A;  4EDR A;  1DDE A;  1VDD A;  2V1C A;  2AU3 A;  3VE5 A;  3VDU A;  4EE1 A;  4EDV A;  4O6O A;  4EDT A;  5GUJ A;  2Q2E A;  4EDG A;  3VDP A;  4JCV A;  2ZBK A;  4E2K A;  1T6T 1;  1DD9 A;  3B39 A; 
#chains in the Genus database with same CATH topology
 1EQN A;  4O6P B;  4EDK A;  1D3Y A;  4EDR A;  1DDE A;  1VDD A;  2V1C A;  2AU3 A;  3VE5 A;  3VDU A;  4EE1 A;  4EDV A;  4O6O A;  4EDT A;  5GUJ A;  2Q2E A;  2I5R A;  4EDG A;  3VDP A;  2FCJ A;  4JCV A;  2ZBK A;  4E2K A;  1T6T 1;  1DD9 A;  3B39 A; 
#chains in the Genus database with same CATH homology
 1EQN A;  4O6P B;  4EDK A;  1D3Y A;  4EDR A;  1DDE A;  1VDD A;  2V1C A;  2AU3 A;  3VE5 A;  3VDU A;  4EE1 A;  4EDV A;  4O6O A;  4EDT A;  5GUJ A;  2Q2E A;  4EDG A;  3VDP A;  4JCV A;  2ZBK A;  4E2K A;  1T6T 1;  1DD9 A;  3B39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...