2I5RA

Structure of small toprim domain-containing protein from b. stearothermophilus in complex with mg2+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
115
structure length
115
Chain Sequence
b'AMRRVEKVIIVEGRSDKQKVAAVLNEPVVIVCTNGTISDARLEELADELEGYDVYLLADADEAGEKLRRQFRRMFPEAEHLYIDRAYREVAAAPIWHLAQVLLRARFDVRIESLM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toprim domain-containing protein
publication title Crystal structure and putative function of small Toprim domain-containing protein from Bacillus stearothermophilus.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
total genus 42
structure length 115
sequence length 115
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1360.20 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Toprim domain 2i5rA00
2FCJA 2I5RA
chains in the Genus database with same CATH superfamily
4O6PB 4E2KA 1EQNA 1VDDA 1D3YA 4EDTA 1DDEA 2Q2EA 4EDKA 2V1CA 3VDPA 4EDVA 4EDGA 2I5RA 4JCVA 2FCJA 3VE5A 1T6T1 1DD9A 4EE1A 4O6OA 5GUJA 3B39A 2ZBKA 3VDUA 2AU3A 4EDRA
chains in the Genus database with same CATH topology
2FCJA 2I5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCJ A;  2I5R A; 
#chains in the Genus database with same CATH topology
 4O6P B;  4E2K A;  1EQN A;  1VDD A;  1D3Y A;  4EDT A;  1DDE A;  2Q2E A;  4EDK A;  2V1C A;  3VDP A;  4EDV A;  4EDG A;  2I5R A;  4JCV A;  2FCJ A;  3VE5 A;  1T6T 1;  1DD9 A;  4EE1 A;  4O6O A;  5GUJ A;  3B39 A;  2ZBK A;  3VDU A;  2AU3 A;  4EDR A; 
#chains in the Genus database with same CATH homology
 2FCJ A;  2I5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...