2I5RA

Structure of small toprim domain-containing protein from b. stearothermophilus in complex with mg2+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
115
structure length
115
Chain Sequence
AMRRVEKVIIVEGRSDKQKVAAVLNEPVVIVCTNGTISDARLEELADELEGYDVYLLADADEAGEKLRRQFRRMFPEAEHLYIDRAYREVAAAPIWHLAQVLLRARFDVRIESLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toprim domain-containing protein
publication title Crystal structure and putative function of small Toprim domain-containing protein from Bacillus stearothermophilus.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
total genus 42
structure length 115
sequence length 115
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1360.20 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Toprim domain 2i5rA00
2I5RA 2FCJA
chains in the Genus database with same CATH superfamily
3B39A 1D3YA 3VE5A 4EE1A 5GUJA 2Q2EA 2AU3A 2V1CA 4EDTA 3VDPA 4EDKA 4JCVA 1DD9A 4EDGA 4O6PB 1VDDA 2FCJA 4O6OA 4EDVA 4EDRA 4E2KA 2ZBKA 1DDEA 1EQNA 2I5RA 3VDUA 1T6T1
chains in the Genus database with same CATH topology
2I5RA 2FCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5R A;  2FCJ A; 
#chains in the Genus database with same CATH topology
 3B39 A;  1D3Y A;  3VE5 A;  4EE1 A;  5GUJ A;  2Q2E A;  2AU3 A;  2V1C A;  4EDT A;  3VDP A;  4EDK A;  4JCV A;  1DD9 A;  4EDG A;  4O6P B;  1VDD A;  2FCJ A;  4O6O A;  4EDV A;  4EDR A;  4E2K A;  2ZBK A;  1DDE A;  1EQN A;  2I5R A;  3VDU A;  1T6T 1; 
#chains in the Genus database with same CATH homology
 2I5R A;  2FCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...