4O6PB

Structural and functional studies the characterization of c58g/c70g mutant in cys4 zinc-finger motif in the recombination mediator protein recr
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
197
structure length
197
Chain Sequence
YYSTSVAKLIEELSKLPGIGPKTAQRLAFFIINMPLDEVRSLSQAIIEAKEKLRYCKIGFNITDKEVCDIGSDENRDHSTICVVSHPMDVVAMEKVKEYKGVYHVLHGVISPIEGVGPEDIRIKELLERVRDGSVKEVILATNPDIEGEATAMYIAKLLKPFGVKVTRIAHGIPVGGDLEYTDVVTLSKALEGRREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombination protein RecR
publication title Structural and functional characterization of Cys4 zinc finger motif in the recombination mediator protein RecR
doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Recombination
total genus 53
structure length 197
sequence length 197
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00633 HHH Helix-hairpin-helix motif
B PF02132 RecR RecR protein
B PF13662 Toprim_4 Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 4o6pB01
4EDVA 1DDEA 2Q2EA 4O6PB 2V1CA 1EQNA 4O6OA 2AU3A 4EDTA 3B39A 3VE5A 4EE1A 1VDDA 1D3YA 4JCVA 4E2KA 2ZBKA 3VDUA 3VDPA 4EDKA 5GUJA 4EDRA 4EDGA 1DD9A 1T6T1
chains in the Genus database with same CATH superfamily
4EDVA 1DDEA 2Q2EA 2FCJA 4O6PB 2V1CA 1EQNA 4O6OA 2AU3A 4EDTA 3B39A 3VE5A 4EE1A 1VDDA 1D3YA 4JCVA 4E2KA 2ZBKA 3VDUA 2I5RA 3VDPA 4EDKA 5GUJA 4EDRA 4EDGA 1DD9A 1T6T1
chains in the Genus database with same CATH topology
4EDVA 1DDEA 2Q2EA 4O6PB 2V1CA 1EQNA 4O6OA 2AU3A 4EDTA 3B39A 3VE5A 4EE1A 1VDDA 1D3YA 4JCVA 4E2KA 2ZBKA 3VDUA 3VDPA 4EDKA 5GUJA 4EDRA 4EDGA 1DD9A 1T6T1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EDV A;  1DDE A;  2Q2E A;  4O6P B;  2V1C A;  1EQN A;  4O6O A;  2AU3 A;  4EDT A;  3B39 A;  3VE5 A;  4EE1 A;  1VDD A;  1D3Y A;  4JCV A;  4E2K A;  2ZBK A;  3VDU A;  3VDP A;  4EDK A;  5GUJ A;  4EDR A;  4EDG A;  1DD9 A;  1T6T 1; 
#chains in the Genus database with same CATH topology
 4EDV A;  1DDE A;  2Q2E A;  2FCJ A;  4O6P B;  2V1C A;  1EQN A;  4O6O A;  2AU3 A;  4EDT A;  3B39 A;  3VE5 A;  4EE1 A;  1VDD A;  1D3Y A;  4JCV A;  4E2K A;  2ZBK A;  3VDU A;  2I5R A;  3VDP A;  4EDK A;  5GUJ A;  4EDR A;  4EDG A;  1DD9 A;  1T6T 1; 
#chains in the Genus database with same CATH homology
 4EDV A;  1DDE A;  2Q2E A;  4O6P B;  2V1C A;  1EQN A;  4O6O A;  2AU3 A;  4EDT A;  3B39 A;  3VE5 A;  4EE1 A;  1VDD A;  1D3Y A;  4JCV A;  4E2K A;  2ZBK A;  3VDU A;  3VDP A;  4EDK A;  5GUJ A;  4EDR A;  4EDG A;  1DD9 A;  1T6T 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...