3VE5A

Structure of recombination mediator protein recr16-196 deletion mutant
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
181
structure length
181
Chain Sequence
b'PGIGPKTAQRLAFFIINMPLDEVRSLSQAIIEAKEKLRYCKICFNITDKEVCDICSDENRDHSTICVVSHPMDVVAMEKVKEYKGVYHVLHGVISPIEGVGPEDIRIKELLERVRDGSVKEVILATNPDIEGEATAMYIAKLLKPFGVKVTRIAHGIPVGGDLEYTDVVTLSKALEGRREV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombination protein recR
publication title RecOR complex including RecR N-N dimer and RecO monomer displays a high affinity for ssDNA
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Recombination
total genus 55
structure length 181
sequence length 181
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02132 RecR RecR protein
A PF13662 Toprim_4 Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.80 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3ve5A02
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 3ve5A03
3VDUA 2ZBKA 2Q2EA 4EDGA 2AU3A 4E2KA 5GUJA 3VDPA 4O6PB 1T6T1 4EDTA 1DDEA 1DD9A 4O6OA 1VDDA 3D00A 4EDKA 4JCVA 1D3YA 4EDVA 3B39A 4EDRA 3VE5A 1EQNA 2V1CA 4EE1A
chains in the Genus database with same CATH superfamily
5E3RA 3CXLA 2ZBKA 1R79A 2F3CI 1R0RI 2ERWA 4L9MA 4E2KA 5FUXA 3UEJA 4A24A 1FAQA 2NU3I 1H0ZA 4O6PB 2P6AC 1P9ZA 1X4SA 2KMRA 2WGCA 2JYYA 2I5RA 4EDTA 4JCVE 2L8EA 1UVFA 2OU2A 2YQPA 3R5BA 1Z2IA 4O6OA 2CWHA 4HGUA 3SEKC 2B0UC 2XRCA 3UGIA 2B8TA 1PTRA 5FUWA 4EDKA 1CSOI 2ORWA 5J8CA 1M8BA 1M8CA 1IW4A 2K9HA 2RC4A 1Y1BA 3FSXA 5HI7A 4EDVA 3R5CA 2ARPF 4E1RA 2N52A 3B39A 1CT4I 1MJBA 2E5RA 3R5AA 4FKDA 3VE5A 2PQ8A 4DNCA 5JHWC 1P9GA 3TO6A 2GKVA 1TURA 1WKXA 1SGQI 1W3SA 2V1CC 4EE1A 3FSYA 1V1IA 2QQCA 2QQDA 4EDGA 1XX6A 3HH2C 2CWGA 2KMOA 2N71A 4UXIA 4UXJA 4AMLA 1SGPI 2N17A 2AU3A 3OVOA 2YUUA 5E3PA 1ULNA 2WCYA 2L7XA 3UOEA 1UVGA 3UEYA 1WTJA 1XA6A 3B4VC 1U5KA 3SGQI 2E73A 1YTPA 1TUSA 1KBEA 2GVIA 1LR8A 4OVOA 1NXUA 1HPTA 2LEOA 2QQEA 2QPOA 1D3YA 2ODDA 1MJAA 2J9RA 1HEVA 2OD1A 4B6DA 3TOAA 3OXFA 4EDRA 2RIJA 1SGDI 1UUCA 2CWFA 2SGFI 5HQ8A 1HDLA 1DDEA 2SGQI 2WVJA 2FCJA 1N13A 1AN1I 1TOTA 2SGEI 1DS2I 1OYVI 2M5XA 2V1CA 3QTLD 3UFFA 1EQNA 2Q2EA 1SGEI 1TIHA 1W4RA 2ORVA 2JW6A 2KMPA 1SGRI 2VRWB 5DAEA 2W0TA 1BUSA 5GUJA 9WGAA 2CJSC 1TGSI 3TO9A 1TBQR 1T6T1 1KBFA 1CHOI 1CGJI 1ULMA 4GI3C 1CT2I 3KY9A 1ULKA 2DB6A 1VDDA 5FUYA 3UGLA 1TBOA 2BUSA 3OXLA 2UZ3A 3E2IA 4UXHA 3GOXA 2NU1I 1LR7A 2GIVA 1K7UA 1RFHA 2OZUA 2DIPA 1IY6A 1LR9A 2GKTI 3QAHA 2A20A 5CCMA 1BMOA 2DKVA 2J87A 2SGDI 3PDNA 1OVOA 1K7TA 1PJUA 2JA1A 2JXDA 2QQ0A 1UHAA 3SGBI 3TJQA 1WGTA 2NU2I 2LUYA 2KMQA 2NU4I 3E59A 3OXGA 2KCXA 3VDUA 2OVOA 1Y1CA 2SGPI 1OMTA 1MJ9A 4WP4A 2N1AB 7WGAA 1XBTA 2X52A 3VDPA 1TBRR 2Y0MA 1K7VA 1MT1A 2ELIA 1Q9BA 2V53A 1PCEA 2ROWA 5E3QA 1NUBA 1Y8FA 2NU0I 1OMUA 2X3TA 3QWPA 1HJAI 3UGDA 1FYBA 1DD9A 1FARA 1V1HA 3D00A 4E1PA 1WGCA 1FY7A 1TBNA 1X74A 5CCLA 3R5DA 1SGNI 1CT0I 1S20A 5FUVA 2JZMA 4MPIA 1Z7KB 3FC3A 4JCVA 1PPFI 2LB7A 3OL0A 5J8FA 3RU0A 1SGYI 2UVOA 3MEKA 2ENZA 5EX3A 1PTQA 4SGBI 1DS3I 2ENNA 1IY5A 3BJIA 2FNFX 5EX0A 1KMAA 1CE3A 1CGII 1YU6C 3TOBA 2GKRI 3TO7A
chains in the Genus database with same CATH topology
3CXLA 2ZBKA 1R79A 2F3CI 1R0RI 2ERWA 4L9MA 4E2KA 5FUXA 3UEJA 4A24A 1FAQA 2NU3I 1H0ZA 4O6PB 2P6AC 1X4SA 2KMRA 2JYYA 4EDTA 4JCVE 2L8EA 1UVFA 2YQPA 4O6OA 4HGUA 3SEKC 2B0UC 2XRCA 3UGIA 2B8TA 1PTRA 5FUWA 4EDKA 1CSOI 2ORWA 1IW4A 1M8BA 1M8CA 2K9HA 1Y1BA 5HI7A 4EDVA 2ARPF 4E1RA 2N52A 3B39A 1CT4I 4FKDA 2E5RA 3VE5A 5JHWC 2GKVA 1TURA 1SGQI 1W3SA 2V1CC 4EE1A 1V1IA 2QQCA 2QQDA 4EDGA 1XX6A 3HH2C 4UXIA 2KMOA 2N71A 4UXJA 2AU3A 1SGPI 2N17A 3OVOA 2YUUA 2WCYA 2L7XA 1UVGA 3UEYA 1XA6A 3B4VC 1U5KA 3SGQI 2E73A 1YTPA 1TUSA 1KBEA 2GVIA 1LR8A 4OVOA 1HPTA 2LEOA 2QQEA 2QPOA 1D3YA 2ODDA 2J9RA 2OD1A 4B6DA 4EDRA 3OXFA 1SGDI 1UUCA 2SGFI 1HDLA 5HQ8A 2SGQI 2WVJA 1N13A 1AN1I 1TOTA 2SGEI 1DS2I 1OYVI 2M5XA 2V1CA 3QTLD 3UFFA 1EQNA 2Q2EA 1SGEI 1TIHA 1W4RA 2ORVA 2JW6A 2KMPA 1SGRI 2VRWB 5DAEA 2W0TA 1BUSA 5GUJA 2CJSC 1TGSI 1TBQR 1T6T1 1KBFA 1CHOI 1CGJI 4GI3C 1CT2I 3KY9A 2DB6A 1VDDA 5FUYA 3UGLA 1TBOA 2BUSA 3OXLA 2UZ3A 3E2IA 4UXHA 3GOXA 2NU1I 1LR7A 1RFHA 2DIPA 1IY6A 1LR9A 2GKTI 2A20A 1BMOA 2J87A 3PDNA 2SGDI 1OVOA 1PJUA 2JA1A 2JXDA 2QQ0A 3SGBI 3TJQA 5CCMA 2NU2I 2LUYA 2KMQA 2NU4I 3E59A 3OXGA 2KCXA 3VDUA 2OVOA 1Y1CA 2SGPI 1OMTA 2N1AB 1XBTA 3VDPA 1TBRR 1MT1A 2ELIA 2V53A 1PCEA 2ROWA 1NUBA 1Y8FA 2NU0I 1OMUA 3QWPA 1DD9A 1HJAI 3UGDA 1FYBA 1DDEA 1FARA 1V1HA 3D00A 4E1PA 1X74A 5CCLA 1TBNA 1SGNI 1CT0I 5FUVA 2JZMA 4JCVA 1Z7KB 3FC3A 1PPFI 3OL0A 3RU0A 1SGYI 3MEKA 2ENZA 5EX3A 1PTQA 4SGBI 1DS3I 2ENNA 1IY5A 3BJIA 2FNFX 5EX0A 1KMAA 1CE3A 1CGII 1YU6C 2GKRI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VDU A;  2ZBK A;  2Q2E A;  4EDG A;  2AU3 A;  4E2K A;  5GUJ A;  3VDP A;  4O6P B;  1T6T 1;  4EDT A;  1DDE A;  1DD9 A;  4O6O A;  1VDD A;  3D00 A;  4EDK A;  4JCV A;  1D3Y A;  4EDV A;  3B39 A;  4EDR A;  3VE5 A;  1EQN A;  2V1C A;  4EE1 A; 
#chains in the Genus database with same CATH topology
 5E3R A;  3CXL A;  2ZBK A;  1R79 A;  2F3C I;  1R0R I;  2ERW A;  4L9M A;  4E2K A;  5FUX A;  3UEJ A;  4A24 A;  1FAQ A;  2NU3 I;  1H0Z A;  4O6P B;  2P6A C;  1P9Z A;  1X4S A;  2KMR A;  2WGC A;  2JYY A;  2I5R A;  4EDT A;  4JCV E;  2L8E A;  1UVF A;  2OU2 A;  2YQP A;  3R5B A;  1Z2I A;  4O6O A;  2CWH A;  4HGU A;  3SEK C;  2B0U C;  2XRC A;  3UGI A;  2B8T A;  1PTR A;  5FUW A;  4EDK A;  1CSO I;  2ORW A;  5J8C A;  1M8B A;  1M8C A;  1IW4 A;  2K9H A;  2RC4 A;  1Y1B A;  3FSX A;  5HI7 A;  4EDV A;  3R5C A;  2ARP F;  4E1R A;  2N52 A;  3B39 A;  1CT4 I;  1MJB A;  2E5R A;  3R5A A;  4FKD A;  3VE5 A;  2PQ8 A;  4DNC A;  5JHW C;  1P9G A;  3TO6 A;  2GKV A;  1TUR A;  1WKX A;  1SGQ I;  1W3S A;  2V1C C;  4EE1 A;  3FSY A;  1V1I A;  2QQC A;  2QQD A;  4EDG A;  1XX6 A;  3HH2 C;  2CWG A;  2KMO A;  2N71 A;  4UXI A;  4UXJ A;  4AML A;  1SGP I;  2N17 A;  2AU3 A;  3OVO A;  2YUU A;  5E3P A;  1ULN A;  2WCY A;  2L7X A;  3UOE A;  1UVG A;  3UEY A;  1WTJ A;  1XA6 A;  3B4V C;  1U5K A;  3SGQ I;  2E73 A;  1YTP A;  1TUS A;  1KBE A;  2GVI A;  1LR8 A;  4OVO A;  1NXU A;  1HPT A;  2LEO A;  2QQE A;  2QPO A;  1D3Y A;  2ODD A;  1MJA A;  2J9R A;  1HEV A;  2OD1 A;  4B6D A;  3TOA A;  3OXF A;  4EDR A;  2RIJ A;  1SGD I;  1UUC A;  2CWF A;  2SGF I;  5HQ8 A;  1HDL A;  1DDE A;  2SGQ I;  2WVJ A;  2FCJ A;  1N13 A;  1AN1 I;  1TOT A;  2SGE I;  1DS2 I;  1OYV I;  2M5X A;  2V1C A;  3QTL D;  3UFF A;  1EQN A;  2Q2E A;  1SGE I;  1TIH A;  1W4R A;  2ORV A;  2JW6 A;  2KMP A;  1SGR I;  2VRW B;  5DAE A;  2W0T A;  1BUS A;  5GUJ A;  9WGA A;  2CJS C;  1TGS I;  3TO9 A;  1TBQ R;  1T6T 1;  1KBF A;  1CHO I;  1CGJ I;  1ULM A;  4GI3 C;  1CT2 I;  3KY9 A;  1ULK A;  2DB6 A;  1VDD A;  5FUY A;  3UGL A;  1TBO A;  2BUS A;  3OXL A;  2UZ3 A;  3E2I A;  4UXH A;  3GOX A;  2NU1 I;  1LR7 A;  2GIV A;  1K7U A;  1RFH A;  2OZU A;  2DIP A;  1IY6 A;  1LR9 A;  2GKT I;  3QAH A;  2A20 A;  5CCM A;  1BMO A;  2DKV A;  2J87 A;  2SGD I;  3PDN A;  1OVO A;  1K7T A;  1PJU A;  2JA1 A;  2JXD A;  2QQ0 A;  1UHA A;  3SGB I;  3TJQ A;  1WGT A;  2NU2 I;  2LUY A;  2KMQ A;  2NU4 I;  3E59 A;  3OXG A;  2KCX A;  3VDU A;  2OVO A;  1Y1C A;  2SGP I;  1OMT A;  1MJ9 A;  4WP4 A;  2N1A B;  7WGA A;  1XBT A;  2X52 A;  3VDP A;  1TBR R;  2Y0M A;  1K7V A;  1MT1 A;  2ELI A;  1Q9B A;  2V53 A;  1PCE A;  2ROW A;  5E3Q A;  1NUB A;  1Y8F A;  2NU0 I;  1OMU A;  2X3T A;  3QWP A;  1HJA I;  3UGD A;  1FYB A;  1DD9 A;  1FAR A;  1V1H A;  3D00 A;  4E1P A;  1WGC A;  1FY7 A;  1TBN A;  1X74 A;  5CCL A;  3R5D A;  1SGN I;  1CT0 I;  1S20 A;  5FUV A;  2JZM A;  4MPI A;  1Z7K B;  3FC3 A;  4JCV A;  1PPF I;  2LB7 A;  3OL0 A;  5J8F A;  3RU0 A;  1SGY I;  2UVO A;  3MEK A;  2ENZ A;  5EX3 A;  1PTQ A;  4SGB I;  1DS3 I;  2ENN A;  1IY5 A;  3BJI A;  2FNF X;  5EX0 A;  1KMA A;  1CE3 A;  1CGI I;  1YU6 C;  3TOB A;  2GKR I;  3TO7 A; 
#chains in the Genus database with same CATH homology
 3CXL A;  2ZBK A;  1R79 A;  2F3C I;  1R0R I;  2ERW A;  4L9M A;  4E2K A;  5FUX A;  3UEJ A;  4A24 A;  1FAQ A;  2NU3 I;  1H0Z A;  4O6P B;  2P6A C;  1X4S A;  2KMR A;  2JYY A;  4EDT A;  4JCV E;  2L8E A;  1UVF A;  2YQP A;  4O6O A;  4HGU A;  3SEK C;  2B0U C;  2XRC A;  3UGI A;  2B8T A;  1PTR A;  5FUW A;  4EDK A;  1CSO I;  2ORW A;  1IW4 A;  1M8B A;  1M8C A;  2K9H A;  1Y1B A;  5HI7 A;  4EDV A;  2ARP F;  4E1R A;  2N52 A;  3B39 A;  1CT4 I;  4FKD A;  2E5R A;  3VE5 A;  5JHW C;  2GKV A;  1TUR A;  1SGQ I;  1W3S A;  2V1C C;  4EE1 A;  1V1I A;  2QQC A;  2QQD A;  4EDG A;  1XX6 A;  3HH2 C;  4UXI A;  2KMO A;  2N71 A;  4UXJ A;  2AU3 A;  1SGP I;  2N17 A;  3OVO A;  2YUU A;  2WCY A;  2L7X A;  1UVG A;  3UEY A;  1XA6 A;  3B4V C;  1U5K A;  3SGQ I;  2E73 A;  1YTP A;  1TUS A;  1KBE A;  2GVI A;  1LR8 A;  4OVO A;  1HPT A;  2LEO A;  2QQE A;  2QPO A;  1D3Y A;  2ODD A;  2J9R A;  2OD1 A;  4B6D A;  4EDR A;  3OXF A;  1SGD I;  1UUC A;  2SGF I;  1HDL A;  5HQ8 A;  2SGQ I;  2WVJ A;  1N13 A;  1AN1 I;  1TOT A;  2SGE I;  1DS2 I;  1OYV I;  2M5X A;  2V1C A;  3QTL D;  3UFF A;  1EQN A;  2Q2E A;  1SGE I;  1TIH A;  1W4R A;  2ORV A;  2JW6 A;  2KMP A;  1SGR I;  2VRW B;  5DAE A;  2W0T A;  1BUS A;  5GUJ A;  2CJS C;  1TGS I;  1TBQ R;  1T6T 1;  1KBF A;  1CHO I;  1CGJ I;  4GI3 C;  1CT2 I;  3KY9 A;  2DB6 A;  1VDD A;  5FUY A;  3UGL A;  1TBO A;  2BUS A;  3OXL A;  2UZ3 A;  3E2I A;  4UXH A;  3GOX A;  2NU1 I;  1LR7 A;  1RFH A;  2DIP A;  1IY6 A;  1LR9 A;  2GKT I;  2A20 A;  1BMO A;  2J87 A;  3PDN A;  2SGD I;  1OVO A;  1PJU A;  2JA1 A;  2JXD A;  2QQ0 A;  3SGB I;  3TJQ A;  5CCM A;  2NU2 I;  2LUY A;  2KMQ A;  2NU4 I;  3E59 A;  3OXG A;  2KCX A;  3VDU A;  2OVO A;  1Y1C A;  2SGP I;  1OMT A;  2N1A B;  1XBT A;  3VDP A;  1TBR R;  1MT1 A;  2ELI A;  2V53 A;  1PCE A;  2ROW A;  1NUB A;  1Y8F A;  2NU0 I;  1OMU A;  3QWP A;  1DD9 A;  1HJA I;  3UGD A;  1FYB A;  1DDE A;  1FAR A;  1V1H A;  3D00 A;  4E1P A;  1X74 A;  5CCL A;  1TBN A;  1SGN I;  1CT0 I;  5FUV A;  2JZM A;  4JCV A;  1Z7K B;  3FC3 A;  1PPF I;  3OL0 A;  3RU0 A;  1SGY I;  3MEK A;  2ENZ A;  5EX3 A;  1PTQ A;  4SGB I;  1DS3 I;  2ENN A;  1IY5 A;  3BJI A;  2FNF X;  5EX0 A;  1KMA A;  1CE3 A;  1CGI I;  1YU6 C;  2GKR I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...