3VE5A

Structure of recombination mediator protein recr16-196 deletion mutant
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
181
structure length
181
Chain Sequence
PGIGPKTAQRLAFFIINMPLDEVRSLSQAIIEAKEKLRYCKICFNITDKEVCDICSDENRDHSTICVVSHPMDVVAMEKVKEYKGVYHVLHGVISPIEGVGPEDIRIKELLERVRDGSVKEVILATNPDIEGEATAMYIAKLLKPFGVKVTRIAHGIPVGGDLEYTDVVTLSKALEGRREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombination protein recR
publication title RecOR complex including RecR N-N dimer and RecO monomer displays a high affinity for ssDNA
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Recombination
total genus 55
structure length 181
sequence length 181
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02132 RecR RecR protein
A PF13662 Toprim_4 Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.80 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3ve5A02
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 3ve5A03
4JCVA 4E2KA 3D00A 4EDRA 1D3YA 3B39A 4O6OA 3VDUA 1DDEA 2ZBKA 4EE1A 3VDPA 2V1CA 1VDDA 4EDTA 1EQNA 4EDGA 5GUJA 4EDKA 1T6T1 4EDVA 4O6PB 2Q2EA 1DD9A 3VE5A 2AU3A
chains in the Genus database with same CATH superfamily
1WTJA 3E59A 2KMOA 4A24A 1IW4A 2QPOA 1PCEA 3PDNA 1K7TA 2GIVA 1PTRA 2E73A 1X74A 2SGQI 3UEYA 1V1HA 2ERWA 7WGAA 4O6OA 2KMQA 1PPFI 2ORVA 1NUBA 1DS3I 3E2IA 3FSXA 5HI7A 5JHWC 2N52A 1OMTA 5J8FA 1HDLA 4GI3C 1CGII 1TBQR 3TO9A 2SGPI 9WGAA 1CE3A 3TOBA 1RFHA 3OXFA 1HEVA 1R79A 2M5XA 1WGTA 3HH2C 4EDGA 2UVOA 5GUJA 2JXDA 1TURA 3R5CA 2NU3I 3QTLD 2GKRI 4UXHA 2KMRA 4OVOA 1KBEA 5FUWA 4O6PB 5FUVA 2NU4I 2VRWB 1P9GA 1OMUA 1SGNI 2NU0I 4E1RA 1PTQA 2JZMA 1LR7A 2YQPA 5EX0A 3SGBI 1MJBA 3UFFA 4E2KA 3UOEA 4HGUA 2WVJA 1SGPI 2WGCA 1CT0I 3TO7A 3D00A 1FYBA 4EDRA 1UHAA 1DS2I 3OXGA 1FAQA 2GVIA 1SGQI 5E3QA 3SEKC 3UEJA 3UGIA 2ROWA 2JYYA 1M8CA 2NU2I 1SGDI 1XA6A 3RU0A 4EE1A 2OVOA 3R5AA 1OYVI 1VDDA 2E5RA 4EDTA 1WKXA 3TJQA 2KCXA 1Y1CA 1UVGA 2CWHA 3BJIA 1M8BA 1V1IA 3MEKA 4EDKA 5DAEA 2L7XA 3OVOA 2L8EA 1AN1I 2SGFI 4L9MA 3FSYA 1IY6A 5FUXA 1XBTA 1P9ZA 1XX6A 2RIJA 3UGLA 2SGEI 5E3PA 2J87A 3QWPA 1MT1A 1FY7A 1W3SA 4JCVE 1CHOI 3VE5A 1DD9A 2X52A 4JCVA 4DNCA 1R0RI 2OD1A 1TBNA 1HPTA 2PQ8A 1U5KA 3R5BA 4UXIA 2ORWA 5CCLA 4AMLA 1X4SA 1ULNA 3TOAA 2FNFX 2P6AC 2B8TA 1TOTA 1UVFA 2XRCA 1DDEA 1SGRI 4E1PA 4SGBI 2N1AB 1CGJI 2OZUA 4B6DA 1IY5A 2ENZA 1K7VA 1LR8A 1Z7KB 2LUYA 2NU1I 2YUUA 3CXLA 1MJ9A 1EQNA 2I5RA 1SGYI 2X3TA 1TBOA 2LEOA 2GKTI 2QQCA 2N71A 2OU2A 1K7UA 3OL0A 1PJUA 1TGSI 2CWGA 5FUYA 1HJAI 1Q9BA 1Y8FA 1CT4I 3KY9A 4EDVA 1Y1BA 2BUSA 2CJSC 2V53A 1TBRR 2B0UC 2ARPF 3R5DA 5CCMA 1W4RA 2K9HA 2JA1A 2DKVA 2RC4A 2AU3A 4FKDA 3FC3A 1NXUA 2QQDA 1KMAA 2ODDA 3GOXA 2KMPA 1YU6C 3SGQI 1YTPA 1BUSA 1OVOA 2ELIA 3UGDA 5HQ8A 1D3YA 3B39A 1ULKA 1CT2I 2F3CI 2JW6A 2Y0MA 2A20A 1SGEI 3OXLA 5EX3A 1N13A 1CSOI 3QAHA 5J8CA 1ULMA 3B4VC 2ZBKA 2LB7A 3VDPA 1LR9A 2V1CA 1BMOA 1S20A 1UUCA 1WGCA 2DIPA 1FARA 2Q2EA 1MJAA 3VDUA 2N17A 2ENNA 2QQ0A 2J9RA 2V1CC 1TUSA 2WCYA 3TO6A 1KBFA 2DB6A 5E3RA 1T6T1 2SGDI 1TIHA 2QQEA 4UXJA 4WP4A 2UZ3A 4MPIA 2FCJA 1Z2IA 2CWFA 2GKVA 2W0TA 1H0ZA
chains in the Genus database with same CATH topology
4A24A 3E59A 2KMOA 1IW4A 2QPOA 1PCEA 3PDNA 1PTRA 2E73A 1X74A 2SGQI 3UEYA 1V1HA 2ERWA 4O6OA 2KMQA 1PPFI 2ORVA 1NUBA 1DS3I 3E2IA 5HI7A 5JHWC 2N52A 1OMTA 4GI3C 1CGII 1TBQR 2SGPI 1CE3A 1RFHA 3OXFA 1R79A 2M5XA 4EDGA 5GUJA 2JXDA 1TURA 2NU3I 3QTLD 2GKRI 4UXHA 2KMRA 4OVOA 1KBEA 5FUWA 4O6PB 5FUVA 2NU4I 2VRWB 1OMUA 1SGNI 2NU0I 4E1RA 1PTQA 2JZMA 1LR7A 2YQPA 5EX0A 3SGBI 3UFFA 4E2KA 4HGUA 2WVJA 1SGPI 1CT0I 3D00A 1FYBA 4EDRA 1DS2I 3OXGA 1FAQA 2GVIA 1SGQI 3SEKC 3UEJA 3UGIA 2ROWA 2JYYA 1M8CA 2NU2I 1SGDI 1XA6A 3RU0A 4EE1A 2OVOA 1OYVI 1VDDA 2E5RA 4EDTA 3TJQA 2KCXA 1Y1CA 1UVGA 3BJIA 1M8BA 1V1IA 3MEKA 4EDKA 5DAEA 2L7XA 3OVOA 2L8EA 1AN1I 2SGFI 4L9MA 1IY6A 5FUXA 1XBTA 1XX6A 3UGLA 2SGEI 2J87A 3QWPA 1MT1A 1DD9A 1W3SA 4JCVE 1CHOI 3VE5A 4JCVA 1R0RI 2OD1A 1TBNA 1HPTA 4UXIA 1U5KA 5CCLA 2ORWA 1X4SA 2FNFX 2P6AC 2B8TA 1TOTA 1UVFA 2XRCA 1DDEA 1SGRI 4E1PA 4SGBI 2N1AB 1CGJI 4B6DA 1IY5A 2ENZA 1LR8A 2NU1I 1Z7KB 2LUYA 2YUUA 3CXLA 1EQNA 1SGYI 1TBOA 2LEOA 2GKTI 2QQCA 2N71A 3OL0A 5FUYA 1PJUA 1TGSI 1HJAI 1Y8FA 1CT4I 3KY9A 4EDVA 1Y1BA 2BUSA 2CJSC 2V53A 1TBRR 2B0UC 2ARPF 5CCMA 1HDLA 1W4RA 2K9HA 2JA1A 2AU3A 4FKDA 3FC3A 2QQDA 2ODDA 3GOXA 2KMPA 1YU6C 3SGQI 1YTPA 1BUSA 1OVOA 2ELIA 3UGDA 5HQ8A 1D3YA 3B39A 1CT2I 2F3CI 2JW6A 5EX3A 2A20A 1SGEI 3OXLA 3VDUA 1N13A 1CSOI 3B4VC 2ZBKA 3VDPA 1LR9A 2V1CA 1BMOA 1UUCA 2DIPA 1FARA 2Q2EA 2N17A 2ENNA 2QQ0A 2J9RA 2V1CC 1TUSA 2WCYA 1KBFA 2DB6A 1T6T1 2SGDI 1TIHA 2QQEA 4UXJA 2UZ3A 2GKVA 3HH2C 1KMAA 2W0TA 1H0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JCV A;  4E2K A;  3D00 A;  4EDR A;  1D3Y A;  3B39 A;  4O6O A;  3VDU A;  1DDE A;  2ZBK A;  4EE1 A;  3VDP A;  2V1C A;  1VDD A;  4EDT A;  1EQN A;  4EDG A;  5GUJ A;  4EDK A;  1T6T 1;  4EDV A;  4O6P B;  2Q2E A;  1DD9 A;  3VE5 A;  2AU3 A; 
#chains in the Genus database with same CATH topology
 1WTJ A;  3E59 A;  2KMO A;  4A24 A;  1IW4 A;  2QPO A;  1PCE A;  3PDN A;  1K7T A;  2GIV A;  1PTR A;  2E73 A;  1X74 A;  2SGQ I;  3UEY A;  1V1H A;  2ERW A;  7WGA A;  4O6O A;  2KMQ A;  1PPF I;  2ORV A;  1NUB A;  1DS3 I;  3E2I A;  3FSX A;  5HI7 A;  5JHW C;  2N52 A;  1OMT A;  5J8F A;  1HDL A;  4GI3 C;  1CGI I;  1TBQ R;  3TO9 A;  2SGP I;  9WGA A;  1CE3 A;  3TOB A;  1RFH A;  3OXF A;  1HEV A;  1R79 A;  2M5X A;  1WGT A;  3HH2 C;  4EDG A;  2UVO A;  5GUJ A;  2JXD A;  1TUR A;  3R5C A;  2NU3 I;  3QTL D;  2GKR I;  4UXH A;  2KMR A;  4OVO A;  1KBE A;  5FUW A;  4O6P B;  5FUV A;  2NU4 I;  2VRW B;  1P9G A;  1OMU A;  1SGN I;  2NU0 I;  4E1R A;  1PTQ A;  2JZM A;  1LR7 A;  2YQP A;  5EX0 A;  3SGB I;  1MJB A;  3UFF A;  4E2K A;  3UOE A;  4HGU A;  2WVJ A;  1SGP I;  2WGC A;  1CT0 I;  3TO7 A;  3D00 A;  1FYB A;  4EDR A;  1UHA A;  1DS2 I;  3OXG A;  1FAQ A;  2GVI A;  1SGQ I;  5E3Q A;  3SEK C;  3UEJ A;  3UGI A;  2ROW A;  2JYY A;  1M8C A;  2NU2 I;  1SGD I;  1XA6 A;  3RU0 A;  4EE1 A;  2OVO A;  3R5A A;  1OYV I;  1VDD A;  2E5R A;  4EDT A;  1WKX A;  3TJQ A;  2KCX A;  1Y1C A;  1UVG A;  2CWH A;  3BJI A;  1M8B A;  1V1I A;  3MEK A;  4EDK A;  5DAE A;  2L7X A;  3OVO A;  2L8E A;  1AN1 I;  2SGF I;  4L9M A;  3FSY A;  1IY6 A;  5FUX A;  1XBT A;  1P9Z A;  1XX6 A;  2RIJ A;  3UGL A;  2SGE I;  5E3P A;  2J87 A;  3QWP A;  1MT1 A;  1FY7 A;  1W3S A;  4JCV E;  1CHO I;  3VE5 A;  1DD9 A;  2X52 A;  4JCV A;  4DNC A;  1R0R I;  2OD1 A;  1TBN A;  1HPT A;  2PQ8 A;  1U5K A;  3R5B A;  4UXI A;  2ORW A;  5CCL A;  4AML A;  1X4S A;  1ULN A;  3TOA A;  2FNF X;  2P6A C;  2B8T A;  1TOT A;  1UVF A;  2XRC A;  1DDE A;  1SGR I;  4E1P A;  4SGB I;  2N1A B;  1CGJ I;  2OZU A;  4B6D A;  1IY5 A;  2ENZ A;  1K7V A;  1LR8 A;  1Z7K B;  2LUY A;  2NU1 I;  2YUU A;  3CXL A;  1MJ9 A;  1EQN A;  2I5R A;  1SGY I;  2X3T A;  1TBO A;  2LEO A;  2GKT I;  2QQC A;  2N71 A;  2OU2 A;  1K7U A;  3OL0 A;  1PJU A;  1TGS I;  2CWG A;  5FUY A;  1HJA I;  1Q9B A;  1Y8F A;  1CT4 I;  3KY9 A;  4EDV A;  1Y1B A;  2BUS A;  2CJS C;  2V53 A;  1TBR R;  2B0U C;  2ARP F;  3R5D A;  5CCM A;  1W4R A;  2K9H A;  2JA1 A;  2DKV A;  2RC4 A;  2AU3 A;  4FKD A;  3FC3 A;  1NXU A;  2QQD A;  1KMA A;  2ODD A;  3GOX A;  2KMP A;  1YU6 C;  3SGQ I;  1YTP A;  1BUS A;  1OVO A;  2ELI A;  3UGD A;  5HQ8 A;  1D3Y A;  3B39 A;  1ULK A;  1CT2 I;  2F3C I;  2JW6 A;  2Y0M A;  2A20 A;  1SGE I;  3OXL A;  5EX3 A;  1N13 A;  1CSO I;  3QAH A;  5J8C A;  1ULM A;  3B4V C;  2ZBK A;  2LB7 A;  3VDP A;  1LR9 A;  2V1C A;  1BMO A;  1S20 A;  1UUC A;  1WGC A;  2DIP A;  1FAR A;  2Q2E A;  1MJA A;  3VDU A;  2N17 A;  2ENN A;  2QQ0 A;  2J9R A;  2V1C C;  1TUS A;  2WCY A;  3TO6 A;  1KBF A;  2DB6 A;  5E3R A;  1T6T 1;  2SGD I;  1TIH A;  2QQE A;  4UXJ A;  4WP4 A;  2UZ3 A;  4MPI A;  2FCJ A;  1Z2I A;  2CWF A;  2GKV A;  2W0T A;  1H0Z A; 
#chains in the Genus database with same CATH homology
 4A24 A;  3E59 A;  2KMO A;  1IW4 A;  2QPO A;  1PCE A;  3PDN A;  1PTR A;  2E73 A;  1X74 A;  2SGQ I;  3UEY A;  1V1H A;  2ERW A;  4O6O A;  2KMQ A;  1PPF I;  2ORV A;  1NUB A;  1DS3 I;  3E2I A;  5HI7 A;  5JHW C;  2N52 A;  1OMT A;  4GI3 C;  1CGI I;  1TBQ R;  2SGP I;  1CE3 A;  1RFH A;  3OXF A;  1R79 A;  2M5X A;  4EDG A;  5GUJ A;  2JXD A;  1TUR A;  2NU3 I;  3QTL D;  2GKR I;  4UXH A;  2KMR A;  4OVO A;  1KBE A;  5FUW A;  4O6P B;  5FUV A;  2NU4 I;  2VRW B;  1OMU A;  1SGN I;  2NU0 I;  4E1R A;  1PTQ A;  2JZM A;  1LR7 A;  2YQP A;  5EX0 A;  3SGB I;  3UFF A;  4E2K A;  4HGU A;  2WVJ A;  1SGP I;  1CT0 I;  3D00 A;  1FYB A;  4EDR A;  1DS2 I;  3OXG A;  1FAQ A;  2GVI A;  1SGQ I;  3SEK C;  3UEJ A;  3UGI A;  2ROW A;  2JYY A;  1M8C A;  2NU2 I;  1SGD I;  1XA6 A;  3RU0 A;  4EE1 A;  2OVO A;  1OYV I;  1VDD A;  2E5R A;  4EDT A;  3TJQ A;  2KCX A;  1Y1C A;  1UVG A;  3BJI A;  1M8B A;  1V1I A;  3MEK A;  4EDK A;  5DAE A;  2L7X A;  3OVO A;  2L8E A;  1AN1 I;  2SGF I;  4L9M A;  1IY6 A;  5FUX A;  1XBT A;  1XX6 A;  3UGL A;  2SGE I;  2J87 A;  3QWP A;  1MT1 A;  1DD9 A;  1W3S A;  4JCV E;  1CHO I;  3VE5 A;  4JCV A;  1R0R I;  2OD1 A;  1TBN A;  1HPT A;  4UXI A;  1U5K A;  5CCL A;  2ORW A;  1X4S A;  2FNF X;  2P6A C;  2B8T A;  1TOT A;  1UVF A;  2XRC A;  1DDE A;  1SGR I;  4E1P A;  4SGB I;  2N1A B;  1CGJ I;  4B6D A;  1IY5 A;  2ENZ A;  1LR8 A;  2NU1 I;  1Z7K B;  2LUY A;  2YUU A;  3CXL A;  1EQN A;  1SGY I;  1TBO A;  2LEO A;  2GKT I;  2QQC A;  2N71 A;  3OL0 A;  5FUY A;  1PJU A;  1TGS I;  1HJA I;  1Y8F A;  1CT4 I;  3KY9 A;  4EDV A;  1Y1B A;  2BUS A;  2CJS C;  2V53 A;  1TBR R;  2B0U C;  2ARP F;  5CCM A;  1HDL A;  1W4R A;  2K9H A;  2JA1 A;  2AU3 A;  4FKD A;  3FC3 A;  2QQD A;  2ODD A;  3GOX A;  2KMP A;  1YU6 C;  3SGQ I;  1YTP A;  1BUS A;  1OVO A;  2ELI A;  3UGD A;  5HQ8 A;  1D3Y A;  3B39 A;  1CT2 I;  2F3C I;  2JW6 A;  5EX3 A;  2A20 A;  1SGE I;  3OXL A;  3VDU A;  1N13 A;  1CSO I;  3B4V C;  2ZBK A;  3VDP A;  1LR9 A;  2V1C A;  1BMO A;  1UUC A;  2DIP A;  1FAR A;  2Q2E A;  2N17 A;  2ENN A;  2QQ0 A;  2J9R A;  2V1C C;  1TUS A;  2WCY A;  1KBF A;  2DB6 A;  1T6T 1;  2SGD I;  1TIH A;  2QQE A;  4UXJ A;  2UZ3 A;  2GKV A;  3HH2 C;  1KMA A;  2W0T A;  1H0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...