4O6OA

Structural and functional studies the characterization of cys4 zinc-finger motif in the recombination mediator protein recr
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
197
structure length
197
Chain Sequence
b'YYSTSVAKLIEELSKLPGIGPKTAQRLAFFIINMPLDEVRSLSQAIIEAKEKLRYGKICFNITDKEVCDICSDENRDHSTICVVSHPMDVVAMEKVKEYKGVYHVLHGVISPIEGVGPEDIRIKELLERVRDGSVKEVILATNPDIEGEATAMYIAKLLKPFGVKVTRIAHGIPVGGDLEYTDVVTLSKALEGRREV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombination protein RecR
publication title Structural and functional characterization of Cys4 zinc finger motif in the recombination mediator protein RecR
doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Recombination
total genus 54
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
A PF02132 RecR RecR protein
A PF13662 Toprim_4 Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 4o6oA01
4E2KA 4EDVA 2ZBKA 4O6PB 4EDTA 1DD9A 1VDDA 4EDRA 4EE1A 4EDGA 1D3YA 3VE5A 4JCVA 3VDPA 2V1CA 5GUJA 1T6T1 1EQNA 4EDKA 4O6OA 3B39A 2Q2EA 2AU3A 1DDEA 3VDUA
chains in the Genus database with same CATH superfamily
4E2KA 4EDVA 2ZBKA 4O6PB 4EDTA 1DD9A 1VDDA 4EDRA 4EE1A 4EDGA 1D3YA 3VE5A 4JCVA 3VDPA 2V1CA 5GUJA 2FCJA 1T6T1 1EQNA 4O6OA 4EDKA 3B39A 2I5RA 2Q2EA 2AU3A 1DDEA 3VDUA
chains in the Genus database with same CATH topology
4E2KA 4EDVA 2ZBKA 4O6PB 4EDTA 1DD9A 1VDDA 4EDRA 4EE1A 4EDGA 1D3YA 3VE5A 4JCVA 3VDPA 2V1CA 5GUJA 1T6T1 1EQNA 4EDKA 4O6OA 3B39A 2Q2EA 2AU3A 1DDEA 3VDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E2K A;  4EDV A;  2ZBK A;  4O6P B;  4EDT A;  1DD9 A;  1VDD A;  4EDR A;  4EE1 A;  4EDG A;  1D3Y A;  3VE5 A;  4JCV A;  3VDP A;  2V1C A;  5GUJ A;  1T6T 1;  1EQN A;  4EDK A;  4O6O A;  3B39 A;  2Q2E A;  2AU3 A;  1DDE A;  3VDU A; 
#chains in the Genus database with same CATH topology
 4E2K A;  4EDV A;  2ZBK A;  4O6P B;  4EDT A;  1DD9 A;  1VDD A;  4EDR A;  4EE1 A;  4EDG A;  1D3Y A;  3VE5 A;  4JCV A;  3VDP A;  2V1C A;  5GUJ A;  2FCJ A;  1T6T 1;  1EQN A;  4O6O A;  4EDK A;  3B39 A;  2I5R A;  2Q2E A;  2AU3 A;  1DDE A;  3VDU A; 
#chains in the Genus database with same CATH homology
 4E2K A;  4EDV A;  2ZBK A;  4O6P B;  4EDT A;  1DD9 A;  1VDD A;  4EDR A;  4EE1 A;  4EDG A;  1D3Y A;  3VE5 A;  4JCV A;  3VDP A;  2V1C A;  5GUJ A;  1T6T 1;  1EQN A;  4EDK A;  4O6O A;  3B39 A;  2Q2E A;  2AU3 A;  1DDE A;  3VDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...