3VDPA

Structure and biochemical studies of the recombination mediator protein recr in recfor pathway
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
197
structure length
197
Chain Sequence
b'YYSTSVAKLIEELSKLPGIGPKTAQRLAFFIINMPLDEVRSLSQAIIEAKEKLRYCKICFNITDKEVCDICSDENRDHSTICVVSHPMDVVAMEKVKEYKGVYHVLHGVISPIEGVGPEDIRIKELLERVRDGSVKEVILATNPDIEGEATAMYIAKLLKPFGVKVTRIAHGIPVGGDLEYTDVVTLSKALEGRREV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombination protein recR
publication title RecOR complex including RecR N-N dimer and RecO monomer displays a high affinity for ssDNA
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Recombination
total genus 59
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
A PF02132 RecR RecR protein
A PF13662 Toprim_4 Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.420 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vdpA01
3.30.60.80 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3vdpA02
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 3vdpA03
4JCVA 4EDVA 3B39A 1VDDA 2AU3A 4E2KA 4EDKA 2ZBKA 4EDRA 4O6OA 3VDUA 1DD9A 5GUJA 3D00A 4O6PB 1DDEA 4EDGA 4EE1A 1T6T1 1EQNA 1D3YA 4EDTA 3VDPA 2V1CA 2Q2EA 3VE5A
chains in the Genus database with same CATH superfamily
3SBJA 1XNRM 1XXHA 1T6OA 2QZ4A 3B7QA 1Y1BA 2VF7A 4QNRA 1F4IA 5ITUA 4LF9M 4LGMA 4Z6YA 3GQ5A 1XNQM 4OW0A 3U61A 2ZTCA 1IN5A 1SGDI 3JR4A 1G71A 2XZUA 2YNMD 2EKFA 5J8FA 4AMLA 3KP1E 5ITRA 3TE6A 1OJLA 4L6V6 3SAVA 1R0RI 1GKIA 3IG5A 2DWLA 3E59A 1PTQA 1TIHA 4WP4A 5ITQA 2B8TA 3HWSA 2KDLA 2DB6A 2RKOA 5DNYA 3B4VC 2F5OA 1TUSA 4DV3M 4ZPXA 2I7NA 1TF0B 3TO7A 2JZMA 1PGYA 5FUXA 2E5LM 2QCUA 1P3QQ 1UM8A 1TDHA 5IT9S 4NL4H 2K9HA 4OVZB 1SXJB 1HT2E 3WHLA 1WGCA 1E94E 2JNHA 2DAMA 1HQCA 2FH0A 3SYLA 1N78A 1YSYA 4JI6M 1QDTA 2ENNA 3BBZA 1IFYA 2Y20A 2NU3I 1N77A 3U60A 2QPOA 4LGYA 1HQYE 2M5XA 2ERWA 3I4YA 2X4AA 3GLHE 1OMTA 3T38A 4RF1A 2B3TA 2R18A 4DNCA 4E1RA 2KCXA 1EQNA 2W82A 1PJIA 2HCBA 1XA6A 4L9MA 4LRTA 5DAEA 1PTRA 2LEOA 3PDNA 1SGQI 1C1KA 1HDLA 2GKRI 1BVSA 4M0DA 3GOXA 3HX3A 4QNMA 1OAIA 3D8BA 2GKTI 4QOZC 4CISA 3SHFA 2XFSA 4JCVA 4MM3B 1MN3A 3FUVA 3GRYA 2VF8A 4AW4A 1J5EM 3FE3A 1X4SA 3CGWA 3UEJA 1ZMUA 3EIHA 4JI2M 1WJ7A 2QHOB 1VEKA 2QQDA 1HNWM 2OD1A 3UZUA 1OFHA 4LZZA 2RIJA 3CTWB 2O5RA 2GVIA 5L8RF 5J8CA 1IXSA 5ITYA 1L8QA 1IY6A 4JYAM 1K3XA 2ERCA 5E6JA 4IBFA 2CFOA 3GLGE 2DENA 2ZBKB 4OU7A 3FTDA 2NU2I 3I04M 2R6FA 2EUCA 1VEGA 3R5BA 1NJFA 4K0KM 4GEWA 1IN4A 1FAQA 2QNJA 2QBYB 3B7NA 3KP0E 2K47A 2KHHA 1CT2I 3RGSA 3ILKA 5IZ7D 3HKPA 4LJAA 5EP4A 3VK7A 3GO8A 3HGIA 5BR8M 2AU3A 1HR0M 1KFVA 4W5WA 2CWBA 2QQ8A 1PJJA 4JI3M 4PCZA 4REZA 2KNAA 1MJAA 5IWAM 2XGNA 2CWGA 2DKLA 4AKGA 1NY5A 1QZMA 3KS4A 2Q2EA 1G41A 3FUUA 3MMPA 2FNFX 1DO2A 4LF5M 3UFFA 1LV7A 1IXZA 1LTMA 2ENZA 4EDTA 4PDGA 4JI5M 3OTOM 4YHHM 2JY7A 4UN2B 4QOSA 2LHGA 1IXRC 1D0KA 2QSFX 3OXGA 2AHMA 1TBRR 3AV0A 1KYIA 2DZLA 5A2QS 1D2NA 5JHWC 2M5ZA 2BWEA 3AOGA 1BMOA 1UHAA 1GJSA 1EFUB 2CV1A 2DAIA 2P6AC 3FUXA 3FYDA 2Z4RA 1SGYI 2R4EA 2JXDA 1Q3CA 1FY7A 3WHKA 2ZANA 3R5CA 4DR3M 4RF0A 3TQSA 2YUUA 1GVNA 3SASA 2QENA 3A98B 2YQPA 4FWDA 1VG5A 2BJWA 3GLFB 2OO9A 5HI7A 4ANRA 3QTLD 4R7GA 1C7YA 5DYIA 4LFAM 1QDRA 4LF4M 1UVFA 2WVJA 3K92A 3W68A 1MJ9A 2OU2A 4CHTB 1J09A 3BOSA 3QAHA 1N33M 3DZDA 3SMSA 3TL4X 1YE9A 4LFBM 1DDEA 1D3YA 1VDDA 3GLHA 3HU3A 2CHVA 2KMRA 3IECA 3QAUA 4G6ZA 1XMQM 3MEKA 4L16A 1MU5A 3D00A 2CE7A 2C99A 2LVNC 1AN1I 1HNZM 3U5ZB 2Y21A 4DR7M 2V6ZM 4BLCA 2UUAM 2DWZB 4L78A 4G4RA 2LB7A 1W5SA 2DNAA 2OOBA 2X3TA 1Z7KB 1GL7A 3LQRA 3RE8A 1NJGA 4G4NA 3FKEA 4GMQA 1T3TA 4I81A 3HJ8A 4IBKA 2N35A 3LQQA 2WCYA 2LVQD 3OXFA 3CXLA 1NO1A 1W4RA 1LR8A 5C1BA 1OTRA 4X66M 2OVOA 2LNHC 3MHVC 2DWNA 3B89A 5JI2E 1QAMA 2R4JA 1PJSA 4NXNM 2QQ0A 4WP2A 3UK6A 2XH9A 2JW6A 4GI3C 1G3IA 3KFUG 3VKHA 3CF0A 4P16A 4DV7M 1QANA 1ULKA 2V53A 3FSXA 2DAGA 2UXBM 4HEOA 1VDLA 3DA1A 3GLGA 1YUBA 1QYRA 4LF8M 2L7XA 2L8EA 2WGCA 1NSFA 1TH3A 3U61B 1Q9BA 3E46A 2OZUA 2DAKA 1FJGM 2CUZA 3GRUA 1OYVI 4EDVA 3DFZA 1XBTA 3GLIE 2D7HA 1W5TA 2MGWA 4GC9A 4OVOA 1HT1E 2KRUA 3TJQA 2JYYA 2K0BX 4JI8M 4IBJA 4JXJA 2GKVA 2ZTDA 2F3CI 4IBGA 1A5TA 4I8OA 4MPIA 3HU1A 4GKJM 4EDRA 4FCTA 2KRKA 3TO6A 3FTFA 1QAOA 2C98A 1OAOC 2BNKA 4Z8XA 2K6BA 3D8LA 1P9GA 2XFTA 1GO5A 1WHCA 4KO8A 3NBIA 1JR3D 2J9RA 4JI7M 3PNYA 1PJTA 3TO9A 4DV4M 3SGBI 3A42A 4M9ZA 5FTNA 3KY9A 1RU3A 3KOYE 5FUYA 1Y8GA 4GITA 3QWLA 3J27B 4PT5A 2VQFM 1ZQ9A 3C9PA 3SARA 3SFZA 2VQEM 1FARA 2N71A 2D7EA 2GIVA 4D81A 3FTCA 2WSEF 3QYBA 3TOBA 4B3RM 1XHBA 1CUKA 4DV6M 2ZAOA 3UGLA 1G8PA 3AFHA 1V1HA 3GPPA 1K7UA 3HHZA 2O25A 2DHRA 1L2DA 5ITTA 4IJEA 1YU6C 1EE8A 1NVMA 2MH8A 1ZMWA 3H4MA 1L1ZA 3KSXA 3R9XB 2HHHM 1NY6A 1FYBA 3U6MA 3FTEA 1YTPA 2KXEA 4WW0A 4LZJA 1Z59A 1IY1A 4JI4M 4LJ5A 5KQDA 4X64M 5EP1A 3L26A 3W0LB 1OQYA 3KDSE 4NRVA 3FC3A 2JY5A 1R2YA 4EDGA 2CJSC 2QP9X 1HJPA 1G4AE 3K2LA 1IN8A 3EIEA 2UXCM 1TH2A 1L2CA 2VDBB 2MROB 2RGHA 1R79A 1IN6A 2M60A 2JUJA 4B7FA 4R3DA 1XWIA 4GH9A 3VDPA 5KPRA 2KZSA 1P9ZA 1TDZA 1M8BA 2FS1A 4JV5M 5ITXE 1NUBA 4AZFA 2B0UC 4XK8F 1MJBA 1SXJD 2KNZA 3HU2A 4JI1M 1IXSB 3UGDA 1OKSA 1JR3E 4FCWA 4KLNA 1IBMM 1CHOI 3W0FA 2QQCA 4FD2A 4BBAA 3HH2C 1IY5A 3T6PA 4GHLA 1PJUA 1IY0A 1NNUC 3GRRA 2N17A 2JZ0A 5FUWA 2L4FA 3OVOA 5DFLA 4CGYB 3LMMA 2KNVA 1TGUA 1OMUA 4L15A 9WGAA 3K8ZA 4P17A 1GJTA 2X49A 1WTJA 1OIZA 4NC6A 4JN6A 2HWJA 2FOIC 4A24A 3U6EA 3ZH9B 2Q2EB 2Y0TA 2CHGA 2XSZD 3UGIA 1L1TA 2CRUA 1IY2A 1MT1A 1XX6A 4MGYE 1R6BX 1WXQA 4DR4M 2EKKA 2DVWB 1DS2I 4LJ7A 2MR9A 4LJ9A 4Y28F 2JY6B 1W3SA 3HHYA 3GLIA 3U6OA 3E4RA 2F5QA 3SAUA 2N52A 4PDIA 1DD9A 5KPTA 3UEYA 4MGZE 1ULNA 3LCUA 4DV1M 1FNNA 5EXSA 1KBEA 1SXJE 3B9PA 2DHYA 1WKXA 3Q8GA 4IBDA 4DR1M 7WGAA 2Z4SA 3MK6A 1U5KA 2DIPA 2GNOA 3QWPA 3ZQJA 4FW9A 5E3RA 1CGJI 3K9OA 2FE8A 3L29A 3GPXA 2ARPF 1Z5BA 3VDUA 1Y8FA 3LVWA 2SGQI 5BPVA 2OPFA 3TWLA 3FD9A 1S20A 3IHPA 1PJQA 4DV0M 3KOXE 2JY8A 2EJSA 4OX9M 5FTJA 3L28A 5EJCA 3GQ3A 2KMQA 3JAMS 2UUBM 1DGHA 3KS8A 2RRUA 3E21A 3R5DA 4IBEA 2UXDM 1DS3I 2A20A 1VQ1A 2FNAA 4I5SA 1T43A 4RNAA 3KW6A 2KW0A 2UVOA 3T1YM 2E73A 2D7GA 2LUYA 1S3SA 2JWSA 2MJ5B 3U6LA 3RFWA 1Z5CA 4EIWA 5E3QA 4MH0E 2ZM6M 3J7BA 1K7VA 4YY3M 2LTUA 5C18A 1R5LA 4B6DA 4G3OA 1QZEA 1IW4A 1WIVA 2V1UA 4UXIA 1M8CA 2FFJA 4G4QA 3U5ZA 2XF3A 1Q39A 5EQTA 7CATA 3LVVA 4NRWA 2NU4I 1WGNA 2LH0A 1CT0I 4QHTA 4LF6M 4LFCM 3DOAA 3E2IA 2V1CC 1D0MA 5CCLA 3R5AA 1V34A 5E3PA 3Q8XA 4L4UA 4FWHA 3HHWA 1JQJC 3I4VA 3W67A 5ITXA 3C58A 2RC4A 2DI0A 3LCVB 1ZMVA 2Z3XA 4LJ8A 2C9OA 1JR3A 4GHAA 4KHPM 4CJ6A 1IM2A 2C5RA 2J87A 2F4VM 1GL6A 2L6OA 3SHGB 3GLGB 1XXHB 1UUCA 1K3WA 5HQ8A 5EX0A 2I5RA 1R7RA 4G4OA 2HL7A 1SGEI 2YFQA 2X52A 1AUAA 5KO3A 1GLNA 3L27A 3TPZA 1QUTA 2DWMA 2YQZA 1MX0A 2N1AB 4HGUA 2E5RA 4LRSA 2XZFA 4NXMM 1OFIA 1Z2IA 3HY5A 5GUJA 3K1JA 2BJVA 3GPUA 3JR5A 1J7KA 3LW5F 3QYEA 3VE5A 3B39A 3U6SA 2UZ3A 3SGQI 4TUWA 2CEAA 3PNVA 1N32M 2NQ8C 2ORWA 4II7A 1NHWC 4ITQA 3VK8A 2LWXA 4LG2A 3J81S 2SGEI 4AI6A 1UVGA 4IBCA 1TURA 3B7ZA 2KA6B 1TTEA 1QUSA 4O6OA 1CSOI 4DV2M 5FTLA 1NXUA 3L25A 3AKZA 1LR7A 3PXGA 1NV8A 4E1PA 3U6PA 3SEKC 2VIIA 2VRWB 3AL0C 1AIPC 1D0LA 2Z7JA 3M7GA 4QHSA 1TBQR 2QQEA 4AG6A 4AKHA 2KMPA 2C96A 1Y1CA 2J7NA 2APLA 4UXHA 3U60B 4OVZA 1SXJA 2EA0A 3MJ5A 3GLFE 4RKUF 1PRBA 1WR1B 1YLAA 1E9RA 4MGKE 4LJ4A 3R8FA 4IJFA 1ULMA 4DV5M 1ZAEA 2L7IA 1DGFA 4AG5A 2CWHA 1SXJC 3FYCA 2BUSA 4MB7A 4FCVA 1QQWA 4M9XA 2QPAA 5DYGA 4A3VB 2DZOB 4CIZA 5FSWA 3PFIA 2XEPA 1GABA 3T1HM 4XGIA 1NNJA 4NOOB 2CV2A 3L2AA 4AKIA 1VEJA 2OOAA 4IBBA 2PQ8A 2CV0A 4L8RC 4X65M 2R65A 1V1IA 1HPTA 2R46A 3SATA 4MGIE 5JI3E 4D82A 1E9SA 1IBLM 3KSJA 1IN7A 2WZJA 4XBOA 3SAWA 2ORVA 2XSZA 3BJIA 2R44A 2CHQA 2SGFI 2J7OA 3GP1A 2ODDA 5EXXA 3TWMA 2HAKA 1WGLA 2EO2A 3SC3A 3U6QA 4HL4A 4M9SA 2KEBA 2H1RA 1L2BA 3B74A 4WURA 2Y0QA 3FUTA 3T15A 1IQPA 3UGJA 1TOTA 3UOEA 4FVMA 4GC5A 2HKJA 3A46A 2L09A 3J80S 2UU9M 1XXHE 1R4GA 4BB9A 1ZV1A 1KMAA 2ZBKA 1SGPI 5EX3A 1CE3A 3RU0A 4KT0F 4KODA 2C9CA 4IIWA 1QVRA 1V92A 2UUCM 3C3EA 1X74A 2LHCA 4LJ6A 1SG9A 5FTMA 1H0ZA 4E2KA 3U6CA 2GQFA 3M6AA 1TH4A 5FTKA 1PM5A 2QBYA 1SGRI 3ZCBB 1N34M 2XRCA 2P5TA 3ZC7B 4DUZM 1DV0A 1HJAI 2KZUA 4FWGA 1UFZA 2K9DA 4R71A 4DR2M 4MGHA 2SGDI 2FCJA 2NU1I 2ROWA 3PVSA 5CCMA 2KMOA 3UMMA 1ORYB 3GLIB 3GRVA 2ELIA 3I51A 1PPFI 1KBFA 3OXLA 2F5SA 2W0TA 4JI0M 2BWBA 3GPYA 3AJIB 3HJQA 3KOZE 3HHXA 4GKKM 1SGNI 3HZJA 2DAEA 3OL0A 1X37A 3J2PB 5KQ8A 3TOAA 1XMOM 1DO0A 3E9SA 4DUYM 2WSFF 3HJSA 3C3DA 4B3SM 4UXJA 5FLXS 3CF2A 1OIPA 2H5XA 2J5YA 2LBCA 1TBNA 4I4LA 4B7HA 5FUVA 1BUSA 4LF7M 2A5YB 4PD2A 5EXPA 3K9PA 4NSRA 2NU0I 2XLJA 4DR5M 1RFHA 1JB0F 4B7GA 1H6UA 2WSCF 3IG8A 1N75A 3BXWA 2L2DA 4X62M 2L4EA 2JXNA 5LMNM 1HEVA 5EP2A 4F2LA 5H37D 3VLFB 4F1IA 4DBGB 1K82A 1NV9A 4HLQA 4B3MM 4FKDA 1DGBA 1DGHB 2DZNB 2G8LA 5LMUM 4DR6M 4GIPA 1EIJA 3KOWE 3M0EA 4O6PB 3H4JA 4SGBI 3GLFA 3KXEC 3CF6E 4Q7JA 2Y0MA 1DGGA 5E26A 3VKGA 1I94M 3GLHB 4JCVE 3FRIA 1KSFX 1Z5AA 3TWKA 1MJGM 2DKVA 4LCBA 1Q3BA 2ZAMA 2CWFA 1XB2B 1HNXM 2LVOC 1XC8A 1TGSI 5IREB 2OQ4A 1NHGC 2L7HA 5EP3A 2RGOA 2JZ1A 4LY6A 3J7AS 3FSYA 3NBXX 3FRHA 2G3QA 1WGTA 3F92A 1E32A 1I4WA 3SYKA 1V33A 2V1CA 2R62A 2SGPI 1QAQA 1N36M 3VFDA 3UJNA 5KPZA 2JA1A 4S12A 1LR9A 3THGA 1Z6TA 3RGPA 1PCEA 2O01F 1R2ZA 1OVOA 1G59A 3GQ4A 3KVWA 2G5GX 2JA2A 2R45A 1TBOA 2R0IA 2JP7A 8CATA 1Q02A 4D80A 5F3WA 4M0WA 1N13A 2CP8A 2F5NA 3V76A 3NWLA 2DXIA 4B08A 4NSOB 2F5PA 3I01M 4AQYM 4EE1A 3U6DA 1TR8A 3AOEA 2Z8YM 4GRIA 4IBIA 4B3TM 1K7TA 2LVPC 1CGII 3SMPA 3A45A 4EDKA 2I7PA 2X8AA 1IBKM 2LVAA 2LXEA 3AOEC 5EXTA 3FUWA 1T6T1 1CT4I 2YR0A 5GKNA
chains in the Genus database with same CATH topology
1QQWA 4LFAM 3SBJA 1XNRM 1XXHA 3K8ZA 2QZ4A 1Y1BA 4M9XA 2QPAA 5DYGA 4A3VB 2DZOB 5FSWA 4LF4M 1UVFA 2WVJA 3K92A 2X49A 3PFIA 4CHTB 1J09A 3BOSA 4QNRA 2XEPA 5ITUA 1N33M 3DZDA 4JN6A 4LF9M 2FOIC 4LGMA 3SMSA 4Z6YA 3TL4X 1YE9A 3GQ5A 3T1HM 1XNQM 4OW0A 4A24A 4XGIA 3U6EA 4LFBM 1DDEA 3U61A 1NNJA 3ZH9B 2Q2EB 1D3YA 2Y0TA 4NOOB 2CHGA 1IN5A 1VDDA 2CV2A 1SGDI 2XSZD 3JR4A 3UGIA 1L1TA 3L2AA 3GLHA 4AKIA 1IY2A 3HU3A 2CHVA 2XZUA 2YNMD 2KMRA 4IBBA 1MT1A 3QAUA 1XX6A 4G6ZA 1XMQM 3MEKA 4L16A 4MGYE 2CV0A 1MU5A 1R6BX 1WXQA 4L8RC 3KP1E 4X65M 2R65A 5ITRA 1V1IA 3TE6A 2CE7A 4DR4M 3D00A 2C99A 1HPTA 2R46A 1AN1I 1HNZM 3SATA 2DVWB 1DS2I 3U5ZB 4LJ7A 4MGIE 5JI3E 2Y21A 4DR7M 2V6ZM 4LJ9A 4D82A 4BLCA 1E9SA 1W3SA 1IBLM 2UUAM 3KSJA 3HHYA 3GLIA 2DWZB 1OJLA 3U6OA 3SAVA 1R0RI 1IN7A 1GKIA 4L78A 3E4RA 4G4RA 2F5QA 4XBOA 3IG5A 2DWLA 1W5SA 3SAWA 2ORVA 2XSZA 3E59A 3BJIA 1PTQA 1TIHA 3SAUA 1Z7KB 2N52A 5ITQA 1GL7A 3LQRA 3RE8A 2CHQA 1NJGA 3HWSA 4PDIA 4G4NA 2B8TA 1DD9A 5KPTA 2SGFI 3UEYA 3FKEA 2DB6A 4GMQA 4MGZE 1T3TA 2J7OA 2RKOA 4I81A 3GP1A 3HJ8A 5DNYA 3B4VC 2F5OA 1TUSA 4DV3M 4DV1M 4IBKA 1FNNA 4ZPXA 2I7NA 5EXSA 1KBEA 3LQQA 2ODDA 2WCYA 5EXXA 3OXFA 3CXLA 1SXJE 1W4RA 2JZMA 3B9PA 3TWMA 1LR8A 5FUXA 2E5LM 2QCUA 5C1BA 2EO2A 3SC3A 4X66M 2OVOA 4IBDA 4DR1M 2LNHC 3U6QA 3MHVC 2Z4SA 1UM8A 3MK6A 5JI2E 1TDHA 1QAMA 2DWNA 4HL4A 4M9SA 2KEBA 2H1RA 1L2BA 5IT9S 1U5KA 4NL4H 2DIPA 2K9HA 4WURA 2Y0QA 2R4JA 3FUTA 3T15A 4OVZB 1SXJB 3QWPA 4NXNM 1IQPA 3UGJA 4FW9A 2QQ0A 1HT2E 3WHLA 3UK6A 1E94E 1CGJI 2XH9A 2FE8A 1TOTA 3L29A 4FVMA 4GC5A 3GPXA 2JW6A 2HKJA 3A46A 4GI3C 2L09A 1G3IA 3J80S 2UU9M 3KFUG 1HQCA 4BB9A 3VKHA 3SYLA 2ARPF 1KMAA 3CF0A 1N78A 1YSYA 4JI6M 1SGPI 2ZBKA 5EX3A 1CE3A 1Z5BA 2ENNA 3RU0A 4P16A 3VDUA 1Y8FA 3LVWA 4DV7M 1QANA 4KODA 2C9CA 2V53A 4IIWA 2SGQI 5BPVA 2OPFA 3TWLA 3FD9A 2Y20A 1QVRA 2NU3I 1N77A 3U60A 2UUCM 2QPOA 4DV0M 2UXBM 1X74A 3DA1A 3GLGA 3KOXE 4LGYA 4LJ6A 1HQYE 4OX9M 1YUBA 5FTJA 1QYRA 5FTMA 1H0ZA 3L28A 5EJCA 3U6CA 2M5XA 2ERWA 4E2KA 3I4YA 3GQ3A 2KMQA 3M6AA 4LF8M 1TH4A 5FTKA 2L7XA 2X4AA 3JAMS 2L8EA 1PM5A 1DGHA 2UUBM 2QBYA 3KS8A 1SGRI 1OMTA 3T38A 4RF1A 3ZCBB 1N34M 1NSFA 1TH3A 3U61B 2R18A 4E1RA 2KCXA 1EQNA 4IBEA 2UXDM 5GKNA 1FJGM 2XRCA 2W82A 1PJIA 2CUZA 3GRUA 1DS3I 1OYVI 2HCBA 1XA6A 4L9MA 4EDVA 4LRTA 3ZC7B 5DAEA 2A20A 1PTRA 2LEOA 4DUZM 2FNAA 4I5SA 1HJAI 3PDNA 2KZUA 3DFZA 4RNAA 1SGQI 1XBTA 1C1KA 4FWGA 2D7HA 1W5TA 4OVOA 3KW6A 2KW0A 4GC9A 1HT1E 1HDLA 2GKRI 2KRUA 3TJQA 4DR2M 4M0DA 2JYYA 4MGHA 3T1YM 2SGDI 3GOXA 2NU1I 2ROWA 2E73A 2D7GA 2LUYA 1S3SA 4QNMA 3PVSA 3D8BA 4JI8M 5CCMA 2GKTI 2KMOA 4QOZC 3UMMA 4IBJA 4CISA 4JXJA 2GKVA 3SHFA 1ORYB 3GLIB 3GRVA 3U6LA 2XFSA 3RFWA 1Z5CA 4MM3B 4EIWA 4JCVA 2F3CI 2ELIA 3I51A 4IBGA 4MH0E 3FUVA 2ZM6M 1PPFI 3OXLA 1KBFA 3J7BA 2F5SA 4I8OA 2W0TA 3GRYA 4AW4A 4YY3M 4JI0M 5C18A 1J5EM 3GPYA 3HU1A 4GKJM 4EDRA 4FCTA 3AJIB 3HJQA 3KOZE 3HHXA 2KRKA 4B6DA 1IW4A 3FTFA 4GKKM 1QAOA 1X4SA 2V1UA 4UXIA 1SGNI 1M8CA 2FFJA 4G4QA 3UEJA 3U5ZA 2C98A 3EIHA 3OL0A 2XF3A 1X37A 3J2PB 5KQ8A 4JI2M 2BNKA 1Q39A 5EQTA 1XMOM 7CATA 1DO0A 3LVVA 4Z8XA 3D8LA 2XFTA 4NRWA 4KO8A 3E9SA 2NU4I 4DUYM 2QQDA 3NBIA 1HNWM 2OD1A 3UZUA 1OFHA 1JR3D 3HJSA 4LZZA 2LH0A 4B3SM 2J9RA 4JI7M 4UXJA 1CT0I 5FLXS 3CF2A 2O5RA 3CTWB 2GVIA 3PNYA 4QHTA 4LF6M 4LFCM 4DV4M 3DOAA 3SGBI 3E2IA 1TBNA 2V1CC 4I4LA 5CCLA 3A42A 4M9ZA 4B7HA 5FTNA 5FUVA 3Q8XA 1BUSA 4L4UA 5ITYA 3KOYE 4LF7M 4FWHA 3KY9A 2A5YB 5FUYA 1L8QA 1IY6A 3HHWA 4GITA 3QWLA 1JQJC 3J27B 3I4VA 4JYAM 4PT5A 2VQFM 4PD2A 5EXPA 1K3XA 1ZQ9A 5ITXA 3C58A 2ERCA 3SARA 4NSRA 5E6JA 4IBFA 2NU0I 2XLJA 2CFOA 4DR5M 1RFHA 3SFZA 4OU7A 2ZBKB 2VQEM 1FARA 3FTDA 2NU2I 4B7GA 2Z3XA 2N71A 1H6UA 2D7EA 2EUCA 4LJ8A 4D81A 2C9OA 1JR3A 3FTCA 4GHAA 3IG8A 1N75A 4KHPM 1IM2A 2C5RA 1XHBA 4B3RM 4X62M 2J87A 4DV6M 5LMNM 2F4VM 1GL6A 2L6OA 2ZAOA 5EP2A 3UGLA 3SHGB 1NJFA 5H37D 1G8PA 3VLFB 3GLGB 4K0KM 1XXHB 1UUCA 3AFHA 1V1HA 1K82A 3GPPA 1K3WA 5EX0A 5HQ8A 4HLQA 4B3MM 1IN4A 1R7RA 3HHZA 4G4OA 1FAQA 2HL7A 4FKDA 1SGEI 2DHRA 1L2DA 1DGBA 1DGHB 2QBYB 5ITTA 2DZNB 3KP0E 2G8LA 2YFQA 2K47A 4IJEA 5LMUM 4DR6M 1EE8A 1YU6C 1NVMA 5KO3A 1GLNA 3L27A 4GIPA 3H4MA 3TPZA 3KOWE 1L1ZA 1CT2I 3M0EA 3KSXA 2DWMA 3RGSA 2HHHM 3R9XB 4O6PB 4SGBI 1NY6A 3GLFA 3ILKA 2YQZA 5IZ7D 3HKPA 3KXEC 4LJAA 1FYBA 3CF6E 5EP4A 1MX0A 3VK7A 3GO8A 3HGIA 3U6MA 3FTEA 5BR8M 1YTPA 2AU3A 1HR0M 2N1AB 2KXEA 4WW0A 1KFVA 1DGGA 4LZJA 4W5WA 5E26A 1Z59A 3VKGA 4HGUA 1I94M 3GLHB 2E5RA 4LRSA 2XZFA 4NXMM 1IY1A 4JCVE 1OFIA 1KSFX 1Z5AA 4JI4M 3TWKA 4LJ5A 5KQDA 4X64M 5EP1A 3L26A 1PJJA 3W0LB 4JI3M 4PCZA 3KDSE 4NRVA 4REZA 4LCBA 5GUJA 3K1JA 1Q3BA 3FC3A 2ZAMA 5IWAM 2XGNA 1R2YA 4EDGA 2CJSC 1HNXM 1XC8A 1TGSI 4AKGA 2BJVA 3GPUA 1NY5A 5IREB 1QZMA 2OQ4A 2QP9X 3JR5A 3KS4A 1J7KA 3VE5A 2Q2EA 1G41A 1NHGC 3B39A 1G4AE 3FUUA 3U6SA 2L7HA 2UZ3A 4TUWA 3SGQI 3K2LA 1IN8A 2CEAA 5EP3A 2RGOA 3EIEA 2UXCM 1TH2A 4LY6A 3PNVA 1N32M 2NQ8C 1L2CA 4II7A 2ORWA 3J7AS 1R79A 2RGHA 1NHWC 4ITQA 1DO2A 3VK8A 2LWXA 2FNFX 1IN6A 2M60A 4LG2A 4LF5M 3UFFA 4B7FA 1E32A 1LV7A 1I4WA 4R3DA 3SYKA 3J81S 1IXZA 1XWIA 4GH9A 2ENZA 4EDTA 3VDPA 2SGEI 4PDGA 5KPRA 2KZSA 2V1CA 4JI5M 2R62A 3OTOM 4AI6A 2SGPI 1QAQA 1N36M 3VFDA 1UVGA 3UJNA 5KPZA 2JA1A 4IBCA 4YHHM 1TURA 4QOSA 2KA6B 4S12A 1TDZA 1LR9A 3THGA 1M8BA 1IXRC 1Z6TA 3RGPA 4JV5M 3OXGA 1PCEA 2AHMA 5ITXE 1NUBA 1TBRR 3AV0A 1R2ZA 1OVOA 1KYIA 4AZFA 2B0UC 4O6OA 5A2QS 1D2NA 3GQ4A 1G59A 3KVWA 1SXJD 1CSOI 5JHWC 2G5GX 3HU2A 4DV2M 4JI1M 1IXSB 2M5ZA 5FTLA 2JA2A 3AOGA 1BMOA 2R45A 3L25A 3UGDA 1TBOA 3AKZA 1LR7A 8CATA 4FCWA 3PXGA 4KLNA 1IBMM 4E1PA 3U6PA 3SEKC 2VIIA 2VRWB 4D80A 5F3WA 3AL0C 4M0WA 1N13A 2CV1A 2F5NA 1CHOI 2Z7JA 3M7GA 4QHSA 2P6AC 3W0FA 2QQCA 4FD2A 5DYIA 3NWLA 4BBAA 2DXIA 1TBQR 2QQEA 3HH2C 1IY5A 4AG6A 3FUXA 3FYDA 4NSOB 4B08A 2F5PA 4AKHA 2KMPA 2Z4RA 2C96A 1SGYI 2R4EA 1Y1CA 2J7NA 4GHLA 4AQYM 2JXDA 1Q3CA 4EE1A 3U6DA 1PJUA 3U60B 3AOEA 4UXHA 4OVZA 1SXJA 3WHKA 4GRIA 2EA0A 3MJ5A 2ZANA 1NNUC 1IY0A 4DR3M 4RF0A 3TQSA 4IBIA 4B3TM 2YUUA 1E9RA 1GVNA 4MGKE 3SASA 3GRRA 4LJ4A 3R8FA 1CGII 2N17A 3SMPA 3A45A 2QENA 3A98B 2YQPA 5FUWA 4EDKA 4FWDA 4IJFA 2I7PA 2X8AA 4DV5M 1ZAEA 2BJWA 3GLFB 2L7IA 1DGFA 4AG5A 1IBKM 2LXEA 3AOEC 3OVOA 4CGYB 3LMMA 5EXTA 1SXJC 3FUWA 3FYCA 5HI7A 3QTLD 4R7GA 2BUSA 1TGUA 4MB7A 1T6T1 1CT4I 2YR0A 1OMUA 4FCVA 2P5TA 4L15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JCV A;  4EDV A;  3B39 A;  1VDD A;  2AU3 A;  4E2K A;  4EDK A;  2ZBK A;  4EDR A;  4O6O A;  3VDU A;  1DD9 A;  5GUJ A;  3D00 A;  4O6P B;  1DDE A;  4EDG A;  4EE1 A;  1T6T 1;  1EQN A;  1D3Y A;  4EDT A;  3VDP A;  2V1C A;  2Q2E A;  3VE5 A; 
#chains in the Genus database with same CATH topology
 3SBJ A;  1XNR M;  1XXH A;  1T6O A;  2QZ4 A;  3B7Q A;  1Y1B A;  2VF7 A;  4QNR A;  1F4I A;  5ITU A;  4LF9 M;  4LGM A;  4Z6Y A;  3GQ5 A;  1XNQ M;  4OW0 A;  3U61 A;  2ZTC A;  1IN5 A;  1SGD I;  3JR4 A;  1G71 A;  2XZU A;  2YNM D;  2EKF A;  5J8F A;  4AML A;  3KP1 E;  5ITR A;  3TE6 A;  1OJL A;  4L6V 6;  3SAV A;  1R0R I;  1GKI A;  3IG5 A;  2DWL A;  3E59 A;  1PTQ A;  1TIH A;  4WP4 A;  5ITQ A;  2B8T A;  3HWS A;  2KDL A;  2DB6 A;  2RKO A;  5DNY A;  3B4V C;  2F5O A;  1TUS A;  4DV3 M;  4ZPX A;  2I7N A;  1TF0 B;  3TO7 A;  2JZM A;  1PGY A;  5FUX A;  2E5L M;  2QCU A;  1P3Q Q;  1UM8 A;  1TDH A;  5IT9 S;  4NL4 H;  2K9H A;  4OVZ B;  1SXJ B;  1HT2 E;  3WHL A;  1WGC A;  1E94 E;  2JNH A;  2DAM A;  1HQC A;  2FH0 A;  3SYL A;  1N78 A;  1YSY A;  4JI6 M;  1QDT A;  2ENN A;  3BBZ A;  1IFY A;  2Y20 A;  2NU3 I;  1N77 A;  3U60 A;  2QPO A;  4LGY A;  1HQY E;  2M5X A;  2ERW A;  3I4Y A;  2X4A A;  3GLH E;  1OMT A;  3T38 A;  4RF1 A;  2B3T A;  2R18 A;  4DNC A;  4E1R A;  2KCX A;  1EQN A;  2W82 A;  1PJI A;  2HCB A;  1XA6 A;  4L9M A;  4LRT A;  5DAE A;  1PTR A;  2LEO A;  3PDN A;  1SGQ I;  1C1K A;  1HDL A;  2GKR I;  1BVS A;  4M0D A;  3GOX A;  3HX3 A;  4QNM A;  1OAI A;  3D8B A;  2GKT I;  4QOZ C;  4CIS A;  3SHF A;  2XFS A;  4JCV A;  4MM3 B;  1MN3 A;  3FUV A;  3GRY A;  2VF8 A;  4AW4 A;  1J5E M;  3FE3 A;  1X4S A;  3CGW A;  3UEJ A;  1ZMU A;  3EIH A;  4JI2 M;  1WJ7 A;  2QHO B;  1VEK A;  2QQD A;  1HNW M;  2OD1 A;  3UZU A;  1OFH A;  4LZZ A;  2RIJ A;  3CTW B;  2O5R A;  2GVI A;  5L8R F;  5J8C A;  1IXS A;  5ITY A;  1L8Q A;  1IY6 A;  4JYA M;  1K3X A;  2ERC A;  5E6J A;  4IBF A;  2CFO A;  3GLG E;  2DEN A;  2ZBK B;  4OU7 A;  3FTD A;  2NU2 I;  3I04 M;  2R6F A;  2EUC A;  1VEG A;  3R5B A;  1NJF A;  4K0K M;  4GEW A;  1IN4 A;  1FAQ A;  2QNJ A;  2QBY B;  3B7N A;  3KP0 E;  2K47 A;  2KHH A;  1CT2 I;  3RGS A;  3ILK A;  5IZ7 D;  3HKP A;  4LJA A;  5EP4 A;  3VK7 A;  3GO8 A;  3HGI A;  5BR8 M;  2AU3 A;  1HR0 M;  1KFV A;  4W5W A;  2CWB A;  2QQ8 A;  1PJJ A;  4JI3 M;  4PCZ A;  4REZ A;  2KNA A;  1MJA A;  5IWA M;  2XGN A;  2CWG A;  2DKL A;  4AKG A;  1NY5 A;  1QZM A;  3KS4 A;  2Q2E A;  1G41 A;  3FUU A;  3MMP A;  2FNF X;  1DO2 A;  4LF5 M;  3UFF A;  1LV7 A;  1IXZ A;  1LTM A;  2ENZ A;  4EDT A;  4PDG A;  4JI5 M;  3OTO M;  4YHH M;  2JY7 A;  4UN2 B;  4QOS A;  2LHG A;  1IXR C;  1D0K A;  2QSF X;  3OXG A;  2AHM A;  1TBR R;  3AV0 A;  1KYI A;  2DZL A;  5A2Q S;  1D2N A;  5JHW C;  2M5Z A;  2BWE A;  3AOG A;  1BMO A;  1UHA A;  1GJS A;  1EFU B;  2CV1 A;  2DAI A;  2P6A C;  3FUX A;  3FYD A;  2Z4R A;  1SGY I;  2R4E A;  2JXD A;  1Q3C A;  1FY7 A;  3WHK A;  2ZAN A;  3R5C A;  4DR3 M;  4RF0 A;  3TQS A;  2YUU A;  1GVN A;  3SAS A;  2QEN A;  3A98 B;  2YQP A;  4FWD A;  1VG5 A;  2BJW A;  3GLF B;  2OO9 A;  5HI7 A;  4ANR A;  3QTL D;  4R7G A;  1C7Y A;  5DYI A;  4LFA M;  1QDR A;  4LF4 M;  1UVF A;  2WVJ A;  3K92 A;  3W68 A;  1MJ9 A;  2OU2 A;  4CHT B;  1J09 A;  3BOS A;  3QAH A;  1N33 M;  3DZD A;  3SMS A;  3TL4 X;  1YE9 A;  4LFB M;  1DDE A;  1D3Y A;  1VDD A;  3GLH A;  3HU3 A;  2CHV A;  2KMR A;  3IEC A;  3QAU A;  4G6Z A;  1XMQ M;  3MEK A;  4L16 A;  1MU5 A;  3D00 A;  2CE7 A;  2C99 A;  2LVN C;  1AN1 I;  1HNZ M;  3U5Z B;  2Y21 A;  4DR7 M;  2V6Z M;  4BLC A;  2UUA M;  2DWZ B;  4L78 A;  4G4R A;  2LB7 A;  1W5S A;  2DNA A;  2OOB A;  2X3T A;  1Z7K B;  1GL7 A;  3LQR A;  3RE8 A;  1NJG A;  4G4N A;  3FKE A;  4GMQ A;  1T3T A;  4I81 A;  3HJ8 A;  4IBK A;  2N35 A;  3LQQ A;  2WCY A;  2LVQ D;  3OXF A;  3CXL A;  1NO1 A;  1W4R A;  1LR8 A;  5C1B A;  1OTR A;  4X66 M;  2OVO A;  2LNH C;  3MHV C;  2DWN A;  3B89 A;  5JI2 E;  1QAM A;  2R4J A;  1PJS A;  4NXN M;  2QQ0 A;  4WP2 A;  3UK6 A;  2XH9 A;  2JW6 A;  4GI3 C;  1G3I A;  3KFU G;  3VKH A;  3CF0 A;  4P16 A;  4DV7 M;  1QAN A;  1ULK A;  2V53 A;  3FSX A;  2DAG A;  2UXB M;  4HEO A;  1VDL A;  3DA1 A;  3GLG A;  1YUB A;  1QYR A;  4LF8 M;  2L7X A;  2L8E A;  2WGC A;  1NSF A;  1TH3 A;  3U61 B;  1Q9B A;  3E46 A;  2OZU A;  2DAK A;  1FJG M;  2CUZ A;  3GRU A;  1OYV I;  4EDV A;  3DFZ A;  1XBT A;  3GLI E;  2D7H A;  1W5T A;  2MGW A;  4GC9 A;  4OVO A;  1HT1 E;  2KRU A;  3TJQ A;  2JYY A;  2K0B X;  4JI8 M;  4IBJ A;  4JXJ A;  2GKV A;  2ZTD A;  2F3C I;  4IBG A;  1A5T A;  4I8O A;  4MPI A;  3HU1 A;  4GKJ M;  4EDR A;  4FCT A;  2KRK A;  3TO6 A;  3FTF A;  1QAO A;  2C98 A;  1OAO C;  2BNK A;  4Z8X A;  2K6B A;  3D8L A;  1P9G A;  2XFT A;  1GO5 A;  1WHC A;  4KO8 A;  3NBI A;  1JR3 D;  2J9R A;  4JI7 M;  3PNY A;  1PJT A;  3TO9 A;  4DV4 M;  3SGB I;  3A42 A;  4M9Z A;  5FTN A;  3KY9 A;  1RU3 A;  3KOY E;  5FUY A;  1Y8G A;  4GIT A;  3QWL A;  3J27 B;  4PT5 A;  2VQF M;  1ZQ9 A;  3C9P A;  3SAR A;  3SFZ A;  2VQE M;  1FAR A;  2N71 A;  2D7E A;  2GIV A;  4D81 A;  3FTC A;  2WSE F;  3QYB A;  3TOB A;  4B3R M;  1XHB A;  1CUK A;  4DV6 M;  2ZAO A;  3UGL A;  1G8P A;  3AFH A;  1V1H A;  3GPP A;  1K7U A;  3HHZ A;  2O25 A;  2DHR A;  1L2D A;  5ITT A;  4IJE A;  1YU6 C;  1EE8 A;  1NVM A;  2MH8 A;  1ZMW A;  3H4M A;  1L1Z A;  3KSX A;  3R9X B;  2HHH M;  1NY6 A;  1FYB A;  3U6M A;  3FTE A;  1YTP A;  2KXE A;  4WW0 A;  4LZJ A;  1Z59 A;  1IY1 A;  4JI4 M;  4LJ5 A;  5KQD A;  4X64 M;  5EP1 A;  3L26 A;  3W0L B;  1OQY A;  3KDS E;  4NRV A;  3FC3 A;  2JY5 A;  1R2Y A;  4EDG A;  2CJS C;  2QP9 X;  1HJP A;  1G4A E;  3K2L A;  1IN8 A;  3EIE A;  2UXC M;  1TH2 A;  1L2C A;  2VDB B;  2MRO B;  2RGH A;  1R79 A;  1IN6 A;  2M60 A;  2JUJ A;  4B7F A;  4R3D A;  1XWI A;  4GH9 A;  3VDP A;  5KPR A;  2KZS A;  1P9Z A;  1TDZ A;  1M8B A;  2FS1 A;  4JV5 M;  5ITX E;  1NUB A;  4AZF A;  2B0U C;  4XK8 F;  1MJB A;  1SXJ D;  2KNZ A;  3HU2 A;  4JI1 M;  1IXS B;  3UGD A;  1OKS A;  1JR3 E;  4FCW A;  4KLN A;  1IBM M;  1CHO I;  3W0F A;  2QQC A;  4FD2 A;  4BBA A;  3HH2 C;  1IY5 A;  3T6P A;  4GHL A;  1PJU A;  1IY0 A;  1NNU C;  3GRR A;  2N17 A;  2JZ0 A;  5FUW A;  2L4F A;  3OVO A;  5DFL A;  4CGY B;  3LMM A;  2KNV A;  1TGU A;  1OMU A;  4L15 A;  9WGA A;  3K8Z A;  4P17 A;  1GJT A;  2X49 A;  1WTJ A;  1OIZ A;  4NC6 A;  4JN6 A;  2HWJ A;  2FOI C;  4A24 A;  3U6E A;  3ZH9 B;  2Q2E B;  2Y0T A;  2CHG A;  2XSZ D;  3UGI A;  1L1T A;  2CRU A;  1IY2 A;  1MT1 A;  1XX6 A;  4MGY E;  1R6B X;  1WXQ A;  4DR4 M;  2EKK A;  2DVW B;  1DS2 I;  4LJ7 A;  2MR9 A;  4LJ9 A;  4Y28 F;  2JY6 B;  1W3S A;  3HHY A;  3GLI A;  3U6O A;  3E4R A;  2F5Q A;  3SAU A;  2N52 A;  4PDI A;  1DD9 A;  5KPT A;  3UEY A;  4MGZ E;  1ULN A;  3LCU A;  4DV1 M;  1FNN A;  5EXS A;  1KBE A;  1SXJ E;  3B9P A;  2DHY A;  1WKX A;  3Q8G A;  4IBD A;  4DR1 M;  7WGA A;  2Z4S A;  3MK6 A;  1U5K A;  2DIP A;  2GNO A;  3QWP A;  3ZQJ A;  4FW9 A;  5E3R A;  1CGJ I;  3K9O A;  2FE8 A;  3L29 A;  3GPX A;  2ARP F;  1Z5B A;  3VDU A;  1Y8F A;  3LVW A;  2SGQ I;  5BPV A;  2OPF A;  3TWL A;  3FD9 A;  1S20 A;  3IHP A;  1PJQ A;  4DV0 M;  3KOX E;  2JY8 A;  2EJS A;  4OX9 M;  5FTJ A;  3L28 A;  5EJC A;  3GQ3 A;  2KMQ A;  3JAM S;  2UUB M;  1DGH A;  3KS8 A;  2RRU A;  3E21 A;  3R5D A;  4IBE A;  2UXD M;  1DS3 I;  2A20 A;  1VQ1 A;  2FNA A;  4I5S A;  1T43 A;  4RNA A;  3KW6 A;  2KW0 A;  2UVO A;  3T1Y M;  2E73 A;  2D7G A;  2LUY A;  1S3S A;  2JWS A;  2MJ5 B;  3U6L A;  3RFW A;  1Z5C A;  4EIW A;  5E3Q A;  4MH0 E;  2ZM6 M;  3J7B A;  1K7V A;  4YY3 M;  2LTU A;  5C18 A;  1R5L A;  4B6D A;  4G3O A;  1QZE A;  1IW4 A;  1WIV A;  2V1U A;  4UXI A;  1M8C A;  2FFJ A;  4G4Q A;  3U5Z A;  2XF3 A;  1Q39 A;  5EQT A;  7CAT A;  3LVV A;  4NRW A;  2NU4 I;  1WGN A;  2LH0 A;  1CT0 I;  4QHT A;  4LF6 M;  4LFC M;  3DOA A;  3E2I A;  2V1C C;  1D0M A;  5CCL A;  3R5A A;  1V34 A;  5E3P A;  3Q8X A;  4L4U A;  4FWH A;  3HHW A;  1JQJ C;  3I4V A;  3W67 A;  5ITX A;  3C58 A;  2RC4 A;  2DI0 A;  3LCV B;  1ZMV A;  2Z3X A;  4LJ8 A;  2C9O A;  1JR3 A;  4GHA A;  4KHP M;  4CJ6 A;  1IM2 A;  2C5R A;  2J87 A;  2F4V M;  1GL6 A;  2L6O A;  3SHG B;  3GLG B;  1XXH B;  1UUC A;  1K3W A;  5HQ8 A;  5EX0 A;  2I5R A;  1R7R A;  4G4O A;  2HL7 A;  1SGE I;  2YFQ A;  2X52 A;  1AUA A;  5KO3 A;  1GLN A;  3L27 A;  3TPZ A;  1QUT A;  2DWM A;  2YQZ A;  1MX0 A;  2N1A B;  4HGU A;  2E5R A;  4LRS A;  2XZF A;  4NXM M;  1OFI A;  1Z2I A;  3HY5 A;  5GUJ A;  3K1J A;  2BJV A;  3GPU A;  3JR5 A;  1J7K A;  3LW5 F;  3QYE A;  3VE5 A;  3B39 A;  3U6S A;  2UZ3 A;  3SGQ I;  4TUW A;  2CEA A;  3PNV A;  1N32 M;  2NQ8 C;  2ORW A;  4II7 A;  1NHW C;  4ITQ A;  3VK8 A;  2LWX A;  4LG2 A;  3J81 S;  2SGE I;  4AI6 A;  1UVG A;  4IBC A;  1TUR A;  3B7Z A;  2KA6 B;  1TTE A;  1QUS A;  4O6O A;  1CSO I;  4DV2 M;  5FTL A;  1NXU A;  3L25 A;  3AKZ A;  1LR7 A;  3PXG A;  1NV8 A;  4E1P A;  3U6P A;  3SEK C;  2VII A;  2VRW B;  3AL0 C;  1AIP C;  1D0L A;  2Z7J A;  3M7G A;  4QHS A;  1TBQ R;  2QQE A;  4AG6 A;  4AKH A;  2KMP A;  2C96 A;  1Y1C A;  2J7N A;  2APL A;  4UXH A;  3U60 B;  4OVZ A;  1SXJ A;  2EA0 A;  3MJ5 A;  3GLF E;  4RKU F;  1PRB A;  1WR1 B;  1YLA A;  1E9R A;  4MGK E;  4LJ4 A;  3R8F A;  4IJF A;  1ULM A;  4DV5 M;  1ZAE A;  2L7I A;  1DGF A;  4AG5 A;  2CWH A;  1SXJ C;  3FYC A;  2BUS A;  4MB7 A;  4FCV A;  1QQW A;  4M9X A;  2QPA A;  5DYG A;  4A3V B;  2DZO B;  4CIZ A;  5FSW A;  3PFI A;  2XEP A;  1GAB A;  3T1H M;  4XGI A;  1NNJ A;  4NOO B;  2CV2 A;  3L2A A;  4AKI A;  1VEJ A;  2OOA A;  4IBB A;  2PQ8 A;  2CV0 A;  4L8R C;  4X65 M;  2R65 A;  1V1I A;  1HPT A;  2R46 A;  3SAT A;  4MGI E;  5JI3 E;  4D82 A;  1E9S A;  1IBL M;  3KSJ A;  1IN7 A;  2WZJ A;  4XBO A;  3SAW A;  2ORV A;  2XSZ A;  3BJI A;  2R44 A;  2CHQ A;  2SGF I;  2J7O A;  3GP1 A;  2ODD A;  5EXX A;  3TWM A;  2HAK A;  1WGL A;  2EO2 A;  3SC3 A;  3U6Q A;  4HL4 A;  4M9S A;  2KEB A;  2H1R A;  1L2B A;  3B74 A;  4WUR A;  2Y0Q A;  3FUT A;  3T15 A;  1IQP A;  3UGJ A;  1TOT A;  3UOE A;  4FVM A;  4GC5 A;  2HKJ A;  3A46 A;  2L09 A;  3J80 S;  2UU9 M;  1XXH E;  1R4G A;  4BB9 A;  1ZV1 A;  1KMA A;  2ZBK A;  1SGP I;  5EX3 A;  1CE3 A;  3RU0 A;  4KT0 F;  4KOD A;  2C9C A;  4IIW A;  1QVR A;  1V92 A;  2UUC M;  3C3E A;  1X74 A;  2LHC A;  4LJ6 A;  1SG9 A;  5FTM A;  1H0Z A;  4E2K A;  3U6C A;  2GQF A;  3M6A A;  1TH4 A;  5FTK A;  1PM5 A;  2QBY A;  1SGR I;  3ZCB B;  1N34 M;  2XRC A;  2P5T A;  3ZC7 B;  4DUZ M;  1DV0 A;  1HJA I;  2KZU A;  4FWG A;  1UFZ A;  2K9D A;  4R71 A;  4DR2 M;  4MGH A;  2SGD I;  2FCJ A;  2NU1 I;  2ROW A;  3PVS A;  5CCM A;  2KMO A;  3UMM A;  1ORY B;  3GLI B;  3GRV A;  2ELI A;  3I51 A;  1PPF I;  1KBF A;  3OXL A;  2F5S A;  2W0T A;  4JI0 M;  2BWB A;  3GPY A;  3AJI B;  3HJQ A;  3KOZ E;  3HHX A;  4GKK M;  1SGN I;  3HZJ A;  2DAE A;  3OL0 A;  1X37 A;  3J2P B;  5KQ8 A;  3TOA A;  1XMO M;  1DO0 A;  3E9S A;  4DUY M;  2WSF F;  3HJS A;  3C3D A;  4B3S M;  4UXJ A;  5FLX S;  3CF2 A;  1OIP A;  2H5X A;  2J5Y A;  2LBC A;  1TBN A;  4I4L A;  4B7H A;  5FUV A;  1BUS A;  4LF7 M;  2A5Y B;  4PD2 A;  5EXP A;  3K9P A;  4NSR A;  2NU0 I;  2XLJ A;  4DR5 M;  1RFH A;  1JB0 F;  4B7G A;  1H6U A;  2WSC F;  3IG8 A;  1N75 A;  3BXW A;  2L2D A;  4X62 M;  2L4E A;  2JXN A;  5LMN M;  1HEV A;  5EP2 A;  4F2L A;  5H37 D;  3VLF B;  4F1I A;  4DBG B;  1K82 A;  1NV9 A;  4HLQ A;  4B3M M;  4FKD A;  1DGB A;  1DGH B;  2DZN B;  2G8L A;  5LMU M;  4DR6 M;  4GIP A;  1EIJ A;  3KOW E;  3M0E A;  4O6P B;  3H4J A;  4SGB I;  3GLF A;  3KXE C;  3CF6 E;  4Q7J A;  2Y0M A;  1DGG A;  5E26 A;  3VKG A;  1I94 M;  3GLH B;  4JCV E;  3FRI A;  1KSF X;  1Z5A A;  3TWK A;  1MJG M;  2DKV A;  4LCB A;  1Q3B A;  2ZAM A;  2CWF A;  1XB2 B;  1HNX M;  2LVO C;  1XC8 A;  1TGS I;  5IRE B;  2OQ4 A;  1NHG C;  2L7H A;  5EP3 A;  2RGO A;  2JZ1 A;  4LY6 A;  3J7A S;  3FSY A;  3NBX X;  3FRH A;  2G3Q A;  1WGT A;  3F92 A;  1E32 A;  1I4W A;  3SYK A;  1V33 A;  2V1C A;  2R62 A;  2SGP I;  1QAQ A;  1N36 M;  3VFD A;  3UJN A;  5KPZ A;  2JA1 A;  4S12 A;  1LR9 A;  3THG A;  1Z6T A;  3RGP A;  1PCE A;  2O01 F;  1R2Z A;  1OVO A;  1G59 A;  3GQ4 A;  3KVW A;  2G5G X;  2JA2 A;  2R45 A;  1TBO A;  2R0I A;  2JP7 A;  8CAT A;  1Q02 A;  4D80 A;  5F3W A;  4M0W A;  1N13 A;  2CP8 A;  2F5N A;  3V76 A;  3NWL A;  2DXI A;  4B08 A;  4NSO B;  2F5P A;  3I01 M;  4AQY M;  4EE1 A;  3U6D A;  1TR8 A;  3AOE A;  2Z8Y M;  4GRI A;  4IBI A;  4B3T M;  1K7T A;  2LVP C;  1CGI I;  3SMP A;  3A45 A;  4EDK A;  2I7P A;  2X8A A;  1IBK M;  2LVA A;  2LXE A;  3AOE C;  5EXT A;  3FUW A;  1T6T 1;  1CT4 I;  2YR0 A;  5GKN A; 
#chains in the Genus database with same CATH homology
 1QQW A;  4LFA M;  3SBJ A;  1XNR M;  1XXH A;  3K8Z A;  2QZ4 A;  1Y1B A;  4M9X A;  2QPA A;  5DYG A;  4A3V B;  2DZO B;  5FSW A;  4LF4 M;  1UVF A;  2WVJ A;  3K92 A;  2X49 A;  3PFI A;  4CHT B;  1J09 A;  3BOS A;  4QNR A;  2XEP A;  5ITU A;  1N33 M;  3DZD A;  4JN6 A;  4LF9 M;  2FOI C;  4LGM A;  3SMS A;  4Z6Y A;  3TL4 X;  1YE9 A;  3GQ5 A;  3T1H M;  1XNQ M;  4OW0 A;  4A24 A;  4XGI A;  3U6E A;  4LFB M;  1DDE A;  3U61 A;  1NNJ A;  3ZH9 B;  2Q2E B;  1D3Y A;  2Y0T A;  4NOO B;  2CHG A;  1IN5 A;  1VDD A;  2CV2 A;  1SGD I;  2XSZ D;  3JR4 A;  3UGI A;  1L1T A;  3L2A A;  3GLH A;  4AKI A;  1IY2 A;  3HU3 A;  2CHV A;  2XZU A;  2YNM D;  2KMR A;  4IBB A;  1MT1 A;  3QAU A;  1XX6 A;  4G6Z A;  1XMQ M;  3MEK A;  4L16 A;  4MGY E;  2CV0 A;  1MU5 A;  1R6B X;  1WXQ A;  4L8R C;  3KP1 E;  4X65 M;  2R65 A;  5ITR A;  1V1I A;  3TE6 A;  2CE7 A;  4DR4 M;  3D00 A;  2C99 A;  1HPT A;  2R46 A;  1AN1 I;  1HNZ M;  3SAT A;  2DVW B;  1DS2 I;  3U5Z B;  4LJ7 A;  4MGI E;  5JI3 E;  2Y21 A;  4DR7 M;  2V6Z M;  4LJ9 A;  4D82 A;  4BLC A;  1E9S A;  1W3S A;  1IBL M;  2UUA M;  3KSJ A;  3HHY A;  3GLI A;  2DWZ B;  1OJL A;  3U6O A;  3SAV A;  1R0R I;  1IN7 A;  1GKI A;  4L78 A;  3E4R A;  4G4R A;  2F5Q A;  4XBO A;  3IG5 A;  2DWL A;  1W5S A;  3SAW A;  2ORV A;  2XSZ A;  3E59 A;  3BJI A;  1PTQ A;  1TIH A;  3SAU A;  1Z7K B;  2N52 A;  5ITQ A;  1GL7 A;  3LQR A;  3RE8 A;  2CHQ A;  1NJG A;  3HWS A;  4PDI A;  4G4N A;  2B8T A;  1DD9 A;  5KPT A;  2SGF I;  3UEY A;  3FKE A;  2DB6 A;  4GMQ A;  4MGZ E;  1T3T A;  2J7O A;  2RKO A;  4I81 A;  3GP1 A;  3HJ8 A;  5DNY A;  3B4V C;  2F5O A;  1TUS A;  4DV3 M;  4DV1 M;  4IBK A;  1FNN A;  4ZPX A;  2I7N A;  5EXS A;  1KBE A;  3LQQ A;  2ODD A;  2WCY A;  5EXX A;  3OXF A;  3CXL A;  1SXJ E;  1W4R A;  2JZM A;  3B9P A;  3TWM A;  1LR8 A;  5FUX A;  2E5L M;  2QCU A;  5C1B A;  2EO2 A;  3SC3 A;  4X66 M;  2OVO A;  4IBD A;  4DR1 M;  2LNH C;  3U6Q A;  3MHV C;  2Z4S A;  1UM8 A;  3MK6 A;  5JI2 E;  1TDH A;  1QAM A;  2DWN A;  4HL4 A;  4M9S A;  2KEB A;  2H1R A;  1L2B A;  5IT9 S;  1U5K A;  4NL4 H;  2DIP A;  2K9H A;  4WUR A;  2Y0Q A;  2R4J A;  3FUT A;  3T15 A;  4OVZ B;  1SXJ B;  3QWP A;  4NXN M;  1IQP A;  3UGJ A;  4FW9 A;  2QQ0 A;  1HT2 E;  3WHL A;  3UK6 A;  1E94 E;  1CGJ I;  2XH9 A;  2FE8 A;  1TOT A;  3L29 A;  4FVM A;  4GC5 A;  3GPX A;  2JW6 A;  2HKJ A;  3A46 A;  4GI3 C;  2L09 A;  1G3I A;  3J80 S;  2UU9 M;  3KFU G;  1HQC A;  4BB9 A;  3VKH A;  3SYL A;  2ARP F;  1KMA A;  3CF0 A;  1N78 A;  1YSY A;  4JI6 M;  1SGP I;  2ZBK A;  5EX3 A;  1CE3 A;  1Z5B A;  2ENN A;  3RU0 A;  4P16 A;  3VDU A;  1Y8F A;  3LVW A;  4DV7 M;  1QAN A;  4KOD A;  2C9C A;  2V53 A;  4IIW A;  2SGQ I;  5BPV A;  2OPF A;  3TWL A;  3FD9 A;  2Y20 A;  1QVR A;  2NU3 I;  1N77 A;  3U60 A;  2UUC M;  2QPO A;  4DV0 M;  2UXB M;  1X74 A;  3DA1 A;  3GLG A;  3KOX E;  4LGY A;  4LJ6 A;  1HQY E;  4OX9 M;  1YUB A;  5FTJ A;  1QYR A;  5FTM A;  1H0Z A;  3L28 A;  5EJC A;  3U6C A;  2M5X A;  2ERW A;  4E2K A;  3I4Y A;  3GQ3 A;  2KMQ A;  3M6A A;  4LF8 M;  1TH4 A;  5FTK A;  2L7X A;  2X4A A;  3JAM S;  2L8E A;  1PM5 A;  1DGH A;  2UUB M;  2QBY A;  3KS8 A;  1SGR I;  1OMT A;  3T38 A;  4RF1 A;  3ZCB B;  1N34 M;  1NSF A;  1TH3 A;  3U61 B;  2R18 A;  4E1R A;  2KCX A;  1EQN A;  4IBE A;  2UXD M;  5GKN A;  1FJG M;  2XRC A;  2W82 A;  1PJI A;  2CUZ A;  3GRU A;  1DS3 I;  1OYV I;  2HCB A;  1XA6 A;  4L9M A;  4EDV A;  4LRT A;  3ZC7 B;  5DAE A;  2A20 A;  1PTR A;  2LEO A;  4DUZ M;  2FNA A;  4I5S A;  1HJA I;  3PDN A;  2KZU A;  3DFZ A;  4RNA A;  1SGQ I;  1XBT A;  1C1K A;  4FWG A;  2D7H A;  1W5T A;  4OVO A;  3KW6 A;  2KW0 A;  4GC9 A;  1HT1 E;  1HDL A;  2GKR I;  2KRU A;  3TJQ A;  4DR2 M;  4M0D A;  2JYY A;  4MGH A;  3T1Y M;  2SGD I;  3GOX A;  2NU1 I;  2ROW A;  2E73 A;  2D7G A;  2LUY A;  1S3S A;  4QNM A;  3PVS A;  3D8B A;  4JI8 M;  5CCM A;  2GKT I;  2KMO A;  4QOZ C;  3UMM A;  4IBJ A;  4CIS A;  4JXJ A;  2GKV A;  3SHF A;  1ORY B;  3GLI B;  3GRV A;  3U6L A;  2XFS A;  3RFW A;  1Z5C A;  4MM3 B;  4EIW A;  4JCV A;  2F3C I;  2ELI A;  3I51 A;  4IBG A;  4MH0 E;  3FUV A;  2ZM6 M;  1PPF I;  3OXL A;  1KBF A;  3J7B A;  2F5S A;  4I8O A;  2W0T A;  3GRY A;  4AW4 A;  4YY3 M;  4JI0 M;  5C18 A;  1J5E M;  3GPY A;  3HU1 A;  4GKJ M;  4EDR A;  4FCT A;  3AJI B;  3HJQ A;  3KOZ E;  3HHX A;  2KRK A;  4B6D A;  1IW4 A;  3FTF A;  4GKK M;  1QAO A;  1X4S A;  2V1U A;  4UXI A;  1SGN I;  1M8C A;  2FFJ A;  4G4Q A;  3UEJ A;  3U5Z A;  2C98 A;  3EIH A;  3OL0 A;  2XF3 A;  1X37 A;  3J2P B;  5KQ8 A;  4JI2 M;  2BNK A;  1Q39 A;  5EQT A;  1XMO M;  7CAT A;  1DO0 A;  3LVV A;  4Z8X A;  3D8L A;  2XFT A;  4NRW A;  4KO8 A;  3E9S A;  2NU4 I;  4DUY M;  2QQD A;  3NBI A;  1HNW M;  2OD1 A;  3UZU A;  1OFH A;  1JR3 D;  3HJS A;  4LZZ A;  2LH0 A;  4B3S M;  2J9R A;  4JI7 M;  4UXJ A;  1CT0 I;  5FLX S;  3CF2 A;  2O5R A;  3CTW B;  2GVI A;  3PNY A;  4QHT A;  4LF6 M;  4LFC M;  4DV4 M;  3DOA A;  3SGB I;  3E2I A;  1TBN A;  2V1C C;  4I4L A;  5CCL A;  3A42 A;  4M9Z A;  4B7H A;  5FTN A;  5FUV A;  3Q8X A;  1BUS A;  4L4U A;  5ITY A;  3KOY E;  4LF7 M;  4FWH A;  3KY9 A;  2A5Y B;  5FUY A;  1L8Q A;  1IY6 A;  3HHW A;  4GIT A;  3QWL A;  1JQJ C;  3J27 B;  3I4V A;  4JYA M;  4PT5 A;  2VQF M;  4PD2 A;  5EXP A;  1K3X A;  1ZQ9 A;  5ITX A;  3C58 A;  2ERC A;  3SAR A;  4NSR A;  5E6J A;  4IBF A;  2NU0 I;  2XLJ A;  2CFO A;  4DR5 M;  1RFH A;  3SFZ A;  4OU7 A;  2ZBK B;  2VQE M;  1FAR A;  3FTD A;  2NU2 I;  4B7G A;  2Z3X A;  2N71 A;  1H6U A;  2D7E A;  2EUC A;  4LJ8 A;  4D81 A;  2C9O A;  1JR3 A;  3FTC A;  4GHA A;  3IG8 A;  1N75 A;  4KHP M;  1IM2 A;  2C5R A;  1XHB A;  4B3R M;  4X62 M;  2J87 A;  4DV6 M;  5LMN M;  2F4V M;  1GL6 A;  2L6O A;  2ZAO A;  5EP2 A;  3UGL A;  3SHG B;  1NJF A;  5H37 D;  1G8P A;  3VLF B;  3GLG B;  4K0K M;  1XXH B;  1UUC A;  3AFH A;  1V1H A;  1K82 A;  3GPP A;  1K3W A;  5EX0 A;  5HQ8 A;  4HLQ A;  4B3M M;  1IN4 A;  1R7R A;  3HHZ A;  4G4O A;  1FAQ A;  2HL7 A;  4FKD A;  1SGE I;  2DHR A;  1L2D A;  1DGB A;  1DGH B;  2QBY B;  5ITT A;  2DZN B;  3KP0 E;  2G8L A;  2YFQ A;  2K47 A;  4IJE A;  5LMU M;  4DR6 M;  1EE8 A;  1YU6 C;  1NVM A;  5KO3 A;  1GLN A;  3L27 A;  4GIP A;  3H4M A;  3TPZ A;  3KOW E;  1L1Z A;  1CT2 I;  3M0E A;  3KSX A;  2DWM A;  3RGS A;  2HHH M;  3R9X B;  4O6P B;  4SGB I;  1NY6 A;  3GLF A;  3ILK A;  2YQZ A;  5IZ7 D;  3HKP A;  3KXE C;  4LJA A;  1FYB A;  3CF6 E;  5EP4 A;  1MX0 A;  3VK7 A;  3GO8 A;  3HGI A;  3U6M A;  3FTE A;  5BR8 M;  1YTP A;  2AU3 A;  1HR0 M;  2N1A B;  2KXE A;  4WW0 A;  1KFV A;  1DGG A;  4LZJ A;  4W5W A;  5E26 A;  1Z59 A;  3VKG A;  4HGU A;  1I94 M;  3GLH B;  2E5R A;  4LRS A;  2XZF A;  4NXM M;  1IY1 A;  4JCV E;  1OFI A;  1KSF X;  1Z5A A;  4JI4 M;  3TWK A;  4LJ5 A;  5KQD A;  4X64 M;  5EP1 A;  3L26 A;  1PJJ A;  3W0L B;  4JI3 M;  4PCZ A;  3KDS E;  4NRV A;  4REZ A;  4LCB A;  5GUJ A;  3K1J A;  1Q3B A;  3FC3 A;  2ZAM A;  5IWA M;  2XGN A;  1R2Y A;  4EDG A;  2CJS C;  1HNX M;  1XC8 A;  1TGS I;  4AKG A;  2BJV A;  3GPU A;  1NY5 A;  5IRE B;  1QZM A;  2OQ4 A;  2QP9 X;  3JR5 A;  3KS4 A;  1J7K A;  3VE5 A;  2Q2E A;  1G41 A;  1NHG C;  3B39 A;  1G4A E;  3FUU A;  3U6S A;  2L7H A;  2UZ3 A;  4TUW A;  3SGQ I;  3K2L A;  1IN8 A;  2CEA A;  5EP3 A;  2RGO A;  3EIE A;  2UXC M;  1TH2 A;  4LY6 A;  3PNV A;  1N32 M;  2NQ8 C;  1L2C A;  4II7 A;  2ORW A;  3J7A S;  1R79 A;  2RGH A;  1NHW C;  4ITQ A;  1DO2 A;  3VK8 A;  2LWX A;  2FNF X;  1IN6 A;  2M60 A;  4LG2 A;  4LF5 M;  3UFF A;  4B7F A;  1E32 A;  1LV7 A;  1I4W A;  4R3D A;  3SYK A;  3J81 S;  1IXZ A;  1XWI A;  4GH9 A;  2ENZ A;  4EDT A;  3VDP A;  2SGE I;  4PDG A;  5KPR A;  2KZS A;  2V1C A;  4JI5 M;  2R62 A;  3OTO M;  4AI6 A;  2SGP I;  1QAQ A;  1N36 M;  3VFD A;  1UVG A;  3UJN A;  5KPZ A;  2JA1 A;  4IBC A;  4YHH M;  1TUR A;  4QOS A;  2KA6 B;  4S12 A;  1TDZ A;  1LR9 A;  3THG A;  1M8B A;  1IXR C;  1Z6T A;  3RGP A;  4JV5 M;  3OXG A;  1PCE A;  2AHM A;  5ITX E;  1NUB A;  1TBR R;  3AV0 A;  1R2Z A;  1OVO A;  1KYI A;  4AZF A;  2B0U C;  4O6O A;  5A2Q S;  1D2N A;  3GQ4 A;  1G59 A;  3KVW A;  1SXJ D;  1CSO I;  5JHW C;  2G5G X;  3HU2 A;  4DV2 M;  4JI1 M;  1IXS B;  2M5Z A;  5FTL A;  2JA2 A;  3AOG A;  1BMO A;  2R45 A;  3L25 A;  3UGD A;  1TBO A;  3AKZ A;  1LR7 A;  8CAT A;  4FCW A;  3PXG A;  4KLN A;  1IBM M;  4E1P A;  3U6P A;  3SEK C;  2VII A;  2VRW B;  4D80 A;  5F3W A;  3AL0 C;  4M0W A;  1N13 A;  2CV1 A;  2F5N A;  1CHO I;  2Z7J A;  3M7G A;  4QHS A;  2P6A C;  3W0F A;  2QQC A;  4FD2 A;  5DYI A;  3NWL A;  4BBA A;  2DXI A;  1TBQ R;  2QQE A;  3HH2 C;  1IY5 A;  4AG6 A;  3FUX A;  3FYD A;  4NSO B;  4B08 A;  2F5P A;  4AKH A;  2KMP A;  2Z4R A;  2C96 A;  1SGY I;  2R4E A;  1Y1C A;  2J7N A;  4GHL A;  4AQY M;  2JXD A;  1Q3C A;  4EE1 A;  3U6D A;  1PJU A;  3U60 B;  3AOE A;  4UXH A;  4OVZ A;  1SXJ A;  3WHK A;  4GRI A;  2EA0 A;  3MJ5 A;  2ZAN A;  1NNU C;  1IY0 A;  4DR3 M;  4RF0 A;  3TQS A;  4IBI A;  4B3T M;  2YUU A;  1E9R A;  1GVN A;  4MGK E;  3SAS A;  3GRR A;  4LJ4 A;  3R8F A;  1CGI I;  2N17 A;  3SMP A;  3A45 A;  2QEN A;  3A98 B;  2YQP A;  5FUW A;  4EDK A;  4FWD A;  4IJF A;  2I7P A;  2X8A A;  4DV5 M;  1ZAE A;  2BJW A;  3GLF B;  2L7I A;  1DGF A;  4AG5 A;  1IBK M;  2LXE A;  3AOE C;  3OVO A;  4CGY B;  3LMM A;  5EXT A;  1SXJ C;  3FUW A;  3FYC A;  5HI7 A;  3QTL D;  4R7G A;  2BUS A;  1TGU A;  4MB7 A;  1T6T 1;  1CT4 I;  2YR0 A;  1OMU A;  4FCV A;  2P5T A;  4L15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...