3VDPA

Structure and biochemical studies of the recombination mediator protein recr in recfor pathway
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
197
structure length
197
Chain Sequence
YYSTSVAKLIEELSKLPGIGPKTAQRLAFFIINMPLDEVRSLSQAIIEAKEKLRYCKICFNITDKEVCDICSDENRDHSTICVVSHPMDVVAMEKVKEYKGVYHVLHGVISPIEGVGPEDIRIKELLERVRDGSVKEVILATNPDIEGEATAMYIAKLLKPFGVKVTRIAHGIPVGGDLEYTDVVTLSKALEGRREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombination protein recR
publication title RecOR complex including RecR N-N dimer and RecO monomer displays a high affinity for ssDNA
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Recombination
total genus 59
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
A PF02132 RecR RecR protein
A PF13662 Toprim_4 Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.420 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vdpA01
3.30.60.80 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3vdpA02
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 3vdpA03
1EQNA 4EE1A 3D00A 3B39A 4EDGA 1T6T1 2V1CA 4EDKA 2ZBKA 3VDUA 1D3YA 2Q2EA 3VE5A 4O6PB 1VDDA 4EDVA 4EDRA 2AU3A 4O6OA 4E2KA 1DDEA 1DD9A 4EDTA 4JCVA 5GUJA 3VDPA
chains in the Genus database with same CATH superfamily
4LJ8A 2G3QA 1Z5CA 1N77A 3SGBI 5EJCA 2GKVA 4PD2A 1LR7A 2RC4A 1EIJA 3HZJA 2UUAM 4R7GA 1TDZA 1GL6A 2C9OA 1OYVI 1ULMA 1PRBA 4P16A 3RGPA 1DDEA 2JA2A 2R65A 4DV7M 5JI2E 5FUXA 4IBFA 3EIEA 2N17A 8CATA 4EDGA 1J5EM 1Q3BA 2R45A 1JR3E 3HH2C 3R5DA 5KPTA 1CT4I 5IWAM 5DYGA 2RIJA 3W68A 3B39A 1PCEA 3PNVA 2OOAA 2BWBA 4IJEA 2LUYA 4LFCM 4D82A 1AUAA 2G5GX 1ZV1A 4LFBM 4I4LA 2OVOA 3TO6A 2QPAA 3HJQA 3DFZA 2XSZA 4I81A 3KOWE 1GO5A 3OXGA 1GL7A 3HU1A 4MGKE 4G6ZA 1QDRA 4QHTA 1E9RA 3KOYE 2ENNA 4MB7A 2VIIA 5KQ8A 2BJWA 4DV1M 1P3QQ 3UZUA 2CUZA 3M7GA 1IN4A 4JI3M 4CHTB 3B4VC 2P6AC 4L78A 2CE7A 1YE9A 1MX0A 4G4QA 1Z7KB 2R18A 4L8RC 3UK6A 2OU2A 2OZUA 2VQFM 1IY5A 2H1RA 3E2IA 2I5RA 5EP1A 1ZMWA 4FW9A 4KO8A 5LMUM 3GLIB 3J2PB 1SGDI 4BLCA 4BB9A 1K7UA 4G4OA 4E2KA 3V76A 2NU4I 5A2QS 4WP2A 2ZBKB 4Z8XA 2XGNA 2UXCM 1XXHA 2LXEA 2KMQA 3TO9A 3U6LA 1S3SA 1N34M 2B8TA 5GUJA 4LJ5A 1V1IA 2J7NA 4SGBI 4IBKA 5E3PA 2LVAA 2KZSA 3L29A 2LBCA 3GRVA 1SXJD 3FRHA 2QQCA 3GLIE 2XLJA 1EE8A 4L16A 4B7FA 4D81A 2Y0TA 5FTKA 3LQQA 4XK8F 5ITXA 3SAVA 4LF6M 4KHPM 1ZMVA 3GLHE 4IBEA 2DZOB 2NQ8C 2ZTDA 4OVZA 1LV7A 2FOIC 3QWPA 3JR4A 3EIHA 4QOZC 2YNMD 2D7EA 2E73A 1PGYA 3NBIA 3KOXE 1IQPA 3UFFA 2J5YA 3BXWA 4II7A 4MGIE 1DGHB 3CTWB 3LCVB 4NSRA 2ELIA 4HGUA 3J7BA 4FCVA 2DWNA 1IY1A 3AOEA 5FUYA 1CGJI 2GKRI 4MM3B 1SGQI 3K8ZA 2LWXA 2QCUA 2VRWB 2GKTI 1R79A 2QP9X 2KA6B 4OVOA 1WGCA 1HDLA 2F5NA 1ZQ9A 3HHZA 5EP2A 2CHVA 4IJFA 4ZPXA 5HI7A 3ZC7B 2UU9M 3UOEA 2DWLA 2KHHA 2EKKA 2XF3A 4LF8M 3RGSA 1BVSA 4DV6M 3R5CA 1TR8A 3E4RA 2JY5A 1SGPI 4PDGA 4B3SM 1YLAA 1SXJE 1P9GA 4O6OA 4DUZM 2FS1A 3C3DA 1HQCA 3GLGB 2NU0I 2LNHC 2CFOA 2R4JA 3SARA 4JV5M 3GP1A 3I01M 4LZZA 4PCZA 5KQDA 1L2BA 2Q2EA 3FD9A 4DNCA 4B08A 2DVWB 1CE3A 1IY2A 1MJBA 3RU0A 1L1ZA 3L25A 4LG2A 4EE1A 4LRSA 3RE8A 2DNAA 5FSWA 4K0KM 3U5ZA 1MU5A 4O6PB 5FTNA 4X64M 1XHBA 1VEGA 4MPIA 4FWDA 1OIZA 4LRTA 1XC8A 2KRUA 1QUTA 1FYBA 1DO2A 5FTJA 1NXUA 5EP3A 3U6CA 5FUVA 4GC5A 2SGQI 3GLGE 2CWBA 3ZQJA 3FTCA 2UXBM 1J09A 2CWFA 3OXLA 1VEJA 3SYKA 4YY3M 2WSCF 3R5BA 2JY7A 3GQ5A 2RRUA 2JZMA 1ORYB 4KT0F 3SAUA 4DR4M 5KO3A 3TO7A 1XA6A 2R46A 1OVOA 1HJPA 3TE6A 1R2YA 2XSZD 3E21A 4DV2M 4JXJA 3J27B 1PJIA 3DZDA 1Q02A 3VDPA 1K82A 1R4GA 2Z7JA 1KFVA 4EDKA 4JN6A 4JI0M 2R62A 3UGDA 2LEOA 4NRVA 2LH0A 1JR3D 3SMPA 1GLNA 2OOBA 3VKGA 1G4AE 3U61A 1IXZA 5IZ7D 1KYIA 5L8RF 5E3RA 5F3WA 2WCYA 4AZFA 2O5RA 1QANA 5EQTA 1WXQA 2Y0QA 1NHWC 4LF9M 4GKKM 1D0LA 4LGYA 2JP7A 3LVVA 3AKZA 3UMMA 1ULKA 1TTEA 1GABA 2W0TA 1TH2A 1XWIA 5EXPA 1HQYE 2MJ5B 3PNYA 3WHKA 4DR6M 1MT1A 1SGYI 1FJGM 2XH9A 4LJ9A 4QOSA 4LF7M 1PJSA 4B3TM 3BJIA 4UXHA 2MGWA 3IG5A 1NO1A 2VDBB 4M9XA 2BWEA 5DYIA 4OX9M 4OU7A 3GPXA 3SBJA 4CGYB 2L7HA 4CIZA 3FE3A 4EDTA 3AOEC 4X62M 1QDTA 3Q8XA 1DGBA 4RNAA 3H4JA 3VE5A 5ITQA 1CHOI 3E46A 1VG5A 3KDSE 5J8CA 2DAGA 1UVFA 3UGLA 2E5RA 3FUVA 3I4VA 3ZCBB 2KRKA 2Z4SA 2WGCA 1T3TA 3GPUA 1XXHB 2RGOA 4DR7M 1X37A 5KPZA 2JY8A 3T6PA 4D80A 2YUUA 2C9CA 2VF7A 4GRIA 3NWLA 1VDDA 1TGUA 3I4YA 1AN1I 4WURA 2SGDI 2O01F 1YU6C 4IBCA 4IBIA 4UXJA 4M9ZA 1IXSA 1XB2B 2DAEA 1NJGA 1NY5A 4JYAM 1HJAI 2LTUA 2KMOA 4LGMA 2QBYA 4Y28F 3K9OA 4M0DA 1MJ9A 4OVZB 3TJQA 3RFWA 1G41A 2RKOA 4CJ6A 4XBOA 4G3OA 3J81S 1G8PA 3U6EA 1D3YA 2ZAOA 1LTMA 4WW0A 3OVOA 2CRUA 3KS4A 3U6DA 3E9SA 3J7AS 2R6FA 2M5ZA 4RF1A 2DAKA 3I51A 2F5QA 3HGIA 4E1RA 3IECA 4IIWA 3E59A 1HNWM 1HEVA 4HEOA 2X4AA 5ITYA 1W4RA 4P17A 1QYRA 4JI2M 1I4WA 3VFDA 3C3EA 3D8LA 1TOTA 2Z3XA 5GKNA 3BOSA 2Z8YM 2X52A 1DGGA 1TUSA 1QAOA 1XNQM 2JXNA 3L2AA 1NVMA 1L2CA 1UVGA 5CCLA 2CEAA 2OD1A 2SGFI 3TWLA 4LZJA 3BBZA 1ULNA 1IM2A 4LCBA 3QYEA 4IBDA 1Y1BA 1NUBA 3UGIA 1OJLA 3LCUA 2EA0A 1RFHA 4ANRA 3M6AA 1XMQM 1W3SA 3HKPA 3LMMA 3GOXA 3CXLA 1MJAA 3HU3A 1PJTA 3SMSA 2CWHA 2Q2EB 4JI1M 2E5LM 2HCBA 1X74A 3MMPA 2FCJA 4W5WA 3QWLA 2JY6B 3H4MA 2X3TA 3FTDA 2R0IA 2EKFA 1Z59A 3Q8GA 3U5ZB 3QYBA 2ERWA 2ARPF 2ODDA 7WGAA 1OKSA 3FYCA 1NNUC 1CUKA 1EFUB 3NBXX 2L4FA 2GNOA 2XEPA 1OMTA 3SGQI 4G4RA 2L7IA 4L15A 3FSYA 1IN6A 2BUSA 1TURA 4F2LA 1R0RI 2HKJA 4QNMA 2DZNB 2LVQD 2X49A 5CCMA 3TOAA 4NC6A 3LW5F 3PFIA 3C58A 1NJFA 2JNHA 2CHGA 2ZAMA 1C7YA 4GI3C 1JQJC 5J8FA 3GQ3A 1IBKM 4A24A 2ZTCA 3THGA 1IBLM 2DI0A 2XFTA 2HHHM 1SG9A 4PT5A 1XX6A 1V92A 2ZANA 2FE8A 1OAOC 1Y1CA 1E9SA 1ZAEA 1N78A 1WGLA 3D8BA 1D2NA 3GLHA 4NXMM 1M8CA 4AKIA 1PJUA 2ORVA 1E94E 1YUBA 1PTRA 3FC3A 3CF0A 1BUSA 4XGIA 3U61B 3CF6E 3HX3A 2UXDM 2F3CI 2RGHA 1T6T1 1HPTA 5FTLA 1E32A 1TDHA 3SC3A 1G59A 2I7NA 3GPPA 3GPYA 5EXXA 2EO2A 3FTEA 1Y8FA 3R8FA 4FCWA 1OAIA 3C9PA 3DOAA 2UVOA 2N35A 4I5SA 4BBAA 4B6DA 1FAQA 2MH8A 1TF0B 2YR0A 2V1UA 1L8QA 2G8LA 4FVMA 2L09A 4FCTA 2M60A 3VLFB 2N71A 1Z5BA 4L9MA 3L28A 3HHXA 1FARA 1HT2E 2P5TA 4JI4M 1S20A 4NSOB 1JB0F 2M5XA 3TWKA 2QNJA 3SAWA 1DD9A 1CT0I 1OMUA 4Q7JA 1CGII 2L2DA 1SXJA 1HNXM 2B3TA 1IW4A 5FTMA 3GO8A 4DR5M 1UFZA 2OQ4A 4EDRA 5C1BA 4JCVE 2F5OA 3TPZA 3HHYA 3T15A 2LVPC 2AHMA 4LJAA 3K92A 2KNAA 1MJGM 2KNVA 2A20A 1SGRI 4AG5A 3I04M 3PDNA 4DV0M 2JZ0A 2PQ8A 3HHWA 3IG8A 4FWHA 4EIWA 2HWJA 1H6UA 2CJSC 2FFJA 2KCXA 1NSFA 2Z4RA 5BPVA 1TH3A 3FSXA 1QAQA 3HY5A 3GQ4A 3M0EA 1AIPC 1WIVA 4B3RM 1D0MA 4MH0E 3GLFA 3MHVC 5EXSA 4GHLA 4IBJA 5ITUA 1KMAA 4AKGA 3SHFA 3GRUA 3FKEA 1TIHA 4WP4A 2FNFX 2C5RA 1IXSB 3KS8A 1DS3I 4A3VB 1FY7A 5JHWC 2HL7A 1GJSA 1R6BX 2QBYB 3FUTA 7CATA 4G4NA 2KEBA 4GIPA 1TGSI 1PM5A 3FRIA 4AQYM 1SGEI 4JI5M 3OL0A 1TBOA 2APLA 3A98B 3AV0A 4UN2B 1K3XA 4DR1M 3AOGA 2LHCA 3SATA 4Z6YA 2KZUA 2QQ0A 1DV0A 2WSFF 1J7KA 3J80S 3U6PA 2DXIA 4AKHA 3D00A 2F5PA 2CP8A 1V1HA 3HJSA 2K9HA 3SFZA 2QQEA 1QUSA 1NV8A 2C98A 4RF0A 3MJ5A 1Q3CA 1RU3A 4FD2A 4NL4H 3KY9A 4EDVA 2WZJA 2O25A 3K1JA 2HAKA 2Y21A 1TBQR 1FNNA 1F4IA 2NU2I 2C96A 1Z2IA 4RKUF 5ITRA 2BJVA 4DV5M 4GEWA 4B3MM 3A42A 4GITA 3UJNA 4B7HA 4M9SA 2LB7A 3FUXA 4IBBA 3MEKA 2L6OA 3K9PA 4QHSA 2SGPI 2JWSA 1Y8GA 3JAMS 2R4EA 2DKLA 3LQRA 1CSOI 1DS2I 1OFHA 4TUWA 2BNKA 1LR9A 1Q39A 3KP0E 2K0BX 3UEYA 1PPFI 3KP1E 1GVNA 5DNYA 3JR5A 3R9XB 2YQPA 3B74A 3IHPA 3L26A 1PJQA 5EX3A 1IN5A 1XXHE 4NRWA 2XRCA 2VQEM 2CV1A 3R5AA 4REZA 4NXNM 2K47A 5EXTA 4GHAA 1BMOA 1NNJA 3UGJA 4JI7M 4JI6M 3KW6A 1JR3A 3W0LB 3U60A 2L7XA 5IT9S 3VKHA 3TWMA 1OTRA 2QHOB 1TBNA 2C99A 1P9ZA 2V1CA 1SXJC 3TQSA 3QAHA 3OTOM 3FYDA 2DENA 4LF4M 2J9RA 1UUCA 5E26A 2N52A 3UEJA 2MROB 3U6MA 5ITXE 5LMNM 3L27A 1C1KA 5DAEA 4UXIA 1N33M 2L4EA 1NV9A 1QZMA 2AU3A 2JZ1A 4F1IA 2K6BA 4MGYE 1K7VA 1XMOM 3QTLD 1DO0A 2ENZA 4AG6A 1Z6TA 4X65M 3HU2A 3U6SA 5KPRA 2XFSA 3GLHB 3W0FA 3KXEC 4B7GA 2KMPA 2YQZA 2QSFX 1QVRA 1XNRM 2ORWA 1T6OA 2YFQA 4FWGA 4LY6A 5C18A 4AMLA 1TH4A 1X4SA 2D7HA 3SASA 1A5TA 2JA1A 5BR8M 1UHAA 1YSYA 2K9DA 5DFLA 9WGAA 3FUUA 1HR0M 3SYLA 3PVSA 2J87A 2KXEA 2UUCM 2V53A 3B7QA 1YTPA 2V6ZM 3LVWA 4DUYM 1EQNA 2A5YB 4PDIA 4DR2M 3PXGA 4AI6A 1WJ7A 1NHGC 1QAMA 3B9PA 3AL0C 4LJ7A 2QQDA 3B7NA 2W82A 5E6JA 2Y0MA 2QZ4A 1IN7A 4HL4A 1D0KA 1PTQA 3SHGB 2LHGA 4LF5M 1OIPA 3GRYA 2GVIA 2DWMA 2KW0A 1N13A 3DA1A 4MGHA 4DR3M 3ILKA 2LVOC 3B89A 1U5KA 4OW0A 5ITTA 3VK8A 4X66M 2D7GA 2WSEF 2H5XA 1SXJB 3SEKC 4GC9A 3T38A 1UM8A 2FNAA 3FUWA 2EJSA 2WVJA 1V34A 3VDUA 3GLIA 4R71A 5EP4A 2XZFA 4L4UA 1DGFA 1G3IA 4DV3M 4GMQA 2R44A 3KFUG 2CV0A 2KDLA 1N32M 4LJ6A 1VDLA 1OFIA 3KOZE 4S12A 3OXFA 4LFAM 2CHQA 2CV2A 2N1AB 2ZBKA 3HWSA 3AFHA 3CF2A 5HQ8A 3A46A 2DIPA 1TBRR 1N75A 1CT2I 1I94M 1KBFA 1ZMUA 1N36M 4QNRA 2QQ8A 5JI3E 1HT1E 2KNZA 3ZH9B 4MGZE 3GLFB 5IREB 1R7RA 3T1YM 3TL4X 2KMRA 1R2ZA 1VEKA 2NU1I 2DKVA 1WR1B 3VK7A 3MK6A 2DAIA 4HLQA 1MN3A 3W67A 2JUJA 2ZM6M 1OQYA 1IFYA 1WTJA 4GH9A 5FLXS 4LJ4A 4I8OA 2QPOA 3KVWA 2X8AA 2Y20A 1K7TA 2ROWA 3F92A 4ITQA 4JI8M 2F4VM 1XBTA 2L8EA 2V1CC 3GLFE 1G71A 4DV4M 1Z5AA 2UUBM 3B7ZA 2LVNC 1DGHA 2B0UC 4M0WA 1KBEA 2F5SA 1R5LA 5EX0A 1GJTA 1IBMM 2GIVA 1IY6A 2QENA 4GKJM 3QAUA 2DZLA 2JW6A 2OPFA 4L6V6 1IN8A 1VQ1A 1W5TA 1W5SA 3U6QA 1WHCA 1V33A 1NY6A 2CWGA 1K3WA 1L2DA 4KLNA 3CGWA 1KSFX 2XZUA 2OO9A 3KSJA 3KSXA 2DAMA 2J7OA 2JYYA 1LR8A 3GRRA 2DHYA 3TOBA 4KODA 2NU3I 4E1PA 2VF8A 3K2LA 1L1TA 2DB6A 1IXRC 3GLGA 5E3QA 1HNZM 3A45A 2JXDA 1IY0A 3T1HM 1QQWA 3U6OA 1Q9BA 4CISA 4DBGB 1T43A 1WGNA 2ERCA 2FH0A 1WKXA 4YHHM 4AW4A 1GKIA 3AJIB 3WHLA 2GQFA 1H0ZA 4JCVA 1M8BA 1QZEA 4FKDA 2EUCA 2DWZB 2DHRA 4IBGA 2UZ3A 2MR9A 5H37D 3U60B 1SGNI 1PJJA 3HJ8A 3FTFA 5FUWA 4NOOB 1WGTA 2I7PA 2SGEI 4R3DA
chains in the Genus database with same CATH topology
4LJ8A 5FTJA 1IN6A 5EP3A 3U6CA 2BUSA 1TBNA 1TURA 2C99A 5FUVA 1Z5CA 4GC5A 1N77A 3SGBI 5EJCA 2V1CA 1R0RI 2GKVA 1SXJC 2SGQI 3TQSA 2HKJA 4QNMA 2DZNB 3FTCA 2UXBM 4PD2A 1J09A 3OTOM 1LR7A 3FYDA 4LF4M 2J9RA 3OXLA 2X49A 1UUCA 5E26A 3SYKA 2UUAM 5CCMA 4YY3M 4R7GA 3PFIA 3C58A 1TDZA 2N52A 3UEJA 1NJFA 1GL6A 3U6MA 2CHGA 2ZAMA 2C9OA 5ITXE 5LMNM 4GI3C 3GQ5A 1JQJC 1C1KA 3L27A 2JZMA 5DAEA 3GQ3A 1IBKM 4A24A 4UXIA 1OYVI 1ORYB 1N33M 3SAUA 4DR4M 5KO3A 4P16A 1XA6A 2R46A 1QZMA 3THGA 1OVOA 1IBLM 3TE6A 2XFTA 1R2YA 2AU3A 2XSZD 2HHHM 3RGPA 1DDEA 4PT5A 4MGYE 2JA2A 2R65A 4DV7M 1XMOM 5JI2E 3QTLD 4DV2M 4JXJA 5FUXA 3J27B 1PJIA 1DO0A 2ENZA 3DZDA 4AG6A 1XX6A 2ZANA 1Z6TA 4IBFA 3VDPA 2FE8A 1Y1CA 1E9SA 1ZAEA 3EIEA 4X65M 1N78A 3HU2A 1K82A 2N17A 3U6SA 8CATA 5KPRA 4EDGA 2XFSA 3D8BA 3GLHB 1J5EM 1Q3BA 1D2NA 2Z7JA 3GLHA 1KFVA 2R45A 4JN6A 3W0FA 3HH2C 4JI0M 3KXEC 4B7GA 4NXMM 1M8CA 4EDKA 2KMPA 2R62A 2YQZA 4AKIA 5KPTA 1PJUA 1CT4I 3UGDA 5IWAM 2ORVA 5DYGA 1E94E 1QVRA 4NRVA 2LH0A 1XNRM 2LEOA 2ORWA 1YUBA 1JR3D 3SMPA 1GLNA 1PTRA 3FC3A 2YFQA 3CF0A 4FWGA 4LY6A 1BUSA 5C18A 1TH4A 3VKGA 4XGIA 3U61B 1X4SA 2D7HA 1G4AE 3U61A 3SASA 2JA1A 1IXZA 5BR8M 3CF6E 5IZ7D 1YSYA 1KYIA 5F3WA 2WCYA 4AZFA 1PCEA 2UXDM 3B39A 3PNVA 2F3CI 2O5RA 2RGHA 1T6T1 1QANA 4IJEA 2LUYA 4LFCM 5EQTA 1HPTA 1WXQA 4D82A 5FTLA 2G5GX 2Y0QA 3FUUA 1NHWC 1HR0M 4LF9M 1E32A 4GKKM 4LGYA 3SYLA 4LFBM 1TDHA 3SC3A 1G59A 2I7NA 3PVSA 4I4LA 3LVVA 3AKZA 2J87A 2QPAA 3HJQA 3GPPA 2OVOA 2KXEA 3GPYA 3UMMA 2UUCM 5EXXA 2V53A 2EO2A 1YTPA 3DFZA 2XSZA 4I81A 3KOWE 2V6ZM 3LVWA 3FTEA 2W0TA 4DUYM 1Y8FA 3OXGA 3R8FA 4FCWA 1EQNA 3DOAA 2A5YB 1GL7A 4PDIA 4DR2M 4I5SA 3HU1A 1TH2A 1XWIA 5EXPA 3PXGA 4BBAA 1HQYE 4MGKE 4AI6A 1NHGC 4G6ZA 4B6DA 1QAMA 3PNYA 1FAQA 3WHKA 4DR6M 3B9PA 2YR0A 1MT1A 4QHTA 1SGYI 1E9RA 3KOYE 2V1UA 2ENNA 3AL0C 1L8QA 4LJ7A 2QQDA 2G8LA 2W82A 5E6JA 4FVMA 1FJGM 4MB7A 2L09A 4FCTA 2XH9A 4LJ9A 2VIIA 5KQ8A 2QZ4A 4QOSA 4LF7M 2M60A 2BJWA 1IN7A 3VLFB 4HL4A 2N71A 4DV1M 4B3TM 3BJIA 1Z5BA 1PTQA 3UZUA 4L9MA 3SHGB 2CUZA 3M7GA 3L28A 1IN4A 4LF5M 2GVIA 3GRYA 4UXHA 4JI3M 3HHXA 4CHTB 2DWMA 1FARA 3B4VC 2KW0A 1HT2E 2P5TA 2P6AC 3IG5A 4JI4M 1N13A 3DA1A 4L78A 2CE7A 4MGHA 4DR3M 1YE9A 1MX0A 4G4QA 4NSOB 1Z7KB 2R18A 4L8RC 3UK6A 2M5XA 4M9XA 3ILKA 2VQFM 3TWKA 5DYIA 4OX9M 4OU7A 1IY5A 1U5KA 4OW0A 5ITTA 3VK8A 3SAWA 4X66M 1DD9A 1CT0I 3GPXA 1OMUA 3SBJA 4CGYB 2L7HA 2D7GA 1CGII 4EDTA 1SXJB 1SXJA 3SEKC 2H1RA 4GC9A 3T38A 3E2IA 1UM8A 2FNAA 3AOEC 5EP1A 1HNXM 4X62M 4FW9A 3Q8XA 3FUWA 1IW4A 5FTMA 2WVJA 4KO8A 3GO8A 4DR5M 5LMUM 1DGBA 4RNAA 3VDUA 3GLIB 3J2PB 1SGDI 4BLCA 3GLIA 3VE5A 4BB9A 5ITQA 5EP4A 2OQ4A 2XZFA 4EDRA 5C1BA 4JCVE 4G4OA 1CHOI 2F5OA 3TPZA 4L4UA 1DGFA 1G3IA 3HHYA 4E2KA 4DV3M 2NU4I 3T15A 3KDSE 4GMQA 3KFUG 2AHMA 4LJAA 2CV0A 3K92A 5A2QS 1N32M 2A20A 4LJ6A 1SGRI 4AG5A 1OFIA 3KOZE 4S12A 1UVFA 3OXFA 3UGLA 4LFAM 3PDNA 2CHQA 2ZBKB 4DV0M 2CV2A 2E5RA 2N1AB 3HWSA 2ZBKA 3FUVA 3I4VA 3HHWA 4Z8XA 3ZCBB 2KRKA 3IG8A 4FWHA 4EIWA 2Z4SA 3AFHA 1H6UA 3CF2A 2CJSC 1T3TA 2XGNA 1XXHB 2FFJA 3GPUA 2UXCM 2KCXA 1XXHA 1NSFA 2RGOA 2LXEA 2Z4RA 5BPVA 4DR7M 2KMQA 3U6LA 1X37A 1S3SA 5HQ8A 3A46A 4R3DA 1TH3A 5KPZA 1N34M 1QAQA 2DIPA 1TBRR 1N75A 2B8TA 1CT2I 1I94M 5GUJA 3GQ4A 1KBFA 3M0EA 1N36M 4QNRA 4D80A 4LJ5A 5JI3E 2YUUA 1V1IA 1HT1E 2C9CA 2J7NA 4B3RM 3ZH9B 4MGZE 4SGBI 4IBKA 4GRIA 3GLFB 4MH0E 3GLFA 3MHVC 5IREB 5EXSA 1FYBA 3NWLA 1R7RA 1VDDA 3T1YM 4GHLA 1TGUA 3I4YA 2KZSA 4IBJA 3L29A 5ITUA 4WURA 4AKGA 1AN1I 2SGDI 3GRVA 3TL4X 3SHFA 2KMRA 3GRUA 1R2ZA 1SXJD 3FKEA 2NU1I 1YU6C 1TIHA 4IBCA 2FNFX 2QQCA 3VK7A 4IBIA 4UXJA 2C5RA 1IXSB 3MK6A 1EE8A 4L16A 4M9ZA 2XLJA 4HLQA 4B7FA 3KS8A 1DS3I 4D81A 2Y0TA 5FTKA 3LQQA 5IT9S 1NJGA 1NY5A 4JYAM 1HJAI 4A3VB 5ITXA 2ZM6M 5JHWC 2HL7A 2KMOA 3SAVA 1R6BX 4LGMA 2QBYB 2QBYA 3FUTA 7CATA 4G4NA 2KEBA 4GIPA 4LF6M 4M0DA 1TGSI 4GH9A 4KHPM 1PM5A 4IBEA 4AQYM 1SGEI 2DZOB 2NQ8C 5FLXS 4JI5M 4OVZB 4LJ4A 3OL0A 4OVZA 4I8OA 1TBOA 3RFWA 3TJQA 1LV7A 2QPOA 3KVWA 1G41A 2X8AA 2RKOA 3A98B 2FOIC 3QWPA 4XBOA 3JR4A 2Y20A 3J81S 1G8PA 3AV0A 2ROWA 3U6EA 3EIHA 1K3XA 1D3YA 4ITQA 4JI8M 4QOZC 2YNMD 2ZAOA 4DR1M 2F4VM 1XBTA 4WW0A 3OVOA 2L8EA 3AOGA 3SATA 2D7EA 4Z6YA 2V1CC 2E73A 3KS4A 3NBIA 3U6DA 3E9SA 2KZUA 3KOXE 2QQ0A 1IQPA 4DV4M 3J7AS 1J7KA 2M5ZA 4RF1A 3J80S 3UFFA 1Z5AA 3I51A 3U6PA 2F5QA 2DXIA 4II7A 4AKHA 2F5PA 3HGIA 3D00A 2UUBM 4MGIE 1DGHB 3CTWB 1DGHA 4E1RA 4IIWA 4NSRA 3E59A 1HNWM 2B0UC 4M0WA 1KBEA 2ELIA 1V1HA 4HGUA 3J7BA 2F5SA 3HJSA 2K9HA 2X4AA 5ITYA 1W4RA 4FCVA 1QYRA 2DWNA 4JI2M 5EX0A 3SFZA 1IY1A 3AOEA 1IBMM 1I4WA 3VFDA 5FUYA 1CGJI 2QQEA 2GKRI 1IY6A 4MM3B 1SGQI 3K8ZA 3D8LA 2QENA 3QAUA 2LWXA 2QCUA 2C98A 3MJ5A 4RF0A 1Q3CA 2Z3XA 4GKJM 1TOTA 2GKTI 1R79A 2QP9X 5GKNA 2VRWB 3BOSA 2KA6B 4OVOA 1DGGA 2JW6A 1HDLA 2OPFA 1TUSA 4FD2A 2F5NA 4NL4H 1IN8A 1ZQ9A 3KY9A 1QAOA 3HHZA 1W5TA 1W5SA 3U6QA 1XNQM 5EP2A 3L2AA 4EDVA 1NY6A 2CHVA 4IJFA 1NVMA 4ZPXA 3ZC7B 5HI7A 1L2CA 2UU9M 1K3WA 1L2DA 1UVGA 4KLNA 5CCLA 3K1JA 1KSFX 2XZUA 2DWLA 3KSJA 2CEAA 2OD1A 3KSXA 2Y21A 1TBQR 2SGFI 3TWLA 1FNNA 4LZJA 2XF3A 4LF8M 3RGSA 2NU2I 2C96A 4DV6M 1IM2A 2J7OA 4LCBA 2JYYA 5ITRA 4IBDA 1LR8A 3E4RA 2BJVA 4DV5M 1Y1BA 1SGPI 1NUBA 3GRRA 4B3MM 3A42A 3UGIA 4PDGA 1OJLA 4GITA 4B3SM 3TWMA 3UJNA 2EA0A 4B7HA 1RFHA 4M9SA 4KODA 1SXJE 2NU3I 3M6AA 1XMQM 3FUXA 4E1PA 4O6OA 4DUZM 1W3SA 4IBBA 3K2LA 3HKPA 1L1TA 2L6OA 4QHSA 3MEKA 1HQCA 2DB6A 3GLGB 2SGPI 3JAMS 1IXRC 2R4EA 3GLGA 2NU0I 2LNHC 2CFOA 1HNZM 3A45A 2JXDA 3LMMA 1IY0A 2R4JA 3GOXA 3CXLA 3LQRA 3SARA 1CSOI 1DS2I 3T1HM 1OFHA 4JV5M 1KMAA 4TUWA 3HU3A 2BNKA 3GP1A 1QQWA 3SMSA 1LR9A 4LZZA 1Q39A 3U6OA 4PCZA 5KQDA 3KP0E 3UEYA 1PPFI 2Q2EB 4CISA 1L2BA 3KP1E 3FD9A 2Q2EA 4JI1M 2E5LM 4B08A 2ERCA 2HCBA 2DVWB 1GVNA 5DNYA 4YHHM 1X74A 1CE3A 4W5WA 1IY2A 4AW4A 3JR5A 3R9XB 3QWLA 1GKIA 2YQPA 3AJIB 3H4MA 3RU0A 1L1ZA 3WHLA 3L26A 3L25A 4JCVA 1H0ZA 1M8BA 3FTDA 4LG2A 4EE1A 4FKDA 5EX3A 1IN5A 4LRSA 1Z59A 3RE8A 2EUCA 4NRWA 2DWZB 2XRCA 2DHRA 5FSWA 3U5ZB 4K0KM 2VQEM 3U5ZA 1MU5A 2CV1A 2ERWA 4REZA 4NXNM 2ARPF 2K47A 5EXTA 5FTNA 4GHAA 1BMOA 1NNJA 4O6PB 2ODDA 4X64M 3UGJA 3FYCA 4JI7M 1XHBA 1NNUC 4IBGA 2UZ3A 4JI6M 5H37D 3U60B 3KW6A 1JR3A 3W0LB 3U60A 1SGNI 1PJJA 2XEPA 1OMTA 3HJ8A 3FTFA 5FUWA 4FWDA 3SGQI 4LRTA 4NOOB 4G4RA 1XC8A 2I7PA 2L7XA 2KRUA 2L7IA 2SGEI 4L15A 3VKHA 1DO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQN A;  4EE1 A;  3D00 A;  3B39 A;  4EDG A;  1T6T 1;  2V1C A;  4EDK A;  2ZBK A;  3VDU A;  1D3Y A;  2Q2E A;  3VE5 A;  4O6P B;  1VDD A;  4EDV A;  4EDR A;  2AU3 A;  4O6O A;  4E2K A;  1DDE A;  1DD9 A;  4EDT A;  4JCV A;  5GUJ A;  3VDP A; 
#chains in the Genus database with same CATH topology
 4LJ8 A;  2G3Q A;  1Z5C A;  1N77 A;  3SGB I;  5EJC A;  2GKV A;  4PD2 A;  1LR7 A;  2RC4 A;  1EIJ A;  3HZJ A;  2UUA M;  4R7G A;  1TDZ A;  1GL6 A;  2C9O A;  1OYV I;  1ULM A;  1PRB A;  4P16 A;  3RGP A;  1DDE A;  2JA2 A;  2R65 A;  4DV7 M;  5JI2 E;  5FUX A;  4IBF A;  3EIE A;  2N17 A;  8CAT A;  4EDG A;  1J5E M;  1Q3B A;  2R45 A;  1JR3 E;  3HH2 C;  3R5D A;  5KPT A;  1CT4 I;  5IWA M;  5DYG A;  2RIJ A;  3W68 A;  3B39 A;  1PCE A;  3PNV A;  2OOA A;  2BWB A;  4IJE A;  2LUY A;  4LFC M;  4D82 A;  1AUA A;  2G5G X;  1ZV1 A;  4LFB M;  4I4L A;  2OVO A;  3TO6 A;  2QPA A;  3HJQ A;  3DFZ A;  2XSZ A;  4I81 A;  3KOW E;  1GO5 A;  3OXG A;  1GL7 A;  3HU1 A;  4MGK E;  4G6Z A;  1QDR A;  4QHT A;  1E9R A;  3KOY E;  2ENN A;  4MB7 A;  2VII A;  5KQ8 A;  2BJW A;  4DV1 M;  1P3Q Q;  3UZU A;  2CUZ A;  3M7G A;  1IN4 A;  4JI3 M;  4CHT B;  3B4V C;  2P6A C;  4L78 A;  2CE7 A;  1YE9 A;  1MX0 A;  4G4Q A;  1Z7K B;  2R18 A;  4L8R C;  3UK6 A;  2OU2 A;  2OZU A;  2VQF M;  1IY5 A;  2H1R A;  3E2I A;  2I5R A;  5EP1 A;  1ZMW A;  4FW9 A;  4KO8 A;  5LMU M;  3GLI B;  3J2P B;  1SGD I;  4BLC A;  4BB9 A;  1K7U A;  4G4O A;  4E2K A;  3V76 A;  2NU4 I;  5A2Q S;  4WP2 A;  2ZBK B;  4Z8X A;  2XGN A;  2UXC M;  1XXH A;  2LXE A;  2KMQ A;  3TO9 A;  3U6L A;  1S3S A;  1N34 M;  2B8T A;  5GUJ A;  4LJ5 A;  1V1I A;  2J7N A;  4SGB I;  4IBK A;  5E3P A;  2LVA A;  2KZS A;  3L29 A;  2LBC A;  3GRV A;  1SXJ D;  3FRH A;  2QQC A;  3GLI E;  2XLJ A;  1EE8 A;  4L16 A;  4B7F A;  4D81 A;  2Y0T A;  5FTK A;  3LQQ A;  4XK8 F;  5ITX A;  3SAV A;  4LF6 M;  4KHP M;  1ZMV A;  3GLH E;  4IBE A;  2DZO B;  2NQ8 C;  2ZTD A;  4OVZ A;  1LV7 A;  2FOI C;  3QWP A;  3JR4 A;  3EIH A;  4QOZ C;  2YNM D;  2D7E A;  2E73 A;  1PGY A;  3NBI A;  3KOX E;  1IQP A;  3UFF A;  2J5Y A;  3BXW A;  4II7 A;  4MGI E;  1DGH B;  3CTW B;  3LCV B;  4NSR A;  2ELI A;  4HGU A;  3J7B A;  4FCV A;  2DWN A;  1IY1 A;  3AOE A;  5FUY A;  1CGJ I;  2GKR I;  4MM3 B;  1SGQ I;  3K8Z A;  2LWX A;  2QCU A;  2VRW B;  2GKT I;  1R79 A;  2QP9 X;  2KA6 B;  4OVO A;  1WGC A;  1HDL A;  2F5N A;  1ZQ9 A;  3HHZ A;  5EP2 A;  2CHV A;  4IJF A;  4ZPX A;  5HI7 A;  3ZC7 B;  2UU9 M;  3UOE A;  2DWL A;  2KHH A;  2EKK A;  2XF3 A;  4LF8 M;  3RGS A;  1BVS A;  4DV6 M;  3R5C A;  1TR8 A;  3E4R A;  2JY5 A;  1SGP I;  4PDG A;  4B3S M;  1YLA A;  1SXJ E;  1P9G A;  4O6O A;  4DUZ M;  2FS1 A;  3C3D A;  1HQC A;  3GLG B;  2NU0 I;  2LNH C;  2CFO A;  2R4J A;  3SAR A;  4JV5 M;  3GP1 A;  3I01 M;  4LZZ A;  4PCZ A;  5KQD A;  1L2B A;  2Q2E A;  3FD9 A;  4DNC A;  4B08 A;  2DVW B;  1CE3 A;  1IY2 A;  1MJB A;  3RU0 A;  1L1Z A;  3L25 A;  4LG2 A;  4EE1 A;  4LRS A;  3RE8 A;  2DNA A;  5FSW A;  4K0K M;  3U5Z A;  1MU5 A;  4O6P B;  5FTN A;  4X64 M;  1XHB A;  1VEG A;  4MPI A;  4FWD A;  1OIZ A;  4LRT A;  1XC8 A;  2KRU A;  1QUT A;  1FYB A;  1DO2 A;  5FTJ A;  1NXU A;  5EP3 A;  3U6C A;  5FUV A;  4GC5 A;  2SGQ I;  3GLG E;  2CWB A;  3ZQJ A;  3FTC A;  2UXB M;  1J09 A;  2CWF A;  3OXL A;  1VEJ A;  3SYK A;  4YY3 M;  2WSC F;  3R5B A;  2JY7 A;  3GQ5 A;  2RRU A;  2JZM A;  1ORY B;  4KT0 F;  3SAU A;  4DR4 M;  5KO3 A;  3TO7 A;  1XA6 A;  2R46 A;  1OVO A;  1HJP A;  3TE6 A;  1R2Y A;  2XSZ D;  3E21 A;  4DV2 M;  4JXJ A;  3J27 B;  1PJI A;  3DZD A;  1Q02 A;  3VDP A;  1K82 A;  1R4G A;  2Z7J A;  1KFV A;  4EDK A;  4JN6 A;  4JI0 M;  2R62 A;  3UGD A;  2LEO A;  4NRV A;  2LH0 A;  1JR3 D;  3SMP A;  1GLN A;  2OOB A;  3VKG A;  1G4A E;  3U61 A;  1IXZ A;  5IZ7 D;  1KYI A;  5L8R F;  5E3R A;  5F3W A;  2WCY A;  4AZF A;  2O5R A;  1QAN A;  5EQT A;  1WXQ A;  2Y0Q A;  1NHW C;  4LF9 M;  4GKK M;  1D0L A;  4LGY A;  2JP7 A;  3LVV A;  3AKZ A;  3UMM A;  1ULK A;  1TTE A;  1GAB A;  2W0T A;  1TH2 A;  1XWI A;  5EXP A;  1HQY E;  2MJ5 B;  3PNY A;  3WHK A;  4DR6 M;  1MT1 A;  1SGY I;  1FJG M;  2XH9 A;  4LJ9 A;  4QOS A;  4LF7 M;  1PJS A;  4B3T M;  3BJI A;  4UXH A;  2MGW A;  3IG5 A;  1NO1 A;  2VDB B;  4M9X A;  2BWE A;  5DYI A;  4OX9 M;  4OU7 A;  3GPX A;  3SBJ A;  4CGY B;  2L7H A;  4CIZ A;  3FE3 A;  4EDT A;  3AOE C;  4X62 M;  1QDT A;  3Q8X A;  1DGB A;  4RNA A;  3H4J A;  3VE5 A;  5ITQ A;  1CHO I;  3E46 A;  1VG5 A;  3KDS E;  5J8C A;  2DAG A;  1UVF A;  3UGL A;  2E5R A;  3FUV A;  3I4V A;  3ZCB B;  2KRK A;  2Z4S A;  2WGC A;  1T3T A;  3GPU A;  1XXH B;  2RGO A;  4DR7 M;  1X37 A;  5KPZ A;  2JY8 A;  3T6P A;  4D80 A;  2YUU A;  2C9C A;  2VF7 A;  4GRI A;  3NWL A;  1VDD A;  1TGU A;  3I4Y A;  1AN1 I;  4WUR A;  2SGD I;  2O01 F;  1YU6 C;  4IBC A;  4IBI A;  4UXJ A;  4M9Z A;  1IXS A;  1XB2 B;  2DAE A;  1NJG A;  1NY5 A;  4JYA M;  1HJA I;  2LTU A;  2KMO A;  4LGM A;  2QBY A;  4Y28 F;  3K9O A;  4M0D A;  1MJ9 A;  4OVZ B;  3TJQ A;  3RFW A;  1G41 A;  2RKO A;  4CJ6 A;  4XBO A;  4G3O A;  3J81 S;  1G8P A;  3U6E A;  1D3Y A;  2ZAO A;  1LTM A;  4WW0 A;  3OVO A;  2CRU A;  3KS4 A;  3U6D A;  3E9S A;  3J7A S;  2R6F A;  2M5Z A;  4RF1 A;  2DAK A;  3I51 A;  2F5Q A;  3HGI A;  4E1R A;  3IEC A;  4IIW A;  3E59 A;  1HNW M;  1HEV A;  4HEO A;  2X4A A;  5ITY A;  1W4R A;  4P17 A;  1QYR A;  4JI2 M;  1I4W A;  3VFD A;  3C3E A;  3D8L A;  1TOT A;  2Z3X A;  5GKN A;  3BOS A;  2Z8Y M;  2X52 A;  1DGG A;  1TUS A;  1QAO A;  1XNQ M;  2JXN A;  3L2A A;  1NVM A;  1L2C A;  1UVG A;  5CCL A;  2CEA A;  2OD1 A;  2SGF I;  3TWL A;  4LZJ A;  3BBZ A;  1ULN A;  1IM2 A;  4LCB A;  3QYE A;  4IBD A;  1Y1B A;  1NUB A;  3UGI A;  1OJL A;  3LCU A;  2EA0 A;  1RFH A;  4ANR A;  3M6A A;  1XMQ M;  1W3S A;  3HKP A;  3LMM A;  3GOX A;  3CXL A;  1MJA A;  3HU3 A;  1PJT A;  3SMS A;  2CWH A;  2Q2E B;  4JI1 M;  2E5L M;  2HCB A;  1X74 A;  3MMP A;  2FCJ A;  4W5W A;  3QWL A;  2JY6 B;  3H4M A;  2X3T A;  3FTD A;  2R0I A;  2EKF A;  1Z59 A;  3Q8G A;  3U5Z B;  3QYB A;  2ERW A;  2ARP F;  2ODD A;  7WGA A;  1OKS A;  3FYC A;  1NNU C;  1CUK A;  1EFU B;  3NBX X;  2L4F A;  2GNO A;  2XEP A;  1OMT A;  3SGQ I;  4G4R A;  2L7I A;  4L15 A;  3FSY A;  1IN6 A;  2BUS A;  1TUR A;  4F2L A;  1R0R I;  2HKJ A;  4QNM A;  2DZN B;  2LVQ D;  2X49 A;  5CCM A;  3TOA A;  4NC6 A;  3LW5 F;  3PFI A;  3C58 A;  1NJF A;  2JNH A;  2CHG A;  2ZAM A;  1C7Y A;  4GI3 C;  1JQJ C;  5J8F A;  3GQ3 A;  1IBK M;  4A24 A;  2ZTC A;  3THG A;  1IBL M;  2DI0 A;  2XFT A;  2HHH M;  1SG9 A;  4PT5 A;  1XX6 A;  1V92 A;  2ZAN A;  2FE8 A;  1OAO C;  1Y1C A;  1E9S A;  1ZAE A;  1N78 A;  1WGL A;  3D8B A;  1D2N A;  3GLH A;  4NXM M;  1M8C A;  4AKI A;  1PJU A;  2ORV A;  1E94 E;  1YUB A;  1PTR A;  3FC3 A;  3CF0 A;  1BUS A;  4XGI A;  3U61 B;  3CF6 E;  3HX3 A;  2UXD M;  2F3C I;  2RGH A;  1T6T 1;  1HPT A;  5FTL A;  1E32 A;  1TDH A;  3SC3 A;  1G59 A;  2I7N A;  3GPP A;  3GPY A;  5EXX A;  2EO2 A;  3FTE A;  1Y8F A;  3R8F A;  4FCW A;  1OAI A;  3C9P A;  3DOA A;  2UVO A;  2N35 A;  4I5S A;  4BBA A;  4B6D A;  1FAQ A;  2MH8 A;  1TF0 B;  2YR0 A;  2V1U A;  1L8Q A;  2G8L A;  4FVM A;  2L09 A;  4FCT A;  2M60 A;  3VLF B;  2N71 A;  1Z5B A;  4L9M A;  3L28 A;  3HHX A;  1FAR A;  1HT2 E;  2P5T A;  4JI4 M;  1S20 A;  4NSO B;  1JB0 F;  2M5X A;  3TWK A;  2QNJ A;  3SAW A;  1DD9 A;  1CT0 I;  1OMU A;  4Q7J A;  1CGI I;  2L2D A;  1SXJ A;  1HNX M;  2B3T A;  1IW4 A;  5FTM A;  3GO8 A;  4DR5 M;  1UFZ A;  2OQ4 A;  4EDR A;  5C1B A;  4JCV E;  2F5O A;  3TPZ A;  3HHY A;  3T15 A;  2LVP C;  2AHM A;  4LJA A;  3K92 A;  2KNA A;  1MJG M;  2KNV A;  2A20 A;  1SGR I;  4AG5 A;  3I04 M;  3PDN A;  4DV0 M;  2JZ0 A;  2PQ8 A;  3HHW A;  3IG8 A;  4FWH A;  4EIW A;  2HWJ A;  1H6U A;  2CJS C;  2FFJ A;  2KCX A;  1NSF A;  2Z4R A;  5BPV A;  1TH3 A;  3FSX A;  1QAQ A;  3HY5 A;  3GQ4 A;  3M0E A;  1AIP C;  1WIV A;  4B3R M;  1D0M A;  4MH0 E;  3GLF A;  3MHV C;  5EXS A;  4GHL A;  4IBJ A;  5ITU A;  1KMA A;  4AKG A;  3SHF A;  3GRU A;  3FKE A;  1TIH A;  4WP4 A;  2FNF X;  2C5R A;  1IXS B;  3KS8 A;  1DS3 I;  4A3V B;  1FY7 A;  5JHW C;  2HL7 A;  1GJS A;  1R6B X;  2QBY B;  3FUT A;  7CAT A;  4G4N A;  2KEB A;  4GIP A;  1TGS I;  1PM5 A;  3FRI A;  4AQY M;  1SGE I;  4JI5 M;  3OL0 A;  1TBO A;  2APL A;  3A98 B;  3AV0 A;  4UN2 B;  1K3X A;  4DR1 M;  3AOG A;  2LHC A;  3SAT A;  4Z6Y A;  2KZU A;  2QQ0 A;  1DV0 A;  2WSF F;  1J7K A;  3J80 S;  3U6P A;  2DXI A;  4AKH A;  3D00 A;  2F5P A;  2CP8 A;  1V1H A;  3HJS A;  2K9H A;  3SFZ A;  2QQE A;  1QUS A;  1NV8 A;  2C98 A;  4RF0 A;  3MJ5 A;  1Q3C A;  1RU3 A;  4FD2 A;  4NL4 H;  3KY9 A;  4EDV A;  2WZJ A;  2O25 A;  3K1J A;  2HAK A;  2Y21 A;  1TBQ R;  1FNN A;  1F4I A;  2NU2 I;  2C96 A;  1Z2I A;  4RKU F;  5ITR A;  2BJV A;  4DV5 M;  4GEW A;  4B3M M;  3A42 A;  4GIT A;  3UJN A;  4B7H A;  4M9S A;  2LB7 A;  3FUX A;  4IBB A;  3MEK A;  2L6O A;  3K9P A;  4QHS A;  2SGP I;  2JWS A;  1Y8G A;  3JAM S;  2R4E A;  2DKL A;  3LQR A;  1CSO I;  1DS2 I;  1OFH A;  4TUW A;  2BNK A;  1LR9 A;  1Q39 A;  3KP0 E;  2K0B X;  3UEY A;  1PPF I;  3KP1 E;  1GVN A;  5DNY A;  3JR5 A;  3R9X B;  2YQP A;  3B74 A;  3IHP A;  3L26 A;  1PJQ A;  5EX3 A;  1IN5 A;  1XXH E;  4NRW A;  2XRC A;  2VQE M;  2CV1 A;  3R5A A;  4REZ A;  4NXN M;  2K47 A;  5EXT A;  4GHA A;  1BMO A;  1NNJ A;  3UGJ A;  4JI7 M;  4JI6 M;  3KW6 A;  1JR3 A;  3W0L B;  3U60 A;  2L7X A;  5IT9 S;  3VKH A;  3TWM A;  1OTR A;  2QHO B;  1TBN A;  2C99 A;  1P9Z A;  2V1C A;  1SXJ C;  3TQS A;  3QAH A;  3OTO M;  3FYD A;  2DEN A;  4LF4 M;  2J9R A;  1UUC A;  5E26 A;  2N52 A;  3UEJ A;  2MRO B;  3U6M A;  5ITX E;  5LMN M;  3L27 A;  1C1K A;  5DAE A;  4UXI A;  1N33 M;  2L4E A;  1NV9 A;  1QZM A;  2AU3 A;  2JZ1 A;  4F1I A;  2K6B A;  4MGY E;  1K7V A;  1XMO M;  3QTL D;  1DO0 A;  2ENZ A;  4AG6 A;  1Z6T A;  4X65 M;  3HU2 A;  3U6S A;  5KPR A;  2XFS A;  3GLH B;  3W0F A;  3KXE C;  4B7G A;  2KMP A;  2YQZ A;  2QSF X;  1QVR A;  1XNR M;  2ORW A;  1T6O A;  2YFQ A;  4FWG A;  4LY6 A;  5C18 A;  4AML A;  1TH4 A;  1X4S A;  2D7H A;  3SAS A;  1A5T A;  2JA1 A;  5BR8 M;  1UHA A;  1YSY A;  2K9D A;  5DFL A;  9WGA A;  3FUU A;  1HR0 M;  3SYL A;  3PVS A;  2J87 A;  2KXE A;  2UUC M;  2V53 A;  3B7Q A;  1YTP A;  2V6Z M;  3LVW A;  4DUY M;  1EQN A;  2A5Y B;  4PDI A;  4DR2 M;  3PXG A;  4AI6 A;  1WJ7 A;  1NHG C;  1QAM A;  3B9P A;  3AL0 C;  4LJ7 A;  2QQD A;  3B7N A;  2W82 A;  5E6J A;  2Y0M A;  2QZ4 A;  1IN7 A;  4HL4 A;  1D0K A;  1PTQ A;  3SHG B;  2LHG A;  4LF5 M;  1OIP A;  3GRY A;  2GVI A;  2DWM A;  2KW0 A;  1N13 A;  3DA1 A;  4MGH A;  4DR3 M;  3ILK A;  2LVO C;  3B89 A;  1U5K A;  4OW0 A;  5ITT A;  3VK8 A;  4X66 M;  2D7G A;  2WSE F;  2H5X A;  1SXJ B;  3SEK C;  4GC9 A;  3T38 A;  1UM8 A;  2FNA A;  3FUW A;  2EJS A;  2WVJ A;  1V34 A;  3VDU A;  3GLI A;  4R71 A;  5EP4 A;  2XZF A;  4L4U A;  1DGF A;  1G3I A;  4DV3 M;  4GMQ A;  2R44 A;  3KFU G;  2CV0 A;  2KDL A;  1N32 M;  4LJ6 A;  1VDL A;  1OFI A;  3KOZ E;  4S12 A;  3OXF A;  4LFA M;  2CHQ A;  2CV2 A;  2N1A B;  2ZBK A;  3HWS A;  3AFH A;  3CF2 A;  5HQ8 A;  3A46 A;  2DIP A;  1TBR R;  1N75 A;  1CT2 I;  1I94 M;  1KBF A;  1ZMU A;  1N36 M;  4QNR A;  2QQ8 A;  5JI3 E;  1HT1 E;  2KNZ A;  3ZH9 B;  4MGZ E;  3GLF B;  5IRE B;  1R7R A;  3T1Y M;  3TL4 X;  2KMR A;  1R2Z A;  1VEK A;  2NU1 I;  2DKV A;  1WR1 B;  3VK7 A;  3MK6 A;  2DAI A;  4HLQ A;  1MN3 A;  3W67 A;  2JUJ A;  2ZM6 M;  1OQY A;  1IFY A;  1WTJ A;  4GH9 A;  5FLX S;  4LJ4 A;  4I8O A;  2QPO A;  3KVW A;  2X8A A;  2Y20 A;  1K7T A;  2ROW A;  3F92 A;  4ITQ A;  4JI8 M;  2F4V M;  1XBT A;  2L8E A;  2V1C C;  3GLF E;  1G71 A;  4DV4 M;  1Z5A A;  2UUB M;  3B7Z A;  2LVN C;  1DGH A;  2B0U C;  4M0W A;  1KBE A;  2F5S A;  1R5L A;  5EX0 A;  1GJT A;  1IBM M;  2GIV A;  1IY6 A;  2QEN A;  4GKJ M;  3QAU A;  2DZL A;  2JW6 A;  2OPF A;  4L6V 6;  1IN8 A;  1VQ1 A;  1W5T A;  1W5S A;  3U6Q A;  1WHC A;  1V33 A;  1NY6 A;  2CWG A;  1K3W A;  1L2D A;  4KLN A;  3CGW A;  1KSF X;  2XZU A;  2OO9 A;  3KSJ A;  3KSX A;  2DAM A;  2J7O A;  2JYY A;  1LR8 A;  3GRR A;  2DHY A;  3TOB A;  4KOD A;  2NU3 I;  4E1P A;  2VF8 A;  3K2L A;  1L1T A;  2DB6 A;  1IXR C;  3GLG A;  5E3Q A;  1HNZ M;  3A45 A;  2JXD A;  1IY0 A;  3T1H M;  1QQW A;  3U6O A;  1Q9B A;  4CIS A;  4DBG B;  1T43 A;  1WGN A;  2ERC A;  2FH0 A;  1WKX A;  4YHH M;  4AW4 A;  1GKI A;  3AJI B;  3WHL A;  2GQF A;  1H0Z A;  4JCV A;  1M8B A;  1QZE A;  4FKD A;  2EUC A;  2DWZ B;  2DHR A;  4IBG A;  2UZ3 A;  2MR9 A;  5H37 D;  3U60 B;  1SGN I;  1PJJ A;  3HJ8 A;  3FTF A;  5FUW A;  4NOO B;  1WGT A;  2I7P A;  2SGE I;  4R3D A; 
#chains in the Genus database with same CATH homology
 4LJ8 A;  5FTJ A;  1IN6 A;  5EP3 A;  3U6C A;  2BUS A;  1TBN A;  1TUR A;  2C99 A;  5FUV A;  1Z5C A;  4GC5 A;  1N77 A;  3SGB I;  5EJC A;  2V1C A;  1R0R I;  2GKV A;  1SXJ C;  2SGQ I;  3TQS A;  2HKJ A;  4QNM A;  2DZN B;  3FTC A;  2UXB M;  4PD2 A;  1J09 A;  3OTO M;  1LR7 A;  3FYD A;  4LF4 M;  2J9R A;  3OXL A;  2X49 A;  1UUC A;  5E26 A;  3SYK A;  2UUA M;  5CCM A;  4YY3 M;  4R7G A;  3PFI A;  3C58 A;  1TDZ A;  2N52 A;  3UEJ A;  1NJF A;  1GL6 A;  3U6M A;  2CHG A;  2ZAM A;  2C9O A;  5ITX E;  5LMN M;  4GI3 C;  3GQ5 A;  1JQJ C;  1C1K A;  3L27 A;  2JZM A;  5DAE A;  3GQ3 A;  1IBK M;  4A24 A;  4UXI A;  1OYV I;  1ORY B;  1N33 M;  3SAU A;  4DR4 M;  5KO3 A;  4P16 A;  1XA6 A;  2R46 A;  1QZM A;  3THG A;  1OVO A;  1IBL M;  3TE6 A;  2XFT A;  1R2Y A;  2AU3 A;  2XSZ D;  2HHH M;  3RGP A;  1DDE A;  4PT5 A;  4MGY E;  2JA2 A;  2R65 A;  4DV7 M;  1XMO M;  5JI2 E;  3QTL D;  4DV2 M;  4JXJ A;  5FUX A;  3J27 B;  1PJI A;  1DO0 A;  2ENZ A;  3DZD A;  4AG6 A;  1XX6 A;  2ZAN A;  1Z6T A;  4IBF A;  3VDP A;  2FE8 A;  1Y1C A;  1E9S A;  1ZAE A;  3EIE A;  4X65 M;  1N78 A;  3HU2 A;  1K82 A;  2N17 A;  3U6S A;  8CAT A;  5KPR A;  4EDG A;  2XFS A;  3D8B A;  3GLH B;  1J5E M;  1Q3B A;  1D2N A;  2Z7J A;  3GLH A;  1KFV A;  2R45 A;  4JN6 A;  3W0F A;  3HH2 C;  4JI0 M;  3KXE C;  4B7G A;  4NXM M;  1M8C A;  4EDK A;  2KMP A;  2R62 A;  2YQZ A;  4AKI A;  5KPT A;  1PJU A;  1CT4 I;  3UGD A;  5IWA M;  2ORV A;  5DYG A;  1E94 E;  1QVR A;  4NRV A;  2LH0 A;  1XNR M;  2LEO A;  2ORW A;  1YUB A;  1JR3 D;  3SMP A;  1GLN A;  1PTR A;  3FC3 A;  2YFQ A;  3CF0 A;  4FWG A;  4LY6 A;  1BUS A;  5C18 A;  1TH4 A;  3VKG A;  4XGI A;  3U61 B;  1X4S A;  2D7H A;  1G4A E;  3U61 A;  3SAS A;  2JA1 A;  1IXZ A;  5BR8 M;  3CF6 E;  5IZ7 D;  1YSY A;  1KYI A;  5F3W A;  2WCY A;  4AZF A;  1PCE A;  2UXD M;  3B39 A;  3PNV A;  2F3C I;  2O5R A;  2RGH A;  1T6T 1;  1QAN A;  4IJE A;  2LUY A;  4LFC M;  5EQT A;  1HPT A;  1WXQ A;  4D82 A;  5FTL A;  2G5G X;  2Y0Q A;  3FUU A;  1NHW C;  1HR0 M;  4LF9 M;  1E32 A;  4GKK M;  4LGY A;  3SYL A;  4LFB M;  1TDH A;  3SC3 A;  1G59 A;  2I7N A;  3PVS A;  4I4L A;  3LVV A;  3AKZ A;  2J87 A;  2QPA A;  3HJQ A;  3GPP A;  2OVO A;  2KXE A;  3GPY A;  3UMM A;  2UUC M;  5EXX A;  2V53 A;  2EO2 A;  1YTP A;  3DFZ A;  2XSZ A;  4I81 A;  3KOW E;  2V6Z M;  3LVW A;  3FTE A;  2W0T A;  4DUY M;  1Y8F A;  3OXG A;  3R8F A;  4FCW A;  1EQN A;  3DOA A;  2A5Y B;  1GL7 A;  4PDI A;  4DR2 M;  4I5S A;  3HU1 A;  1TH2 A;  1XWI A;  5EXP A;  3PXG A;  4BBA A;  1HQY E;  4MGK E;  4AI6 A;  1NHG C;  4G6Z A;  4B6D A;  1QAM A;  3PNY A;  1FAQ A;  3WHK A;  4DR6 M;  3B9P A;  2YR0 A;  1MT1 A;  4QHT A;  1SGY I;  1E9R A;  3KOY E;  2V1U A;  2ENN A;  3AL0 C;  1L8Q A;  4LJ7 A;  2QQD A;  2G8L A;  2W82 A;  5E6J A;  4FVM A;  1FJG M;  4MB7 A;  2L09 A;  4FCT A;  2XH9 A;  4LJ9 A;  2VII A;  5KQ8 A;  2QZ4 A;  4QOS A;  4LF7 M;  2M60 A;  2BJW A;  1IN7 A;  3VLF B;  4HL4 A;  2N71 A;  4DV1 M;  4B3T M;  3BJI A;  1Z5B A;  1PTQ A;  3UZU A;  4L9M A;  3SHG B;  2CUZ A;  3M7G A;  3L28 A;  1IN4 A;  4LF5 M;  2GVI A;  3GRY A;  4UXH A;  4JI3 M;  3HHX A;  4CHT B;  2DWM A;  1FAR A;  3B4V C;  2KW0 A;  1HT2 E;  2P5T A;  2P6A C;  3IG5 A;  4JI4 M;  1N13 A;  3DA1 A;  4L78 A;  2CE7 A;  4MGH A;  4DR3 M;  1YE9 A;  1MX0 A;  4G4Q A;  4NSO B;  1Z7K B;  2R18 A;  4L8R C;  3UK6 A;  2M5X A;  4M9X A;  3ILK A;  2VQF M;  3TWK A;  5DYI A;  4OX9 M;  4OU7 A;  1IY5 A;  1U5K A;  4OW0 A;  5ITT A;  3VK8 A;  3SAW A;  4X66 M;  1DD9 A;  1CT0 I;  3GPX A;  1OMU A;  3SBJ A;  4CGY B;  2L7H A;  2D7G A;  1CGI I;  4EDT A;  1SXJ B;  1SXJ A;  3SEK C;  2H1R A;  4GC9 A;  3T38 A;  3E2I A;  1UM8 A;  2FNA A;  3AOE C;  5EP1 A;  1HNX M;  4X62 M;  4FW9 A;  3Q8X A;  3FUW A;  1IW4 A;  5FTM A;  2WVJ A;  4KO8 A;  3GO8 A;  4DR5 M;  5LMU M;  1DGB A;  4RNA A;  3VDU A;  3GLI B;  3J2P B;  1SGD I;  4BLC A;  3GLI A;  3VE5 A;  4BB9 A;  5ITQ A;  5EP4 A;  2OQ4 A;  2XZF A;  4EDR A;  5C1B A;  4JCV E;  4G4O A;  1CHO I;  2F5O A;  3TPZ A;  4L4U A;  1DGF A;  1G3I A;  3HHY A;  4E2K A;  4DV3 M;  2NU4 I;  3T15 A;  3KDS E;  4GMQ A;  3KFU G;  2AHM A;  4LJA A;  2CV0 A;  3K92 A;  5A2Q S;  1N32 M;  2A20 A;  4LJ6 A;  1SGR I;  4AG5 A;  1OFI A;  3KOZ E;  4S12 A;  1UVF A;  3OXF A;  3UGL A;  4LFA M;  3PDN A;  2CHQ A;  2ZBK B;  4DV0 M;  2CV2 A;  2E5R A;  2N1A B;  3HWS A;  2ZBK A;  3FUV A;  3I4V A;  3HHW A;  4Z8X A;  3ZCB B;  2KRK A;  3IG8 A;  4FWH A;  4EIW A;  2Z4S A;  3AFH A;  1H6U A;  3CF2 A;  2CJS C;  1T3T A;  2XGN A;  1XXH B;  2FFJ A;  3GPU A;  2UXC M;  2KCX A;  1XXH A;  1NSF A;  2RGO A;  2LXE A;  2Z4R A;  5BPV A;  4DR7 M;  2KMQ A;  3U6L A;  1X37 A;  1S3S A;  5HQ8 A;  3A46 A;  4R3D A;  1TH3 A;  5KPZ A;  1N34 M;  1QAQ A;  2DIP A;  1TBR R;  1N75 A;  2B8T A;  1CT2 I;  1I94 M;  5GUJ A;  3GQ4 A;  1KBF A;  3M0E A;  1N36 M;  4QNR A;  4D80 A;  4LJ5 A;  5JI3 E;  2YUU A;  1V1I A;  1HT1 E;  2C9C A;  2J7N A;  4B3R M;  3ZH9 B;  4MGZ E;  4SGB I;  4IBK A;  4GRI A;  3GLF B;  4MH0 E;  3GLF A;  3MHV C;  5IRE B;  5EXS A;  1FYB A;  3NWL A;  1R7R A;  1VDD A;  3T1Y M;  4GHL A;  1TGU A;  3I4Y A;  2KZS A;  4IBJ A;  3L29 A;  5ITU A;  4WUR A;  4AKG A;  1AN1 I;  2SGD I;  3GRV A;  3TL4 X;  3SHF A;  2KMR A;  3GRU A;  1R2Z A;  1SXJ D;  3FKE A;  2NU1 I;  1YU6 C;  1TIH A;  4IBC A;  2FNF X;  2QQC A;  3VK7 A;  4IBI A;  4UXJ A;  2C5R A;  1IXS B;  3MK6 A;  1EE8 A;  4L16 A;  4M9Z A;  2XLJ A;  4HLQ A;  4B7F A;  3KS8 A;  1DS3 I;  4D81 A;  2Y0T A;  5FTK A;  3LQQ A;  5IT9 S;  1NJG A;  1NY5 A;  4JYA M;  1HJA I;  4A3V B;  5ITX A;  2ZM6 M;  5JHW C;  2HL7 A;  2KMO A;  3SAV A;  1R6B X;  4LGM A;  2QBY B;  2QBY A;  3FUT A;  7CAT A;  4G4N A;  2KEB A;  4GIP A;  4LF6 M;  4M0D A;  1TGS I;  4GH9 A;  4KHP M;  1PM5 A;  4IBE A;  4AQY M;  1SGE I;  2DZO B;  2NQ8 C;  5FLX S;  4JI5 M;  4OVZ B;  4LJ4 A;  3OL0 A;  4OVZ A;  4I8O A;  1TBO A;  3RFW A;  3TJQ A;  1LV7 A;  2QPO A;  3KVW A;  1G41 A;  2X8A A;  2RKO A;  3A98 B;  2FOI C;  3QWP A;  4XBO A;  3JR4 A;  2Y20 A;  3J81 S;  1G8P A;  3AV0 A;  2ROW A;  3U6E A;  3EIH A;  1K3X A;  1D3Y A;  4ITQ A;  4JI8 M;  4QOZ C;  2YNM D;  2ZAO A;  4DR1 M;  2F4V M;  1XBT A;  4WW0 A;  3OVO A;  2L8E A;  3AOG A;  3SAT A;  2D7E A;  4Z6Y A;  2V1C C;  2E73 A;  3KS4 A;  3NBI A;  3U6D A;  3E9S A;  2KZU A;  3KOX E;  2QQ0 A;  1IQP A;  4DV4 M;  3J7A S;  1J7K A;  2M5Z A;  4RF1 A;  3J80 S;  3UFF A;  1Z5A A;  3I51 A;  3U6P A;  2F5Q A;  2DXI A;  4II7 A;  4AKH A;  2F5P A;  3HGI A;  3D00 A;  2UUB M;  4MGI E;  1DGH B;  3CTW B;  1DGH A;  4E1R A;  4IIW A;  4NSR A;  3E59 A;  1HNW M;  2B0U C;  4M0W A;  1KBE A;  2ELI A;  1V1H A;  4HGU A;  3J7B A;  2F5S A;  3HJS A;  2K9H A;  2X4A A;  5ITY A;  1W4R A;  4FCV A;  1QYR A;  2DWN A;  4JI2 M;  5EX0 A;  3SFZ A;  1IY1 A;  3AOE A;  1IBM M;  1I4W A;  3VFD A;  5FUY A;  1CGJ I;  2QQE A;  2GKR I;  1IY6 A;  4MM3 B;  1SGQ I;  3K8Z A;  3D8L A;  2QEN A;  3QAU A;  2LWX A;  2QCU A;  2C98 A;  3MJ5 A;  4RF0 A;  1Q3C A;  2Z3X A;  4GKJ M;  1TOT A;  2GKT I;  1R79 A;  2QP9 X;  5GKN A;  2VRW B;  3BOS A;  2KA6 B;  4OVO A;  1DGG A;  2JW6 A;  1HDL A;  2OPF A;  1TUS A;  4FD2 A;  2F5N A;  4NL4 H;  1IN8 A;  1ZQ9 A;  3KY9 A;  1QAO A;  3HHZ A;  1W5T A;  1W5S A;  3U6Q A;  1XNQ M;  5EP2 A;  3L2A A;  4EDV A;  1NY6 A;  2CHV A;  4IJF A;  1NVM A;  4ZPX A;  3ZC7 B;  5HI7 A;  1L2C A;  2UU9 M;  1K3W A;  1L2D A;  1UVG A;  4KLN A;  5CCL A;  3K1J A;  1KSF X;  2XZU A;  2DWL A;  3KSJ A;  2CEA A;  2OD1 A;  3KSX A;  2Y21 A;  1TBQ R;  2SGF I;  3TWL A;  1FNN A;  4LZJ A;  2XF3 A;  4LF8 M;  3RGS A;  2NU2 I;  2C96 A;  4DV6 M;  1IM2 A;  2J7O A;  4LCB A;  2JYY A;  5ITR A;  4IBD A;  1LR8 A;  3E4R A;  2BJV A;  4DV5 M;  1Y1B A;  1SGP I;  1NUB A;  3GRR A;  4B3M M;  3A42 A;  3UGI A;  4PDG A;  1OJL A;  4GIT A;  4B3S M;  3TWM A;  3UJN A;  2EA0 A;  4B7H A;  1RFH A;  4M9S A;  4KOD A;  1SXJ E;  2NU3 I;  3M6A A;  1XMQ M;  3FUX A;  4E1P A;  4O6O A;  4DUZ M;  1W3S A;  4IBB A;  3K2L A;  3HKP A;  1L1T A;  2L6O A;  4QHS A;  3MEK A;  1HQC A;  2DB6 A;  3GLG B;  2SGP I;  3JAM S;  1IXR C;  2R4E A;  3GLG A;  2NU0 I;  2LNH C;  2CFO A;  1HNZ M;  3A45 A;  2JXD A;  3LMM A;  1IY0 A;  2R4J A;  3GOX A;  3CXL A;  3LQR A;  3SAR A;  1CSO I;  1DS2 I;  3T1H M;  1OFH A;  4JV5 M;  1KMA A;  4TUW A;  3HU3 A;  2BNK A;  3GP1 A;  1QQW A;  3SMS A;  1LR9 A;  4LZZ A;  1Q39 A;  3U6O A;  4PCZ A;  5KQD A;  3KP0 E;  3UEY A;  1PPF I;  2Q2E B;  4CIS A;  1L2B A;  3KP1 E;  3FD9 A;  2Q2E A;  4JI1 M;  2E5L M;  4B08 A;  2ERC A;  2HCB A;  2DVW B;  1GVN A;  5DNY A;  4YHH M;  1X74 A;  1CE3 A;  4W5W A;  1IY2 A;  4AW4 A;  3JR5 A;  3R9X B;  3QWL A;  1GKI A;  2YQP A;  3AJI B;  3H4M A;  3RU0 A;  1L1Z A;  3WHL A;  3L26 A;  3L25 A;  4JCV A;  1H0Z A;  1M8B A;  3FTD A;  4LG2 A;  4EE1 A;  4FKD A;  5EX3 A;  1IN5 A;  4LRS A;  1Z59 A;  3RE8 A;  2EUC A;  4NRW A;  2DWZ B;  2XRC A;  2DHR A;  5FSW A;  3U5Z B;  4K0K M;  2VQE M;  3U5Z A;  1MU5 A;  2CV1 A;  2ERW A;  4REZ A;  4NXN M;  2ARP F;  2K47 A;  5EXT A;  5FTN A;  4GHA A;  1BMO A;  1NNJ A;  4O6P B;  2ODD A;  4X64 M;  3UGJ A;  3FYC A;  4JI7 M;  1XHB A;  1NNU C;  4IBG A;  2UZ3 A;  4JI6 M;  5H37 D;  3U60 B;  3KW6 A;  1JR3 A;  3W0L B;  3U60 A;  1SGN I;  1PJJ A;  2XEP A;  1OMT A;  3HJ8 A;  3FTF A;  5FUW A;  4FWD A;  3SGQ I;  4LRT A;  4NOO B;  4G4R A;  1XC8 A;  2I7P A;  2L7X A;  2KRU A;  2L7I A;  2SGE I;  4L15 A;  3VKH A;  1DO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...