3VDPA

Structure and biochemical studies of the recombination mediator protein recr in recfor pathway
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
197
structure length
197
Chain Sequence
YYSTSVAKLIEELSKLPGIGPKTAQRLAFFIINMPLDEVRSLSQAIIEAKEKLRYCKICFNITDKEVCDICSDENRDHSTICVVSHPMDVVAMEKVKEYKGVYHVLHGVISPIEGVGPEDIRIKELLERVRDGSVKEVILATNPDIEGEATAMYIAKLLKPFGVKVTRIAHGIPVGGDLEYTDVVTLSKALEGRREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination
molecule keywords Recombination protein recR
publication title RecOR complex including RecR N-N dimer and RecO monomer displays a high affinity for ssDNA
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
total genus 59
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
A PF02132 RecR RecR protein
A PF13662 Toprim_4 Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.420 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vdpA01
3.30.60.80 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3vdpA02
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 3vdpA03
1T6T1 4EDTA 4E2KA 5GUJA 2V1CA 3D00A 1EQNA 1VDDA 3VE5A 1DD9A 2AU3A 4O6OA 1DDEA 4EDGA 4EDVA 2Q2EA 3VDUA 4EDKA 3B39A 2ZBKA 1D3YA 3VDPA 4JCVA 4EDRA 4EE1A 4O6PB
chains in the Genus database with same CATH superfamily
2LHGA 5DYGA 1AUAA 4RNAA 5FTLA 4IJFA 1IBMM 3VDUA 1PJUA 2ZBKA 3A45A 3FUWA 4JCVA 5EJCA 1JR3A 5JI2E 2P5TA 3KP1E 3LW5F 3HHXA 2OZUA 1IW4A 3GLIE 3TOAA 3GLFE 1WGTA 3BJIA 5IT9S 2I5RA 1C7YA 4IBDA 2ORVA 3SYLA 2I7PA 1V92A 3CTWB 4GHLA 4HGUA 1HJAI 3FD9A 3MMPA 1LV7A 3U6CA 1NY5A 2LWXA 1NHGC 3UGDA 2GQFA 3AOGA 2DAEA 2QBYB 1WGNA 2DNAA 2C9OA 2F5OA 1IN6A 5HI7A 2L7IA 3QWPA 4AW4A 4M9ZA 3TQSA 2CUZA 1TBOA 4JXJA 1VDLA 1I94M 3GRVA 2OQ4A 2Q2EA 4DR3M 1IN4A 1TOTA 2HL7A 3SYKA 4NOOB 5IWAM 1M8CA 4AKIA 4O6OA 2BWBA 2XSZD 3CGWA 4BB9A 1NY6A 3UGLA 5LMNM 4DR5M 2HHHM 2F5QA 3GLHA 1R79A 1TGUA 1J09A 2ZM6M 2D7EA 2DKVA 1UUCA 2EUCA 2FNAA 3I04M 1HQCA 1XHBA 5BPVA 1TBQR 2UU9M 2KNAA 1UVGA 4L15A 3FSXA 1YE9A 2CEAA 3OXGA 3IHPA 2AHMA 2ZANA 3SMPA 1VEKA 5ITTA 4OU7A 3SASA 3ZH9B 1WJ7A 5FTKA 1MU5A 2M5XA 3L2AA 4TUWA 3UJNA 4HL4A 1XB2B 1L2DA 4CHTB 3SEKC 3I01M 3VFDA 1IN7A 2OPFA 2DKLA 5F3WA 4LJ7A 2DB6A 3KSJA 3IG8A 1OJLA 2KXEA 2Z8YM 1SGYI 3R5CA 2QQ0A 1OMUA 2LVQD 1GLNA 4GMQA 3GP1A 3QYEA 2Y0TA 4EDRA 3SFZA 3HY5A 3UGIA 2YNMD 4LZJA 2EA0A 4GRIA 2R4EA 3U6LA 3GLGA 9WGAA 4DR6M 3W68A 7CATA 2GKTI 1N32M 2JYYA 1G71A 2KCXA 1GKIA 4MGHA 1Z5BA 2R4JA 3U6OA 2R62A 2RC4A 1MJAA 5FSWA 2UXCM 4KT0F 4EDGA 3CF0A 4EIWA 1ZMVA 1NVMA 1GL7A 3U6QA 4NRVA 3GQ5A 3ZQJA 1IY5A 1SXJA 2N35A 3UK6A 4EE1A 4JI2M 3KVWA 4IBGA 4I4LA 1NXUA 4LJ6A 3FC3A 1CSOI 2SGPI 3AOEA 2O01F 2GKRI 4XK8F 3HWSA 1TF0B 5EX3A 2WVJA 2FFJA 1XNRM 2WZJA 4EDTA 3M0EA 2X52A 1N34M 4ITQA 3KS8A 2H5XA 2JZ1A 1XBTA 1W5SA 1BMOA 3U61B 2QQDA 1N78A 2O5RA 2OD1A 4F1IA 1W3SA 1H6UA 2RGHA 2N52A 3H4MA 3HU1A 4K0KM 4LZZA 4L8RC 1R2YA 5EXTA 3R5AA 3KS4A 2C96A 4MM3B 3J7AS 3FE3A 3J7BA 2Z3XA 3FUTA 3B74A 3HH2C 1IXSA 1XMOM 2UZ3A 3ZC7B 8CATA 2CFOA 2EKFA 4W5WA 2WGCA 1KMAA 4M0DA 3MK6A 3NWLA 3GLIB 1G8PA 2ORWA 1IM2A 2O25A 2LBCA 4FWGA 3W0LB 2B3TA 1MJ9A 1YSYA 1YTPA 4SGBI 2DWZB 3HJSA 2QSFX 4OVZA 4WP2A 4LFAM 1FYBA 2NU0I 5CCLA 4B7FA 4II7A 2NU3I 4L9MA 2R6FA 1NUBA 4MB7A 1N75A 2DXIA 1G59A 3SAWA 1DD9A 2CRUA 1K7TA 1KBFA 2JP7A 2KW0A 5EP4A 2VQFM 1CUKA 4PDGA 3HGIA 1TBNA 2KHHA 2VF7A 3HU3A 2LNHC 1SGNI 2OOAA 4Z6YA 4MH0E 4AKGA 2LUYA 1BUSA 4MGIE 3DZDA 1NNUC 1XX6A 1V1HA 2F5SA 3MJ5A 1OVOA 3U5ZB 4KODA 5KPRA 4P17A 2E73A 3UEJA 5ITUA 4IBCA 2UUAM 4KO8A 3HKPA 4RF0A 4DNCA 2W0TA 1CGII 3KW6A 2K6BA 1F4IA 4DV4M 3PDNA 3RGPA 3D00A 2RIJA 3E9SA 3AV0A 1Q3CA 2RRUA 4GEWA 3RGSA 2EO2A 1Y8FA 1HDLA 5BR8M 1R6BX 4PDIA 3J27B 1WR1B 3RE8A 2SGQI 4LF5M 5FUVA 4S12A 1MJBA 1IN8A 2CV1A 1V1IA 3OXFA 4JI5M 2G8LA 3PNYA 3E46A 1K7VA 3SGBI 1TGSI 3RFWA 5FUYA 4FKDA 2V6ZM 2WCYA 1QZMA 1NO1A 5E3QA 2CWGA 3Q8XA 1T3TA 4DUYM 4D82A 5DNYA 3NBIA 3AL0C 1XNQM 4QHSA 1KSFX 3LMMA 1Q39A 1OIPA 1XA6A 1SGQI 2SGFI 2XRCA 1W4RA 1DDEA 2ZAOA 4JN6A 3C3EA 1N77A 4DV0M 1T6OA 3K2LA 3U6SA 4AG6A 1SGEI 2A5YB 4FWHA 4BLCA 1PGYA 2V1CA 2N71A 2MR9A 3VE5A 4B7GA 2DHYA 1IXRC 1YLAA 4JI8M 2BJWA 5ITRA 2E5LM 1Z59A 5HQ8A 4JI1M 1IXZA 1KYIA 2K47A 3VKHA 1C1KA 4DV7M 2G5GX 4UXIA 2MROB 2DHRA 2OVOA 3U60A 3GO8A 2J7OA 2M60A 3B7QA 1HNZM 1NSFA 3J2PB 1DS2I 1ZAEA 2HKJA 4EDKA 4GC9A 3HZJA 4IJEA 4OW0A 4QHTA 3VLFB 4FCTA 3FYCA 1ZV1A 1TH4A 3PXGA 1SG9A 4X64M 1D0MA 3L27A 1X4SA 2Y0MA 4NC6A 5E26A 4LFCM 1HJPA 1WTJA 2ROWA 4PD2A 3AFHA 4IIWA 1UFZA 1WKXA 2J87A 2K9HA 1SXJC 5J8FA 4RF1A 2CWHA 1ULMA 3U61A 2N17A 2SGEI 2PQ8A 1K82A 1L2CA 5FTJA 3L28A 4RKUF 5DFLA 1VEJA 4G4NA 2RKOA 2X49A 1R0RI 4AI6A 3KOXE 4L16A 5DAEA 2F4VM 2LVAA 2EJSA 3KY9A 4M9SA 3BOSA 4B3MM 3HJ8A 2LB7A 5ITQA 1PJIA 1ZMWA 1NJFA 3U6EA 1QAOA 2QQ8A 2KMQA 4KLNA 2XZUA 1R7RA 2JWSA 3DFZA 2A20A 3GLIA 3GLFA 3D8LA 1T6T1 3KOWE 4E2KA 3KOZE 2XLJA 1FNNA 4MGZE 1GABA 1OAOC 3FSYA 1S3SA 1N13A 1TURA 2GIVA 5JI3E 1HT1E 2FH0A 1P9ZA 3FTFA 2CWBA 1HQYE 3J81S 3LQQA 2VF8A 4CJ6A 2ZTDA 4G6ZA 2QQEA 3HU2A 3K9PA 1S20A 4WP4A 5FUWA 5KQ8A 1HEVA 1L8QA 3VDPA 2L4EA 1QAQA 2MH8A 2UUBM 3W0FA 2SGDI 1Q9BA 3JR5A 2L7XA 4IBEA 2F5NA 3WHLA 5EQTA 2LEOA 3R5DA 5H37D 4QOSA 4OVOA 1JB0F 1XMQM 3U5ZA 1Y8GA 2RGOA 2FNFX 1G4AE 4GIPA 4HLQA 3E59A 2ODDA 3IG5A 4DR1M 5KO3A 1XXHE 5FLXS 1QYRA 3GOXA 2L09A 4LGYA 4Y28F 2KMOA 3THGA 3L25A 1T43A 2DZNB 2CHVA 1Y1BA 2R45A 2ZBKB 3HHWA 1CT2I 2DZOB 3B7NA 3AJIB 1G3IA 3A98B 1TDZA 4AG5A 1IY6A 4DV6M 1TR8A 1UM8A 2Y20A 1GVNA 4P16A 2F3CI 1YUBA 2JY6B 2Z4SA 2XH9A 2DAMA 4KHPM 1NNJA 4Q7JA 5C1BA 2QNJA 1Z5AA 1CT4I 3R8FA 3FUUA 2N1AB 4QOZC 1E9SA 1TIHA 2W82A 1PPFI 3UEYA 3T1HM 1NV8A 1QAMA 1D3YA 1J7KA 3HX3A 1MX0A 2DVWB 4A24A 2LVPC 3QTLD 3HJQA 1SGDI 3B89A 1IN5A 2KEBA 5JHWC 1VDDA 3SMSA 1CHOI 4X65M 2UXDM 1QVRA 2FE8A 4G3OA 3C3DA 4IBKA 1OTRA 3K92A 2WSEF 4REZA 3ILKA 2CJSC 4I5SA 3M6AA 7WGAA 3HHZA 3FUVA 1LTMA 1P9GA 1TDHA 1PJSA 2ZTCA 1D0LA 2XSZA 1AIPC 3FUXA 4G4RA 4G4QA 5J8CA 1FJGM 4LFBM 3Q8GA 1UVFA 5EP2A 2ELIA 3KDSE 1HNWM 3TOBA 3BBZA 2Z4RA 1V33A 2LH0A 1U5KA 2DWMA 3E21A 5DYIA 3U6PA 1KBEA 3LVVA 4LGMA 1ULNA 3V76A 4F2LA 1PJTA 4L78A 4FCWA 4B3TM 3DA1A 5IZ7D 2JZ0A 3FTEA 2JY8A 2FS1A 3UFFA 1IY1A 3R9XB 2QBYA 1GJSA 4IBJA 4L4UA 3KSXA 4AQYM 5EP3A 1V34A 4FVMA 1QUTA 5ITXE 2E5RA 1QANA 3GRYA 2JXNA 4DV1M 2QPAA 2KNVA 4X62M 2ENNA 4G4OA 4YHHM 2K0BX 3D8BA 3SHGB 1K3WA 3QYBA 1PM5A 2YR0A 3PNVA 2YQPA 1N36M 3GQ3A 3C9PA 2VIIA 4DV2M 2EKKA 4DR2M 2BWEA 2I7NA 3DOAA 4DR4M 1LR7A 5E3PA 3TL4X 2HAKA 2MGWA 2JA2A 5CCMA 1DGFA 3GPUA 2XF3A 2HCBA 2C5RA 4AKHA 2C98A 3TWLA 4NL4H 5KPTA 2KMRA 3E4RA 4JCVE 1CT0I 1JR3E 1QDRA 1OKSA 4ANRA 3F92A 4GHAA 3FRIA 3CF2A 1DS3I 3UGJA 2QCUA 1D0KA 1PCEA 4FW9A 4QNRA 3OXLA 3T6PA 3EIEA 4A3VB 1XXHB 3SBJA 4NXMM 2H1RA 1AN1I 1ORYB 4NSRA 3LVWA 2ZAMA 2NU4I 1WIVA 4DV5M 2L8EA 4GI3C 1HNXM 4DBGB 1DGBA 2KA6B 3GPXA 5A2QS 3OL0A 2B0UC 2OOBA 3RU0A 1LR9A 3VKGA 1XC8A 4QNMA 3GRRA 4CGYB 4XGIA 2FCJA 2ERWA 2QHOB 1MJGM 3R5BA 1DO0A 2CWFA 2CE7A 2JA1A 1GJTA 1SXJD 2VDBB 3SATA 3QAHA 2DAGA 5EXXA 5C18A 5KQDA 1NJGA 1CGJI 1SGRI 3TWKA 4OVZB 3TO6A 3K8ZA 2P6AC 4MGYE 4BBAA 4B3SM 3GLHE 3K1JA 4B3RM 1NV9A 1Z2IA 3LCVB 1GO5A 4R71A 2J9RA 3KXEC 1Q02A 4DV3M 1P3QQ 3VK7A 1EIJA 3SGQI 3LQRA 1OMTA 1Z5CA 1TH2A 1OAIA 2ARPF 4NSOB 3UZUA 4I8OA 1A5TA 4FWDA 2LVOC 4LJ4A 4LG2A 4CIZA 2GVIA 3T38A 2FOIC 2UXBM 3OVOA 2X3TA 5KPZA 4B6DA 2KDLA 3AOEC 4JI6M 4JV5M 2LTUA 4MGKE 4DUZM 5GUJA 3GRUA 1FAQA 2L7HA 1J5EM 1DGGA 3FTCA 3BXWA 4L6V6 3WHKA 4PCZA 2XFSA 3GQ4A 1G41A 1PRBA 5FTNA 2QQCA 2QP9X 2R44A 1OFIA 1YU6C 3MHVC 2DWLA 4M0WA 4XBOA 1QQWA 1I4WA 4IBBA 4B7HA 3PVSA 2DAIA 2D7HA 2AU3A 2XGNA 1Z6TA 1VEGA 2YUUA 3GLGE 4JI7M 2DAKA 4HEOA 2KMPA 3FRHA 1OYVI 4LCBA 1HR0M 4LY6A 3A42A 3CF6E 2KZUA 1HT2E 2JUJA 2X4AA 1QUSA 1KFVA 3QWLA 2LHCA 4GC5A 5GKNA 1ULKA 3W67A 1TH3A 2VRWB 2DIPA 1E32A 3SAVA 2B8TA 1Z7KB 2XEPA 4X66M 1BVSA 1PTQA 3UMMA 3HHYA 1W5TA 1SXJE 4E1PA 1OFHA 1EFUB 2R46A 1CE3A 3J80S 3VK8A 4UXJA 1ZQ9A 3GPYA 2CHQA 5ITYA 3SHFA 5EXSA 2K9DA 1SGPI 2GKVA 1QDTA 2OU2A 1DGHB 3GPPA 1D2NA 4FD2A 4UXHA 1WGLA 2WSCF 3U6MA 3NBXX 1OIZA 2Y21A 1K7UA 4LJAA 3A46A 5E3RA 3FKEA 3M7GA 2DWNA 2MJ5B 3JAMS 2OO9A 2XZFA 4NRWA 1X37A 1JQJC 1R5LA 3B9PA 4LJ9A 3E2IA 5L8RF 2UVOA 3SAUA 3U60B 2V53A 3I4YA 1PJJA 3C58A 1FY7A 1L2BA 3K9OA 1GL6A 1OQYA 4CISA 2C99A 1MT1A 1IFYA 2YFQA 3U6DA 4OX9M 3TJQA 2Z7JA 2QENA 1NHWC 4AMLA 2VQEM 2JW6A 1IY0A 2M5ZA 5IREB 2Y0QA 1WXQA 2V1UA 2CV2A 1XXHA 2D7GA 1L1TA 2NU1I 4DR7M 2L6OA 2BNKA 1IBLM 3B7ZA 2JXDA 1N33M 1IBKM 2Q2EB 3FYDA 3TO9A 2KRKA 3FTDA 1Y1CA 2G3QA 3L29A 1H0ZA 2GNOA 1TTEA 3OTOM 1WGCA 2ENZA 3SARA 1JR3D 3KP0E 4I81A 2JY5A 2X8AA 4YY3M 3CXLA 4ZPXA 3GLHB 3GLFB 1L1ZA 2CV0A 1DV0A 2YQZA 2J5YA 3IECA 3B4VC 2V1CC 4UN2B 2CHGA 1IY2A 2R65A 2LXEA 3KFUG 2DENA 2ERCA 1EE8A 2APLA 5EX0A 4LJ8A 3I4VA 3QAUA 4JI3M 4WW0A 4JYAM 1K3XA 1LR8A 4AZFA 2J7NA 2L2DA 3H4JA 2R0IA 3EIHA 1E9RA 1UHAA 4GITA 3T15A 4D81A 3TE6A 2WSFF 4GH9A 3I51A 2QZ4A 1EQNA 4LF8M 1X74A 2R18A 3PFIA 2KZSA 1WHCA 4JI0M 1Q3BA 2NQ8C 4WURA 1TUSA 1FARA 5EP1A 3T1YM 2HWJA 3SC3A 3ZCBB 2CP8A 2KRUA 1RFHA 2JNHA 4IBIA 1E94E 4LF4M 3GLGB 1TBRR 4FCVA 4B08A 3TPZA 3B39A 4GKKM 2DI0A 5FUXA 5EXPA 1R2ZA 4R3DA 4Z8XA 3TO7A 1XWIA 1QZEA 4R7GA 4E1RA 4M9XA 1R4GA 5FTMA 4D80A 2L4FA 1SXJB 4JI4M 4MPIA 4O6PB 2JY7A 1IQPA 2QPOA 4LRSA 4LF9M 5ITXA 1PTRA 1PJQA 2KNZA 1RU3A 3MEKA 5LMUM 3TWMA 2NU2I 1VQ1A 3KOYE 2XFTA 4LRTA 4LJ5A 3AKZA 5E6JA 3L26A 2DZLA 4EDVA 2F5PA 3LCUA 4GKJM 1ZMUA 1HPTA 1MN3A 1DGHA 2C9CA 4LF6M 2BUSA 4PT5A 1DO2A 3JR4A 1VG5A 2LVNC 4LF7M 1IXSB 4NXNM 3UOEA 1M8BA 2UUCM 4IBFA 2JZMA 2BJVA
chains in the Genus database with same CATH topology
4KODA 5DYGA 5KPRA 1HR0M 1Z5AA 2E73A 4LY6A 3A42A 3CF6E 4RNAA 2KZUA 1CT4I 1HT2E 3UEJA 2X4AA 5ITUA 3R8FA 1KFVA 4IBCA 3QWLA 5FTLA 3FUUA 4IJFA 2N1AB 4QOZC 2UUAM 1E9SA 4GC5A 5GKNA 3VDUA 1IBMM 4KO8A 3HKPA 2W82A 1PPFI 1TIHA 4RF0A 3T1HM 1PJUA 1TH3A 2VRWB 2DIPA 3UEYA 2ZBKA 3A45A 1E32A 1QAMA 3SAVA 2B8TA 1Z7KB 2W0TA 1D3YA 3FUWA 1J7KA 1CGII 4JCVA 3KW6A 2XEPA 1MX0A 4X66M 2DVWB 5EJCA 4A24A 1JR3A 3QTLD 5JI2E 1PTQA 3UMMA 4DV4M 2P5TA 3HJQA 3KP1E 1SGDI 3PDNA 1IN5A 3HHXA 3HHYA 1W5TA 1SXJE 3RGPA 3D00A 4E1PA 1IW4A 1OFHA 2KEBA 5JHWC 1VDDA 2R46A 1CE3A 3J80S 3VK8A 3SMSA 3E9SA 4UXJA 3AV0A 1CHOI 4X65M 1ZQ9A 2UXDM 1QVRA 1Q3CA 3GPYA 3BJIA 2CHQA 5IT9S 5ITYA 2FE8A 3RGSA 2EO2A 3SHFA 4IBKA 4IBDA 1Y8FA 1HDLA 5BR8M 2ORVA 3SYLA 1R6BX 2I7PA 5EXSA 4PDIA 3J27B 3K92A 3CTWB 4GHLA 4REZA 3RE8A 4LF5M 3ILKA 2SGQI 1SGPI 4HGUA 2GKVA 5FUVA 4S12A 2CJSC 4I5SA 3M6AA 3FD9A 1HJAI 1DGHB 1LV7A 3U6CA 1NY5A 2LWXA 3HHZA 3FUVA 1IN8A 3GPPA 1NHGC 1D2NA 2CV1A 1V1IA 3OXFA 3UGDA 4FD2A 4JI5M 4UXHA 2G8LA 3AOGA 1TDHA 3U6MA 3PNYA 2QBYB 3SGBI 1TGSI 2Y21A 4LJAA 2XSZA 3RFWA 3A46A 5FUYA 2C9OA 3FUXA 3FKEA 2F5OA 3M7GA 4G4RA 1IN6A 4G4QA 5HI7A 2DWNA 4FKDA 2L7IA 3QWPA 2V6ZM 4AW4A 3JAMS 1FJGM 2XZFA 4NRWA 1X37A 1QZMA 4LFBM 2WCYA 4M9ZA 3TQSA 2CUZA 1UVFA 1JQJC 4JXJA 1TBOA 5EP2A 3Q8XA 1I94M 3GRVA 2OQ4A 2Q2EA 1T3TA 4DUYM 4D82A 3KDSE 4DR3M 5DNYA 2ELIA 3NBIA 1HNWM 3B9PA 3AL0C 2Z4RA 4LJ9A 1IN4A 2LH0A 1XNQM 1TOTA 4QHSA 1U5KA 3E2IA 1KSFX 2DWMA 5DYIA 3LMMA 3U6PA 1Q39A 1KBEA 1XA6A 2HL7A 3LVVA 4LGMA 3SYKA 4NOOB 3SAUA 1SGQI 2SGFI 4L78A 3U60B 2XRCA 2V53A 5IWAM 4FCWA 4B3TM 3DA1A 5IZ7D 1M8CA 1W4RA 4AKIA 3I4YA 4O6OA 1DDEA 1PJJA 2ZAOA 2XSZD 3C58A 3FTEA 1L2BA 4BB9A 1NY6A 3UFFA 1IY1A 1GL6A 3R9XB 4JN6A 2QBYA 4IBJA 4L4UA 3UGLA 1N77A 3KSXA 4DV0M 4CISA 5LMNM 2C99A 4DR5M 2HHHM 3K2LA 1MT1A 2F5QA 4AQYM 3GLHA 3U6SA 2YFQA 5EP3A 4AG6A 3U6DA 4OX9M 1R79A 1SGEI 3TJQA 1TGUA 2A5YB 1J09A 4FWHA 2Z7JA 2ZM6M 2D7EA 2QENA 1UUCA 2EUCA 4BLCA 4FVMA 1NHWC 2V1CA 2FNAA 5ITXE 2N71A 2E5RA 1HQCA 1XHBA 5BPVA 1TBQR 1QANA 2UU9M 2VQEM 3VE5A 3GRYA 1UVGA 4L15A 4B7GA 1IXRC 4DV1M 2QPAA 4JI8M 2JW6A 1YE9A 2CEAA 3OXGA 2AHMA 2BJWA 5ITRA 1IY0A 2ZANA 4X62M 2E5LM 1Z59A 3SMPA 2M5ZA 2ENNA 5HQ8A 5IREB 4G4OA 2Y0QA 1WXQA 4JI1M 1IXZA 1KYIA 2K47A 4YHHM 2V1UA 1C1KA 5ITTA 2CV2A 3VKHA 4DV7M 3D8BA 4OU7A 2G5GX 3SASA 1XXHA 2D7GA 3SHGB 3ZH9B 1L1TA 2NU1I 4UXIA 4DR7M 5FTKA 1OVOA 2DHRA 1MU5A 1K3WA 2L6OA 2BNKA 3U60A 1IBLM 2M5XA 3GO8A 2OVOA 3L2AA 2JXDA 2J7OA 1PM5A 2M60A 1N33M 2YR0A 1IBKM 4TUWA 1HNZM 3UJNA 1NSFA 3J2PB 3PNVA 4HL4A 1DS2I 1L2DA 1ZAEA 4CHTB 3SEKC 2HKJA 2YQPA 4EDKA 1N36M 4GC9A 2Q2EB 4IJEA 4OW0A 3GQ3A 3FYDA 4QHTA 3VLFB 4FCTA 2KRKA 3VFDA 1IN7A 3FTDA 3FYCA 2OPFA 2VIIA 5F3WA 1TH4A 4LJ7A 2DB6A 3PXGA 4DV2M 4DR2M 1Y1CA 3L29A 3KSJA 2I7NA 3IG8A 1OJLA 3DOAA 2KXEA 4DR4M 1LR7A 1H0ZA 4X64M 3TL4X 3L27A 1SGYI 1X4SA 3OTOM 2QQ0A 2JA2A 1OMUA 5CCMA 5E26A 4LFCM 1DGFA 3GPUA 2ENZA 3SARA 2ROWA 4PD2A 1GLNA 1JR3D 3KP0E 4GMQA 2XF3A 4I81A 3GP1A 2HCBA 2X8AA 3AFHA 2C5RA 4AKHA 2Y0TA 4IIWA 4YY3M 2C98A 4EDRA 3SFZA 3UGIA 3TWLA 2YNMD 3CXLA 4NL4H 4LZJA 4ZPXA 5KPTA 2EA0A 3GLHB 2J87A 4GRIA 3GLFB 3E4RA 2KMRA 2K9HA 2R4EA 3U6LA 1SXJC 3GLGA 4RF1A 1L1ZA 4DR6M 4JCVE 7CATA 2CV0A 2GKTI 1N32M 2JYYA 2YQZA 3U61A 1CT0I 2N17A 2SGEI 1K82A 1L2CA 5FTJA 4GHAA 3L28A 2V1CC 3B4VC 2KCXA 3CF2A 1DS3I 3UGJA 2QCUA 2CHGA 1IY2A 1GKIA 2R65A 4MGHA 1Z5BA 4G4NA 2LXEA 3KFUG 2RKOA 2X49A 2ERCA 4FW9A 1PCEA 1R0RI 2R4JA 4QNRA 4AI6A 3KOXE 4L16A 5DAEA 1EE8A 2F4VM 3OXLA 3EIEA 4A3VB 5EX0A 3U6OA 3KY9A 1XXHB 4M9SA 3SBJA 4NXMM 4LJ8A 3I4VA 3BOSA 3QAUA 2H1RA 3HJ8A 2R62A 4JI3M 4B3MM 1AN1I 1ORYB 4NSRA 4WW0A 4JYAM 3LVWA 1K3XA 2ZAMA 5ITQA 1LR8A 2NU4I 1PJIA 5FSWA 2UXCM 4AZFA 1NJFA 3CF0A 4EIWA 3U6EA 4EDGA 1NVMA 1QAOA 4DV5M 2J7NA 2L8EA 1GL7A 3U6QA 4NRVA 3GQ5A 2KMQA 1HNXM 4GI3C 4KLNA 1IY5A 2XZUA 1R7RA 3DFZA 1SXJA 2A20A 3EIHA 1DGBA 1E9RA 3UK6A 4GITA 3GLIA 4EE1A 3T15A 2KA6B 3TE6A 4D81A 3GPXA 5A2QS 3GLFA 4JI2M 3KVWA 3D8LA 3OL0A 1T6T1 4IBGA 4I4LA 3KOWE 2B0UC 3KOZE 4E2KA 4GH9A 3I51A 2QZ4A 1EQNA 3RU0A 4LF8M 1LR9A 1X74A 3VKGA 2R18A 4LJ6A 1CSOI 3PFIA 2XLJA 1FNNA 1XC8A 2SGPI 3FC3A 3AOEA 2KZSA 4MGZE 4JI0M 1Q3BA 2NQ8C 2GKRI 4QNMA 4WURA 1TUSA 1S3SA 3HWSA 1FARA 5EP1A 1N13A 1TURA 3GRRA 4CGYB 5EX3A 5JI3E 3T1YM 1HT1E 2WVJA 3FTFA 3SC3A 2FFJA 3ZCBB 1XNRM 4XGIA 2ERWA 2KRUA 1DO0A 4EDTA 1HQYE 2CE7A 3M0EA 1RFHA 4IBIA 1N34M 1E94E 2JA1A 4LF4M 3GLGB 3J81S 4ITQA 3KS8A 3LQQA 1TBRR 1XBTA 1SXJD 4FCVA 4G6ZA 4B08A 2QQEA 1W5SA 3HU2A 3TPZA 3U61B 1BMOA 2QQDA 1N78A 2O5RA 5FUWA 2OD1A 3B39A 3SATA 4GKKM 1W3SA 1H6UA 5KQ8A 2RGHA 1L8QA 2N52A 3VDPA 5EXXA 5C18A 3H4MA 3HU1A 5KQDA 1NJGA 5FUXA 1CGJI 1SGRI 4K0KM 1QAQA 4LZZA 4OVZB 3TWKA 5EXPA 4L8RC 3K8ZA 1R2ZA 2UUBM 2P6AC 4R3DA 4MGYE 3W0FA 4BBAA 1R2YA 4B3SM 2SGDI 5EXTA 3KS4A 2C96A 3JR5A 4Z8XA 4IBEA 1XWIA 2L7XA 2F5NA 3WHLA 3K1JA 4B3RM 5EQTA 4MM3B 3J7AS 2LEOA 3J7BA 2Z3XA 3FUTA 5H37D 3HH2C 4R7GA 1XMOM 4QOSA 2UZ3A 3ZC7B 8CATA 4E1RA 2CFOA 4M9XA 4OVOA 4W5WA 2J9RA 3KXEC 1KMAA 4M0DA 1XMQM 5FTMA 4D80A 4DV3M 3U5ZA 3MK6A 3VK7A 1SXJB 4JI4M 3SGQI 4O6PB 3LQRA 2RGOA 3NWLA 3GLIB 1G8PA 1OMTA 2ORWA 2FNFX 1G4AE 4GIPA 4HLQA 1Z5CA 1IM2A 1TH2A 3E59A 2ARPF 2ODDA 4NSOB 3UZUA 4I8OA 1IQPA 3IG5A 4DR1M 4FWDA 5KO3A 4LJ4A 5FLXS 4LG2A 4FWGA 2GVIA 2QPOA 3T38A 2FOIC 2UXBM 3OVOA 3W0LB 5KPZA 1QYRA 4LRSA 3GOXA 1YSYA 4B6DA 4LF9M 1YTPA 3AOEC 2L09A 4SGBI 4JI6M 5ITXA 4LGYA 2DWZB 4JV5M 1PTRA 2KMOA 3HJSA 4OVZA 4MGKE 4LFAM 3THGA 3MEKA 4DUZM 5LMUM 3L25A 1FYBA 2NU0I 5GUJA 3TWMA 3GRUA 5CCLA 2NU2I 4B7FA 4II7A 2NU3I 4L9MA 1FAQA 3KOYE 2XFTA 1NUBA 4LRTA 4LJ5A 4MB7A 3AKZA 1N75A 5E6JA 2DXIA 1G59A 3L26A 2L7HA 3SAWA 1J5EM 1DD9A 1DGGA 3FTCA 2DZNB 1KBFA 4EDVA 2CHVA 3WHKA 2F5PA 1Y1BA 4PCZA 2XFSA 2R45A 2ZBKB 3HHWA 2KW0A 3GQ4A 1G41A 5EP4A 4GKJM 2VQFM 5FTNA 1CT2I 2QQCA 2QP9X 4PDGA 2DZOB 3HGIA 1HPTA 1OFIA 1YU6C 3MHVC 1TBNA 2DWLA 4M0WA 4XBOA 3AJIB 1G3IA 3A98B 1TDZA 1DGHA 1QQWA 3HU3A 2C9CA 1I4WA 4AG5A 4LF6M 1IY6A 4IBBA 2LNHC 1SGNI 4B7HA 2BUSA 4PT5A 4DV6M 3PVSA 1DO2A 1UM8A 2D7HA 1GVNA 2Y20A 4P16A 4Z6YA 2F3CI 4MH0E 3JR4A 2AU3A 2XGNA 1Z6TA 2YUUA 1YUBA 4LF7M 2Z4SA 4JI7M 4AKGA 2LUYA 1IXSB 2XH9A 4NXNM 4MGIE 1BUSA 3DZDA 1NNUC 1XX6A 1M8BA 4KHPM 2KMPA 1V1HA 2UUCM 1NNJA 1OYVI 5C1BA 3MJ5A 4LCBA 4IBFA 3U5ZB 2F5SA 2JZMA 2BJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6T 1;  4EDT A;  4E2K A;  5GUJ A;  2V1C A;  3D00 A;  1EQN A;  1VDD A;  3VE5 A;  1DD9 A;  2AU3 A;  4O6O A;  1DDE A;  4EDG A;  4EDV A;  2Q2E A;  3VDU A;  4EDK A;  3B39 A;  2ZBK A;  1D3Y A;  3VDP A;  4JCV A;  4EDR A;  4EE1 A;  4O6P B; 
#chains in the Genus database with same CATH topology
 2LHG A;  5DYG A;  1AUA A;  4RNA A;  5FTL A;  4IJF A;  1IBM M;  3VDU A;  1PJU A;  2ZBK A;  3A45 A;  3FUW A;  4JCV A;  5EJC A;  1JR3 A;  5JI2 E;  2P5T A;  3KP1 E;  3LW5 F;  3HHX A;  2OZU A;  1IW4 A;  3GLI E;  3TOA A;  3GLF E;  1WGT A;  3BJI A;  5IT9 S;  2I5R A;  1C7Y A;  4IBD A;  2ORV A;  3SYL A;  2I7P A;  1V92 A;  3CTW B;  4GHL A;  4HGU A;  1HJA I;  3FD9 A;  3MMP A;  1LV7 A;  3U6C A;  1NY5 A;  2LWX A;  1NHG C;  3UGD A;  2GQF A;  3AOG A;  2DAE A;  2QBY B;  1WGN A;  2DNA A;  2C9O A;  2F5O A;  1IN6 A;  5HI7 A;  2L7I A;  3QWP A;  4AW4 A;  4M9Z A;  3TQS A;  2CUZ A;  1TBO A;  4JXJ A;  1VDL A;  1I94 M;  3GRV A;  2OQ4 A;  2Q2E A;  4DR3 M;  1IN4 A;  1TOT A;  2HL7 A;  3SYK A;  4NOO B;  5IWA M;  1M8C A;  4AKI A;  4O6O A;  2BWB A;  2XSZ D;  3CGW A;  4BB9 A;  1NY6 A;  3UGL A;  5LMN M;  4DR5 M;  2HHH M;  2F5Q A;  3GLH A;  1R79 A;  1TGU A;  1J09 A;  2ZM6 M;  2D7E A;  2DKV A;  1UUC A;  2EUC A;  2FNA A;  3I04 M;  1HQC A;  1XHB A;  5BPV A;  1TBQ R;  2UU9 M;  2KNA A;  1UVG A;  4L15 A;  3FSX A;  1YE9 A;  2CEA A;  3OXG A;  3IHP A;  2AHM A;  2ZAN A;  3SMP A;  1VEK A;  5ITT A;  4OU7 A;  3SAS A;  3ZH9 B;  1WJ7 A;  5FTK A;  1MU5 A;  2M5X A;  3L2A A;  4TUW A;  3UJN A;  4HL4 A;  1XB2 B;  1L2D A;  4CHT B;  3SEK C;  3I01 M;  3VFD A;  1IN7 A;  2OPF A;  2DKL A;  5F3W A;  4LJ7 A;  2DB6 A;  3KSJ A;  3IG8 A;  1OJL A;  2KXE A;  2Z8Y M;  1SGY I;  3R5C A;  2QQ0 A;  1OMU A;  2LVQ D;  1GLN A;  4GMQ A;  3GP1 A;  3QYE A;  2Y0T A;  4EDR A;  3SFZ A;  3HY5 A;  3UGI A;  2YNM D;  4LZJ A;  2EA0 A;  4GRI A;  2R4E A;  3U6L A;  3GLG A;  9WGA A;  4DR6 M;  3W68 A;  7CAT A;  2GKT I;  1N32 M;  2JYY A;  1G71 A;  2KCX A;  1GKI A;  4MGH A;  1Z5B A;  2R4J A;  3U6O A;  2R62 A;  2RC4 A;  1MJA A;  5FSW A;  2UXC M;  4KT0 F;  4EDG A;  3CF0 A;  4EIW A;  1ZMV A;  1NVM A;  1GL7 A;  3U6Q A;  4NRV A;  3GQ5 A;  3ZQJ A;  1IY5 A;  1SXJ A;  2N35 A;  3UK6 A;  4EE1 A;  4JI2 M;  3KVW A;  4IBG A;  4I4L A;  1NXU A;  4LJ6 A;  3FC3 A;  1CSO I;  2SGP I;  3AOE A;  2O01 F;  2GKR I;  4XK8 F;  3HWS A;  1TF0 B;  5EX3 A;  2WVJ A;  2FFJ A;  1XNR M;  2WZJ A;  4EDT A;  3M0E A;  2X52 A;  1N34 M;  4ITQ A;  3KS8 A;  2H5X A;  2JZ1 A;  1XBT A;  1W5S A;  1BMO A;  3U61 B;  2QQD A;  1N78 A;  2O5R A;  2OD1 A;  4F1I A;  1W3S A;  1H6U A;  2RGH A;  2N52 A;  3H4M A;  3HU1 A;  4K0K M;  4LZZ A;  4L8R C;  1R2Y A;  5EXT A;  3R5A A;  3KS4 A;  2C96 A;  4MM3 B;  3J7A S;  3FE3 A;  3J7B A;  2Z3X A;  3FUT A;  3B74 A;  3HH2 C;  1IXS A;  1XMO M;  2UZ3 A;  3ZC7 B;  8CAT A;  2CFO A;  2EKF A;  4W5W A;  2WGC A;  1KMA A;  4M0D A;  3MK6 A;  3NWL A;  3GLI B;  1G8P A;  2ORW A;  1IM2 A;  2O25 A;  2LBC A;  4FWG A;  3W0L B;  2B3T A;  1MJ9 A;  1YSY A;  1YTP A;  4SGB I;  2DWZ B;  3HJS A;  2QSF X;  4OVZ A;  4WP2 A;  4LFA M;  1FYB A;  2NU0 I;  5CCL A;  4B7F A;  4II7 A;  2NU3 I;  4L9M A;  2R6F A;  1NUB A;  4MB7 A;  1N75 A;  2DXI A;  1G59 A;  3SAW A;  1DD9 A;  2CRU A;  1K7T A;  1KBF A;  2JP7 A;  2KW0 A;  5EP4 A;  2VQF M;  1CUK A;  4PDG A;  3HGI A;  1TBN A;  2KHH A;  2VF7 A;  3HU3 A;  2LNH C;  1SGN I;  2OOA A;  4Z6Y A;  4MH0 E;  4AKG A;  2LUY A;  1BUS A;  4MGI E;  3DZD A;  1NNU C;  1XX6 A;  1V1H A;  2F5S A;  3MJ5 A;  1OVO A;  3U5Z B;  4KOD A;  5KPR A;  4P17 A;  2E73 A;  3UEJ A;  5ITU A;  4IBC A;  2UUA M;  4KO8 A;  3HKP A;  4RF0 A;  4DNC A;  2W0T A;  1CGI I;  3KW6 A;  2K6B A;  1F4I A;  4DV4 M;  3PDN A;  3RGP A;  3D00 A;  2RIJ A;  3E9S A;  3AV0 A;  1Q3C A;  2RRU A;  4GEW A;  3RGS A;  2EO2 A;  1Y8F A;  1HDL A;  5BR8 M;  1R6B X;  4PDI A;  3J27 B;  1WR1 B;  3RE8 A;  2SGQ I;  4LF5 M;  5FUV A;  4S12 A;  1MJB A;  1IN8 A;  2CV1 A;  1V1I A;  3OXF A;  4JI5 M;  2G8L A;  3PNY A;  3E46 A;  1K7V A;  3SGB I;  1TGS I;  3RFW A;  5FUY A;  4FKD A;  2V6Z M;  2WCY A;  1QZM A;  1NO1 A;  5E3Q A;  2CWG A;  3Q8X A;  1T3T A;  4DUY M;  4D82 A;  5DNY A;  3NBI A;  3AL0 C;  1XNQ M;  4QHS A;  1KSF X;  3LMM A;  1Q39 A;  1OIP A;  1XA6 A;  1SGQ I;  2SGF I;  2XRC A;  1W4R A;  1DDE A;  2ZAO A;  4JN6 A;  3C3E A;  1N77 A;  4DV0 M;  1T6O A;  3K2L A;  3U6S A;  4AG6 A;  1SGE I;  2A5Y B;  4FWH A;  4BLC A;  1PGY A;  2V1C A;  2N71 A;  2MR9 A;  3VE5 A;  4B7G A;  2DHY A;  1IXR C;  1YLA A;  4JI8 M;  2BJW A;  5ITR A;  2E5L M;  1Z59 A;  5HQ8 A;  4JI1 M;  1IXZ A;  1KYI A;  2K47 A;  3VKH A;  1C1K A;  4DV7 M;  2G5G X;  4UXI A;  2MRO B;  2DHR A;  2OVO A;  3U60 A;  3GO8 A;  2J7O A;  2M60 A;  3B7Q A;  1HNZ M;  1NSF A;  3J2P B;  1DS2 I;  1ZAE A;  2HKJ A;  4EDK A;  4GC9 A;  3HZJ A;  4IJE A;  4OW0 A;  4QHT A;  3VLF B;  4FCT A;  3FYC A;  1ZV1 A;  1TH4 A;  3PXG A;  1SG9 A;  4X64 M;  1D0M A;  3L27 A;  1X4S A;  2Y0M A;  4NC6 A;  5E26 A;  4LFC M;  1HJP A;  1WTJ A;  2ROW A;  4PD2 A;  3AFH A;  4IIW A;  1UFZ A;  1WKX A;  2J87 A;  2K9H A;  1SXJ C;  5J8F A;  4RF1 A;  2CWH A;  1ULM A;  3U61 A;  2N17 A;  2SGE I;  2PQ8 A;  1K82 A;  1L2C A;  5FTJ A;  3L28 A;  4RKU F;  5DFL A;  1VEJ A;  4G4N A;  2RKO A;  2X49 A;  1R0R I;  4AI6 A;  3KOX E;  4L16 A;  5DAE A;  2F4V M;  2LVA A;  2EJS A;  3KY9 A;  4M9S A;  3BOS A;  4B3M M;  3HJ8 A;  2LB7 A;  5ITQ A;  1PJI A;  1ZMW A;  1NJF A;  3U6E A;  1QAO A;  2QQ8 A;  2KMQ A;  4KLN A;  2XZU A;  1R7R A;  2JWS A;  3DFZ A;  2A20 A;  3GLI A;  3GLF A;  3D8L A;  1T6T 1;  3KOW E;  4E2K A;  3KOZ E;  2XLJ A;  1FNN A;  4MGZ E;  1GAB A;  1OAO C;  3FSY A;  1S3S A;  1N13 A;  1TUR A;  2GIV A;  5JI3 E;  1HT1 E;  2FH0 A;  1P9Z A;  3FTF A;  2CWB A;  1HQY E;  3J81 S;  3LQQ A;  2VF8 A;  4CJ6 A;  2ZTD A;  4G6Z A;  2QQE A;  3HU2 A;  3K9P A;  1S20 A;  4WP4 A;  5FUW A;  5KQ8 A;  1HEV A;  1L8Q A;  3VDP A;  2L4E A;  1QAQ A;  2MH8 A;  2UUB M;  3W0F A;  2SGD I;  1Q9B A;  3JR5 A;  2L7X A;  4IBE A;  2F5N A;  3WHL A;  5EQT A;  2LEO A;  3R5D A;  5H37 D;  4QOS A;  4OVO A;  1JB0 F;  1XMQ M;  3U5Z A;  1Y8G A;  2RGO A;  2FNF X;  1G4A E;  4GIP A;  4HLQ A;  3E59 A;  2ODD A;  3IG5 A;  4DR1 M;  5KO3 A;  1XXH E;  5FLX S;  1QYR A;  3GOX A;  2L09 A;  4LGY A;  4Y28 F;  2KMO A;  3THG A;  3L25 A;  1T43 A;  2DZN B;  2CHV A;  1Y1B A;  2R45 A;  2ZBK B;  3HHW A;  1CT2 I;  2DZO B;  3B7N A;  3AJI B;  1G3I A;  3A98 B;  1TDZ A;  4AG5 A;  1IY6 A;  4DV6 M;  1TR8 A;  1UM8 A;  2Y20 A;  1GVN A;  4P16 A;  2F3C I;  1YUB A;  2JY6 B;  2Z4S A;  2XH9 A;  2DAM A;  4KHP M;  1NNJ A;  4Q7J A;  5C1B A;  2QNJ A;  1Z5A A;  1CT4 I;  3R8F A;  3FUU A;  2N1A B;  4QOZ C;  1E9S A;  1TIH A;  2W82 A;  1PPF I;  3UEY A;  3T1H M;  1NV8 A;  1QAM A;  1D3Y A;  1J7K A;  3HX3 A;  1MX0 A;  2DVW B;  4A24 A;  2LVP C;  3QTL D;  3HJQ A;  1SGD I;  3B89 A;  1IN5 A;  2KEB A;  5JHW C;  1VDD A;  3SMS A;  1CHO I;  4X65 M;  2UXD M;  1QVR A;  2FE8 A;  4G3O A;  3C3D A;  4IBK A;  1OTR A;  3K92 A;  2WSE F;  4REZ A;  3ILK A;  2CJS C;  4I5S A;  3M6A A;  7WGA A;  3HHZ A;  3FUV A;  1LTM A;  1P9G A;  1TDH A;  1PJS A;  2ZTC A;  1D0L A;  2XSZ A;  1AIP C;  3FUX A;  4G4R A;  4G4Q A;  5J8C A;  1FJG M;  4LFB M;  3Q8G A;  1UVF A;  5EP2 A;  2ELI A;  3KDS E;  1HNW M;  3TOB A;  3BBZ A;  2Z4R A;  1V33 A;  2LH0 A;  1U5K A;  2DWM A;  3E21 A;  5DYI A;  3U6P A;  1KBE A;  3LVV A;  4LGM A;  1ULN A;  3V76 A;  4F2L A;  1PJT A;  4L78 A;  4FCW A;  4B3T M;  3DA1 A;  5IZ7 D;  2JZ0 A;  3FTE A;  2JY8 A;  2FS1 A;  3UFF A;  1IY1 A;  3R9X B;  2QBY A;  1GJS A;  4IBJ A;  4L4U A;  3KSX A;  4AQY M;  5EP3 A;  1V34 A;  4FVM A;  1QUT A;  5ITX E;  2E5R A;  1QAN A;  3GRY A;  2JXN A;  4DV1 M;  2QPA A;  2KNV A;  4X62 M;  2ENN A;  4G4O A;  4YHH M;  2K0B X;  3D8B A;  3SHG B;  1K3W A;  3QYB A;  1PM5 A;  2YR0 A;  3PNV A;  2YQP A;  1N36 M;  3GQ3 A;  3C9P A;  2VII A;  4DV2 M;  2EKK A;  4DR2 M;  2BWE A;  2I7N A;  3DOA A;  4DR4 M;  1LR7 A;  5E3P A;  3TL4 X;  2HAK A;  2MGW A;  2JA2 A;  5CCM A;  1DGF A;  3GPU A;  2XF3 A;  2HCB A;  2C5R A;  4AKH A;  2C98 A;  3TWL A;  4NL4 H;  5KPT A;  2KMR A;  3E4R A;  4JCV E;  1CT0 I;  1JR3 E;  1QDR A;  1OKS A;  4ANR A;  3F92 A;  4GHA A;  3FRI A;  3CF2 A;  1DS3 I;  3UGJ A;  2QCU A;  1D0K A;  1PCE A;  4FW9 A;  4QNR A;  3OXL A;  3T6P A;  3EIE A;  4A3V B;  1XXH B;  3SBJ A;  4NXM M;  2H1R A;  1AN1 I;  1ORY B;  4NSR A;  3LVW A;  2ZAM A;  2NU4 I;  1WIV A;  4DV5 M;  2L8E A;  4GI3 C;  1HNX M;  4DBG B;  1DGB A;  2KA6 B;  3GPX A;  5A2Q S;  3OL0 A;  2B0U C;  2OOB A;  3RU0 A;  1LR9 A;  3VKG A;  1XC8 A;  4QNM A;  3GRR A;  4CGY B;  4XGI A;  2FCJ A;  2ERW A;  2QHO B;  1MJG M;  3R5B A;  1DO0 A;  2CWF A;  2CE7 A;  2JA1 A;  1GJT A;  1SXJ D;  2VDB B;  3SAT A;  3QAH A;  2DAG A;  5EXX A;  5C18 A;  5KQD A;  1NJG A;  1CGJ I;  1SGR I;  3TWK A;  4OVZ B;  3TO6 A;  3K8Z A;  2P6A C;  4MGY E;  4BBA A;  4B3S M;  3GLH E;  3K1J A;  4B3R M;  1NV9 A;  1Z2I A;  3LCV B;  1GO5 A;  4R71 A;  2J9R A;  3KXE C;  1Q02 A;  4DV3 M;  1P3Q Q;  3VK7 A;  1EIJ A;  3SGQ I;  3LQR A;  1OMT A;  1Z5C A;  1TH2 A;  1OAI A;  2ARP F;  4NSO B;  3UZU A;  4I8O A;  1A5T A;  4FWD A;  2LVO C;  4LJ4 A;  4LG2 A;  4CIZ A;  2GVI A;  3T38 A;  2FOI C;  2UXB M;  3OVO A;  2X3T A;  5KPZ A;  4B6D A;  2KDL A;  3AOE C;  4JI6 M;  4JV5 M;  2LTU A;  4MGK E;  4DUZ M;  5GUJ A;  3GRU A;  1FAQ A;  2L7H A;  1J5E M;  1DGG A;  3FTC A;  3BXW A;  4L6V 6;  3WHK A;  4PCZ A;  2XFS A;  3GQ4 A;  1G41 A;  1PRB A;  5FTN A;  2QQC A;  2QP9 X;  2R44 A;  1OFI A;  1YU6 C;  3MHV C;  2DWL A;  4M0W A;  4XBO A;  1QQW A;  1I4W A;  4IBB A;  4B7H A;  3PVS A;  2DAI A;  2D7H A;  2AU3 A;  2XGN A;  1Z6T A;  1VEG A;  2YUU A;  3GLG E;  4JI7 M;  2DAK A;  4HEO A;  2KMP A;  3FRH A;  1OYV I;  4LCB A;  1HR0 M;  4LY6 A;  3A42 A;  3CF6 E;  2KZU A;  1HT2 E;  2JUJ A;  2X4A A;  1QUS A;  1KFV A;  3QWL A;  2LHC A;  4GC5 A;  5GKN A;  1ULK A;  3W67 A;  1TH3 A;  2VRW B;  2DIP A;  1E32 A;  3SAV A;  2B8T A;  1Z7K B;  2XEP A;  4X66 M;  1BVS A;  1PTQ A;  3UMM A;  3HHY A;  1W5T A;  1SXJ E;  4E1P A;  1OFH A;  1EFU B;  2R46 A;  1CE3 A;  3J80 S;  3VK8 A;  4UXJ A;  1ZQ9 A;  3GPY A;  2CHQ A;  5ITY A;  3SHF A;  5EXS A;  2K9D A;  1SGP I;  2GKV A;  1QDT A;  2OU2 A;  1DGH B;  3GPP A;  1D2N A;  4FD2 A;  4UXH A;  1WGL A;  2WSC F;  3U6M A;  3NBX X;  1OIZ A;  2Y21 A;  1K7U A;  4LJA A;  3A46 A;  5E3R A;  3FKE A;  3M7G A;  2DWN A;  2MJ5 B;  3JAM S;  2OO9 A;  2XZF A;  4NRW A;  1X37 A;  1JQJ C;  1R5L A;  3B9P A;  4LJ9 A;  3E2I A;  5L8R F;  2UVO A;  3SAU A;  3U60 B;  2V53 A;  3I4Y A;  1PJJ A;  3C58 A;  1FY7 A;  1L2B A;  3K9O A;  1GL6 A;  1OQY A;  4CIS A;  2C99 A;  1MT1 A;  1IFY A;  2YFQ A;  3U6D A;  4OX9 M;  3TJQ A;  2Z7J A;  2QEN A;  1NHW C;  4AML A;  2VQE M;  2JW6 A;  1IY0 A;  2M5Z A;  5IRE B;  2Y0Q A;  1WXQ A;  2V1U A;  2CV2 A;  1XXH A;  2D7G A;  1L1T A;  2NU1 I;  4DR7 M;  2L6O A;  2BNK A;  1IBL M;  3B7Z A;  2JXD A;  1N33 M;  1IBK M;  2Q2E B;  3FYD A;  3TO9 A;  2KRK A;  3FTD A;  1Y1C A;  2G3Q A;  3L29 A;  1H0Z A;  2GNO A;  1TTE A;  3OTO M;  1WGC A;  2ENZ A;  3SAR A;  1JR3 D;  3KP0 E;  4I81 A;  2JY5 A;  2X8A A;  4YY3 M;  3CXL A;  4ZPX A;  3GLH B;  3GLF B;  1L1Z A;  2CV0 A;  1DV0 A;  2YQZ A;  2J5Y A;  3IEC A;  3B4V C;  2V1C C;  4UN2 B;  2CHG A;  1IY2 A;  2R65 A;  2LXE A;  3KFU G;  2DEN A;  2ERC A;  1EE8 A;  2APL A;  5EX0 A;  4LJ8 A;  3I4V A;  3QAU A;  4JI3 M;  4WW0 A;  4JYA M;  1K3X A;  1LR8 A;  4AZF A;  2J7N A;  2L2D A;  3H4J A;  2R0I A;  3EIH A;  1E9R A;  1UHA A;  4GIT A;  3T15 A;  4D81 A;  3TE6 A;  2WSF F;  4GH9 A;  3I51 A;  2QZ4 A;  1EQN A;  4LF8 M;  1X74 A;  2R18 A;  3PFI A;  2KZS A;  1WHC A;  4JI0 M;  1Q3B A;  2NQ8 C;  4WUR A;  1TUS A;  1FAR A;  5EP1 A;  3T1Y M;  2HWJ A;  3SC3 A;  3ZCB B;  2CP8 A;  2KRU A;  1RFH A;  2JNH A;  4IBI A;  1E94 E;  4LF4 M;  3GLG B;  1TBR R;  4FCV A;  4B08 A;  3TPZ A;  3B39 A;  4GKK M;  2DI0 A;  5FUX A;  5EXP A;  1R2Z A;  4R3D A;  4Z8X A;  3TO7 A;  1XWI A;  1QZE A;  4R7G A;  4E1R A;  4M9X A;  1R4G A;  5FTM A;  4D80 A;  2L4F A;  1SXJ B;  4JI4 M;  4MPI A;  4O6P B;  2JY7 A;  1IQP A;  2QPO A;  4LRS A;  4LF9 M;  5ITX A;  1PTR A;  1PJQ A;  2KNZ A;  1RU3 A;  3MEK A;  5LMU M;  3TWM A;  2NU2 I;  1VQ1 A;  3KOY E;  2XFT A;  4LRT A;  4LJ5 A;  3AKZ A;  5E6J A;  3L26 A;  2DZL A;  4EDV A;  2F5P A;  3LCU A;  4GKJ M;  1ZMU A;  1HPT A;  1MN3 A;  1DGH A;  2C9C A;  4LF6 M;  2BUS A;  4PT5 A;  1DO2 A;  3JR4 A;  1VG5 A;  2LVN C;  4LF7 M;  1IXS B;  4NXN M;  3UOE A;  1M8B A;  2UUC M;  4IBF A;  2JZM A;  2BJV A; 
#chains in the Genus database with same CATH homology
 4KOD A;  5DYG A;  5KPR A;  1HR0 M;  1Z5A A;  2E73 A;  4LY6 A;  3A42 A;  3CF6 E;  4RNA A;  2KZU A;  1CT4 I;  1HT2 E;  3UEJ A;  2X4A A;  5ITU A;  3R8F A;  1KFV A;  4IBC A;  3QWL A;  5FTL A;  3FUU A;  4IJF A;  2N1A B;  4QOZ C;  2UUA M;  1E9S A;  4GC5 A;  5GKN A;  3VDU A;  1IBM M;  4KO8 A;  3HKP A;  2W82 A;  1PPF I;  1TIH A;  4RF0 A;  3T1H M;  1PJU A;  1TH3 A;  2VRW B;  2DIP A;  3UEY A;  2ZBK A;  3A45 A;  1E32 A;  1QAM A;  3SAV A;  2B8T A;  1Z7K B;  2W0T A;  1D3Y A;  3FUW A;  1J7K A;  1CGI I;  4JCV A;  3KW6 A;  2XEP A;  1MX0 A;  4X66 M;  2DVW B;  5EJC A;  4A24 A;  1JR3 A;  3QTL D;  5JI2 E;  1PTQ A;  3UMM A;  4DV4 M;  2P5T A;  3HJQ A;  3KP1 E;  1SGD I;  3PDN A;  1IN5 A;  3HHX A;  3HHY A;  1W5T A;  1SXJ E;  3RGP A;  3D00 A;  4E1P A;  1IW4 A;  1OFH A;  2KEB A;  5JHW C;  1VDD A;  2R46 A;  1CE3 A;  3J80 S;  3VK8 A;  3SMS A;  3E9S A;  4UXJ A;  3AV0 A;  1CHO I;  4X65 M;  1ZQ9 A;  2UXD M;  1QVR A;  1Q3C A;  3GPY A;  3BJI A;  2CHQ A;  5IT9 S;  5ITY A;  2FE8 A;  3RGS A;  2EO2 A;  3SHF A;  4IBK A;  4IBD A;  1Y8F A;  1HDL A;  5BR8 M;  2ORV A;  3SYL A;  1R6B X;  2I7P A;  5EXS A;  4PDI A;  3J27 B;  3K92 A;  3CTW B;  4GHL A;  4REZ A;  3RE8 A;  4LF5 M;  3ILK A;  2SGQ I;  1SGP I;  4HGU A;  2GKV A;  5FUV A;  4S12 A;  2CJS C;  4I5S A;  3M6A A;  3FD9 A;  1HJA I;  1DGH B;  1LV7 A;  3U6C A;  1NY5 A;  2LWX A;  3HHZ A;  3FUV A;  1IN8 A;  3GPP A;  1NHG C;  1D2N A;  2CV1 A;  1V1I A;  3OXF A;  3UGD A;  4FD2 A;  4JI5 M;  4UXH A;  2G8L A;  3AOG A;  1TDH A;  3U6M A;  3PNY A;  2QBY B;  3SGB I;  1TGS I;  2Y21 A;  4LJA A;  2XSZ A;  3RFW A;  3A46 A;  5FUY A;  2C9O A;  3FUX A;  3FKE A;  2F5O A;  3M7G A;  4G4R A;  1IN6 A;  4G4Q A;  5HI7 A;  2DWN A;  4FKD A;  2L7I A;  3QWP A;  2V6Z M;  4AW4 A;  3JAM S;  1FJG M;  2XZF A;  4NRW A;  1X37 A;  1QZM A;  4LFB M;  2WCY A;  4M9Z A;  3TQS A;  2CUZ A;  1UVF A;  1JQJ C;  4JXJ A;  1TBO A;  5EP2 A;  3Q8X A;  1I94 M;  3GRV A;  2OQ4 A;  2Q2E A;  1T3T A;  4DUY M;  4D82 A;  3KDS E;  4DR3 M;  5DNY A;  2ELI A;  3NBI A;  1HNW M;  3B9P A;  3AL0 C;  2Z4R A;  4LJ9 A;  1IN4 A;  2LH0 A;  1XNQ M;  1TOT A;  4QHS A;  1U5K A;  3E2I A;  1KSF X;  2DWM A;  5DYI A;  3LMM A;  3U6P A;  1Q39 A;  1KBE A;  1XA6 A;  2HL7 A;  3LVV A;  4LGM A;  3SYK A;  4NOO B;  3SAU A;  1SGQ I;  2SGF I;  4L78 A;  3U60 B;  2XRC A;  2V53 A;  5IWA M;  4FCW A;  4B3T M;  3DA1 A;  5IZ7 D;  1M8C A;  1W4R A;  4AKI A;  3I4Y A;  4O6O A;  1DDE A;  1PJJ A;  2ZAO A;  2XSZ D;  3C58 A;  3FTE A;  1L2B A;  4BB9 A;  1NY6 A;  3UFF A;  1IY1 A;  1GL6 A;  3R9X B;  4JN6 A;  2QBY A;  4IBJ A;  4L4U A;  3UGL A;  1N77 A;  3KSX A;  4DV0 M;  4CIS A;  5LMN M;  2C99 A;  4DR5 M;  2HHH M;  3K2L A;  1MT1 A;  2F5Q A;  4AQY M;  3GLH A;  3U6S A;  2YFQ A;  5EP3 A;  4AG6 A;  3U6D A;  4OX9 M;  1R79 A;  1SGE I;  3TJQ A;  1TGU A;  2A5Y B;  1J09 A;  4FWH A;  2Z7J A;  2ZM6 M;  2D7E A;  2QEN A;  1UUC A;  2EUC A;  4BLC A;  4FVM A;  1NHW C;  2V1C A;  2FNA A;  5ITX E;  2N71 A;  2E5R A;  1HQC A;  1XHB A;  5BPV A;  1TBQ R;  1QAN A;  2UU9 M;  2VQE M;  3VE5 A;  3GRY A;  1UVG A;  4L15 A;  4B7G A;  1IXR C;  4DV1 M;  2QPA A;  4JI8 M;  2JW6 A;  1YE9 A;  2CEA A;  3OXG A;  2AHM A;  2BJW A;  5ITR A;  1IY0 A;  2ZAN A;  4X62 M;  2E5L M;  1Z59 A;  3SMP A;  2M5Z A;  2ENN A;  5HQ8 A;  5IRE B;  4G4O A;  2Y0Q A;  1WXQ A;  4JI1 M;  1IXZ A;  1KYI A;  2K47 A;  4YHH M;  2V1U A;  1C1K A;  5ITT A;  2CV2 A;  3VKH A;  4DV7 M;  3D8B A;  4OU7 A;  2G5G X;  3SAS A;  1XXH A;  2D7G A;  3SHG B;  3ZH9 B;  1L1T A;  2NU1 I;  4UXI A;  4DR7 M;  5FTK A;  1OVO A;  2DHR A;  1MU5 A;  1K3W A;  2L6O A;  2BNK A;  3U60 A;  1IBL M;  2M5X A;  3GO8 A;  2OVO A;  3L2A A;  2JXD A;  2J7O A;  1PM5 A;  2M60 A;  1N33 M;  2YR0 A;  1IBK M;  4TUW A;  1HNZ M;  3UJN A;  1NSF A;  3J2P B;  3PNV A;  4HL4 A;  1DS2 I;  1L2D A;  1ZAE A;  4CHT B;  3SEK C;  2HKJ A;  2YQP A;  4EDK A;  1N36 M;  4GC9 A;  2Q2E B;  4IJE A;  4OW0 A;  3GQ3 A;  3FYD A;  4QHT A;  3VLF B;  4FCT A;  2KRK A;  3VFD A;  1IN7 A;  3FTD A;  3FYC A;  2OPF A;  2VII A;  5F3W A;  1TH4 A;  4LJ7 A;  2DB6 A;  3PXG A;  4DV2 M;  4DR2 M;  1Y1C A;  3L29 A;  3KSJ A;  2I7N A;  3IG8 A;  1OJL A;  3DOA A;  2KXE A;  4DR4 M;  1LR7 A;  1H0Z A;  4X64 M;  3TL4 X;  3L27 A;  1SGY I;  1X4S A;  3OTO M;  2QQ0 A;  2JA2 A;  1OMU A;  5CCM A;  5E26 A;  4LFC M;  1DGF A;  3GPU A;  2ENZ A;  3SAR A;  2ROW A;  4PD2 A;  1GLN A;  1JR3 D;  3KP0 E;  4GMQ A;  2XF3 A;  4I81 A;  3GP1 A;  2HCB A;  2X8A A;  3AFH A;  2C5R A;  4AKH A;  2Y0T A;  4IIW A;  4YY3 M;  2C98 A;  4EDR A;  3SFZ A;  3UGI A;  3TWL A;  2YNM D;  3CXL A;  4NL4 H;  4LZJ A;  4ZPX A;  5KPT A;  2EA0 A;  3GLH B;  2J87 A;  4GRI A;  3GLF B;  3E4R A;  2KMR A;  2K9H A;  2R4E A;  3U6L A;  1SXJ C;  3GLG A;  4RF1 A;  1L1Z A;  4DR6 M;  4JCV E;  7CAT A;  2CV0 A;  2GKT I;  1N32 M;  2JYY A;  2YQZ A;  3U61 A;  1CT0 I;  2N17 A;  2SGE I;  1K82 A;  1L2C A;  5FTJ A;  4GHA A;  3L28 A;  2V1C C;  3B4V C;  2KCX A;  3CF2 A;  1DS3 I;  3UGJ A;  2QCU A;  2CHG A;  1IY2 A;  1GKI A;  2R65 A;  4MGH A;  1Z5B A;  4G4N A;  2LXE A;  3KFU G;  2RKO A;  2X49 A;  2ERC A;  4FW9 A;  1PCE A;  1R0R I;  2R4J A;  4QNR A;  4AI6 A;  3KOX E;  4L16 A;  5DAE A;  1EE8 A;  2F4V M;  3OXL A;  3EIE A;  4A3V B;  5EX0 A;  3U6O A;  3KY9 A;  1XXH B;  4M9S A;  3SBJ A;  4NXM M;  4LJ8 A;  3I4V A;  3BOS A;  3QAU A;  2H1R A;  3HJ8 A;  2R62 A;  4JI3 M;  4B3M M;  1AN1 I;  1ORY B;  4NSR A;  4WW0 A;  4JYA M;  3LVW A;  1K3X A;  2ZAM A;  5ITQ A;  1LR8 A;  2NU4 I;  1PJI A;  5FSW A;  2UXC M;  4AZF A;  1NJF A;  3CF0 A;  4EIW A;  3U6E A;  4EDG A;  1NVM A;  1QAO A;  4DV5 M;  2J7N A;  2L8E A;  1GL7 A;  3U6Q A;  4NRV A;  3GQ5 A;  2KMQ A;  1HNX M;  4GI3 C;  4KLN A;  1IY5 A;  2XZU A;  1R7R A;  3DFZ A;  1SXJ A;  2A20 A;  3EIH A;  1DGB A;  1E9R A;  3UK6 A;  4GIT A;  3GLI A;  4EE1 A;  3T15 A;  2KA6 B;  3TE6 A;  4D81 A;  3GPX A;  5A2Q S;  3GLF A;  4JI2 M;  3KVW A;  3D8L A;  3OL0 A;  1T6T 1;  4IBG A;  4I4L A;  3KOW E;  2B0U C;  3KOZ E;  4E2K A;  4GH9 A;  3I51 A;  2QZ4 A;  1EQN A;  3RU0 A;  4LF8 M;  1LR9 A;  1X74 A;  3VKG A;  2R18 A;  4LJ6 A;  1CSO I;  3PFI A;  2XLJ A;  1FNN A;  1XC8 A;  2SGP I;  3FC3 A;  3AOE A;  2KZS A;  4MGZ E;  4JI0 M;  1Q3B A;  2NQ8 C;  2GKR I;  4QNM A;  4WUR A;  1TUS A;  1S3S A;  3HWS A;  1FAR A;  5EP1 A;  1N13 A;  1TUR A;  3GRR A;  4CGY B;  5EX3 A;  5JI3 E;  3T1Y M;  1HT1 E;  2WVJ A;  3FTF A;  3SC3 A;  2FFJ A;  3ZCB B;  1XNR M;  4XGI A;  2ERW A;  2KRU A;  1DO0 A;  4EDT A;  1HQY E;  2CE7 A;  3M0E A;  1RFH A;  4IBI A;  1N34 M;  1E94 E;  2JA1 A;  4LF4 M;  3GLG B;  3J81 S;  4ITQ A;  3KS8 A;  3LQQ A;  1TBR R;  1XBT A;  1SXJ D;  4FCV A;  4G6Z A;  4B08 A;  2QQE A;  1W5S A;  3HU2 A;  3TPZ A;  3U61 B;  1BMO A;  2QQD A;  1N78 A;  2O5R A;  5FUW A;  2OD1 A;  3B39 A;  3SAT A;  4GKK M;  1W3S A;  1H6U A;  5KQ8 A;  2RGH A;  1L8Q A;  2N52 A;  3VDP A;  5EXX A;  5C18 A;  3H4M A;  3HU1 A;  5KQD A;  1NJG A;  5FUX A;  1CGJ I;  1SGR I;  4K0K M;  1QAQ A;  4LZZ A;  4OVZ B;  3TWK A;  5EXP A;  4L8R C;  3K8Z A;  1R2Z A;  2UUB M;  2P6A C;  4R3D A;  4MGY E;  3W0F A;  4BBA A;  1R2Y A;  4B3S M;  2SGD I;  5EXT A;  3KS4 A;  2C96 A;  3JR5 A;  4Z8X A;  4IBE A;  1XWI A;  2L7X A;  2F5N A;  3WHL A;  3K1J A;  4B3R M;  5EQT A;  4MM3 B;  3J7A S;  2LEO A;  3J7B A;  2Z3X A;  3FUT A;  5H37 D;  3HH2 C;  4R7G A;  1XMO M;  4QOS A;  2UZ3 A;  3ZC7 B;  8CAT A;  4E1R A;  2CFO A;  4M9X A;  4OVO A;  4W5W A;  2J9R A;  3KXE C;  1KMA A;  4M0D A;  1XMQ M;  5FTM A;  4D80 A;  4DV3 M;  3U5Z A;  3MK6 A;  3VK7 A;  1SXJ B;  4JI4 M;  3SGQ I;  4O6P B;  3LQR A;  2RGO A;  3NWL A;  3GLI B;  1G8P A;  1OMT A;  2ORW A;  2FNF X;  1G4A E;  4GIP A;  4HLQ A;  1Z5C A;  1IM2 A;  1TH2 A;  3E59 A;  2ARP F;  2ODD A;  4NSO B;  3UZU A;  4I8O A;  1IQP A;  3IG5 A;  4DR1 M;  4FWD A;  5KO3 A;  4LJ4 A;  5FLX S;  4LG2 A;  4FWG A;  2GVI A;  2QPO A;  3T38 A;  2FOI C;  2UXB M;  3OVO A;  3W0L B;  5KPZ A;  1QYR A;  4LRS A;  3GOX A;  1YSY A;  4B6D A;  4LF9 M;  1YTP A;  3AOE C;  2L09 A;  4SGB I;  4JI6 M;  5ITX A;  4LGY A;  2DWZ B;  4JV5 M;  1PTR A;  2KMO A;  3HJS A;  4OVZ A;  4MGK E;  4LFA M;  3THG A;  3MEK A;  4DUZ M;  5LMU M;  3L25 A;  1FYB A;  2NU0 I;  5GUJ A;  3TWM A;  3GRU A;  5CCL A;  2NU2 I;  4B7F A;  4II7 A;  2NU3 I;  4L9M A;  1FAQ A;  3KOY E;  2XFT A;  1NUB A;  4LRT A;  4LJ5 A;  4MB7 A;  3AKZ A;  1N75 A;  5E6J A;  2DXI A;  1G59 A;  3L26 A;  2L7H A;  3SAW A;  1J5E M;  1DD9 A;  1DGG A;  3FTC A;  2DZN B;  1KBF A;  4EDV A;  2CHV A;  3WHK A;  2F5P A;  1Y1B A;  4PCZ A;  2XFS A;  2R45 A;  2ZBK B;  3HHW A;  2KW0 A;  3GQ4 A;  1G41 A;  5EP4 A;  4GKJ M;  2VQF M;  5FTN A;  1CT2 I;  2QQC A;  2QP9 X;  4PDG A;  2DZO B;  3HGI A;  1HPT A;  1OFI A;  1YU6 C;  3MHV C;  1TBN A;  2DWL A;  4M0W A;  4XBO A;  3AJI B;  1G3I A;  3A98 B;  1TDZ A;  1DGH A;  1QQW A;  3HU3 A;  2C9C A;  1I4W A;  4AG5 A;  4LF6 M;  1IY6 A;  4IBB A;  2LNH C;  1SGN I;  4B7H A;  2BUS A;  4PT5 A;  4DV6 M;  3PVS A;  1DO2 A;  1UM8 A;  2D7H A;  1GVN A;  2Y20 A;  4P16 A;  4Z6Y A;  2F3C I;  4MH0 E;  3JR4 A;  2AU3 A;  2XGN A;  1Z6T A;  2YUU A;  1YUB A;  4LF7 M;  2Z4S A;  4JI7 M;  4AKG A;  2LUY A;  1IXS B;  2XH9 A;  4NXN M;  4MGI E;  1BUS A;  3DZD A;  1NNU C;  1XX6 A;  1M8B A;  4KHP M;  2KMP A;  1V1H A;  2UUC M;  1NNJ A;  1OYV I;  5C1B A;  3MJ5 A;  4LCB A;  4IBF A;  3U5Z B;  2F5S A;  2JZM A;  2BJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...