3VDPA

Structure and biochemical studies of the recombination mediator protein recr in recfor pathway
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
197
structure length
197
Chain Sequence
YYSTSVAKLIEELSKLPGIGPKTAQRLAFFIINMPLDEVRSLSQAIIEAKEKLRYCKICFNITDKEVCDICSDENRDHSTICVVSHPMDVVAMEKVKEYKGVYHVLHGVISPIEGVGPEDIRIKELLERVRDGSVKEVILATNPDIEGEATAMYIAKLLKPFGVKVTRIAHGIPVGGDLEYTDVVTLSKALEGRREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recombination protein recR
publication title RecOR complex including RecR N-N dimer and RecO monomer displays a high affinity for ssDNA
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Recombination
total genus 59
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
A PF02132 RecR RecR protein
A PF13662 Toprim_4 Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.420 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vdpA01
3.30.60.80 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3vdpA02
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 3vdpA03
4O6PB 4EDRA 5GUJA 1T6T1 4EE1A 1EQNA 4EDTA 3VDPA 1DD9A 2AU3A 3VDUA 2Q2EA 1VDDA 4EDGA 1D3YA 3VE5A 2V1CA 4E2KA 3D00A 2ZBKA 3B39A 1DDEA 4JCVA 4EDKA 4EDVA 4O6OA
chains in the Genus database with same CATH superfamily
1TUSA 2V1UA 1OFHA 5EX3A 3VLFB 1VEGA 1MN3A 3GQ5A 2XFSA 5HQ8A 3D8BA 2XZUA 3E2IA 1SG9A 2WVJA 1M8BA 2XZFA 3SASA 4XGIA 2QP9X 3U5ZA 1XA6A 2DAIA 2WSFF 4DUYM 4LF8M 4LZJA 2MR9A 1VDLA 4RNAA 4R71A 3KSJA 4NXNM 5IZ7D 1XNRM 1IY2A 2LHCA 4MM3B 2RGOA 1PJJA 3LW5F 1F4IA 2I5RA 3NBXX 2BUSA 5BR8M 5E26A 8CATA 3TO6A 2K0BX 3HGIA 1P9GA 2W0TA 2WCYA 3BOSA 7CATA 2J7NA 4NC6A 1G4AE 2QZ4A 4M9XA 4ZPXA 4LFBM 5BPVA 2K9DA 3FTFA 4NXMM 1QAOA 3L28A 2CUZA 1W3SA 2JXDA 2ENNA 2DAGA 2V6ZM 3HJSA 2NU3I 2DI0A 4EE1A 1HQCA 2UZ3A 1VEKA 1J5EM 1LTMA 2E73A 2O25A 1H6UA 3M0EA 4UN2B 3UMMA 4L4UA 4JI7M 2EA0A 3KVWA 2QENA 3GLHA 3B7NA 4LZZA 3LCVB 3KOYE 4DV1M 2KRUA 3R5DA 2KRKA 5KPZA 2SGDI 5L8RF 4G6ZA 2QHOB 5CCMA 1UM8A 4FKDA 3GRRA 3PDNA 4E1PA 4LJ7A 2XLJA 1WIVA 1L2CA 5ITXA 1P9ZA 1WGLA 3KS8A 5KQDA 3QWLA 3U6LA 4GKJM 4D82A 2QPOA 1L2DA 5EJCA 3TO7A 2XEPA 1XXHA 1SGQI 4O6PB 1PJQA 1TURA 4IJFA 4AG5A 2YUUA 1N32M 2SGFI 3RE8A 4MH0E 3B74A 3HX3A 1E32A 1Y1BA 3U60A 2R65A 3SEKC 4RKUF 2ZBKA 1DS2I 2ELIA 3L2AA 4KT0F 2Y0MA 2FS1A 2G5GX 4SGBI 1LV7A 3FUTA 2SGPI 1ZMUA 4M9SA 3A42A 4G3OA 3OXGA 3IG5A 2LH0A 5ITRA 5FUYA 2NU1I 3L27A 4GI3C 3VK7A 2DKLA 3LVVA 4CJ6A 4PD2A 1OVOA 4FD2A 2B3TA 2JWSA 1V1HA 1NJGA 3EIHA 3M6AA 4DV7M 2ERWA 3UOEA 3HY5A 1IN8A 2ZTCA 4XK8F 1IXSB 2G3QA 4DR5M 2KXEA 3W0LB 3K9PA 3GPYA 2L09A 3IECA 4MGYE 1GJSA 3U6EA 1DD9A 2AHMA 4REZA 1DV0A 1GLNA 1KFVA 1E94E 1VG5A 1NY6A 3J7AS 2VIIA 2LB7A 4ITQA 1HT1E 4G4OA 3FSYA 2P6AC 3LCUA 2X49A 3TE6A 1Q9BA 4Z6YA 4KO8A 4FVMA 3TPZA 1KSFX 3FUVA 1NY5A 4ANRA 2CV1A 2CE7A 2OZUA 5JI3E 2ROWA 2ZM6M 3B4VC 1JR3E 1CSOI 4F2LA 2XRCA 5EQTA 2Q2EB 2BWBA 3I4VA 3GPXA 1U5KA 3PXGA 2RRUA 2KMRA 1CUKA 1W4RA 4JN6A 2OU2A 1T43A 4HLQA 2OVOA 1DGHB 2JY6B 3KS4A 3KOZE 2R44A 1PJUA 4CIZA 3K8ZA 4DR7M 3J80S 2JW6A 3PVSA 1CE3A 1R2ZA 4HGUA 3TOAA 1SGEI 3L25A 1TH4A 1YTPA 3H4MA 3QTLD 4EDRA 3F92A 2GQFA 1IXRC 2XH9A 1QAQA 3UGIA 4AZFA 4HEOA 4LRSA 1NUBA 4FWDA 2N17A 3A45A 4DR1M 2X3TA 2KNVA 1QDRA 4JCVA 2A5YB 2KA6B 2KEBA 3V76A 2ARPF 1OKSA 1XX6A 3SGBI 2QQCA 2L4EA 4IBCA 3FD9A 1IY5A 2EO2A 3MHVC 2DAKA 2FH0A 2M5ZA 2Z3XA 3LQRA 3DA1A 3ZCBB 1Q39A 2ORWA 3VKHA 5EXSA 1VQ1A 3FTDA 2CV2A 3A46A 4JI2M 2E5RA 3D00A 1R6BX 2CRUA 2SGEI 3UJNA 3E4RA 1ZAEA 2X52A 5KQ8A 3QYBA 4NRWA 4DBGB 3HJQA 3T1HM 1NVMA 2VRWB 1GABA 2I7NA 1EIJA 1MJAA 2DWNA 2A20A 4GHAA 5C18A 4L8RC 4YY3M 1ZV1A 2MGWA 4EIWA 2GNOA 1IXZA 1N34M 5DNYA 5EP2A 2BJVA 2OO9A 4CGYB 3E21A 4JI1M 4NSOB 2UXDM 1E9SA 4LF9M 1CHOI 3GLFE 2GVIA 2KW0A 4WURA 2N71A 3SAUA 3MMPA 4GRIA 3C3DA 1OMTA 2GKRI 1JQJC 2DZOB 2GKVA 1KBEA 3VE5A 2Y20A 3HKPA 1QVRA 4JI3M 1UVGA 3FYDA 2RGHA 3TOBA 1NV8A 1PRBA 1Y8FA 2L4FA 2O01F 2V53A 4Y28F 2JA2A 3B9PA 4DR2M 2UVOA 3MK6A 2DENA 1YUBA 3GRVA 2ZAMA 4GIPA 1MX0A 2H5XA 2R62A 5JI2E 5FLXS 4DR4M 1Z7KB 5J8FA 1QUTA 3U6MA 2L8EA 1NSFA 4AG6A 2FCJA 2N35A 4GC5A 1NJFA 2C5RA 4L6V6 3FUWA 3J81S 4UXHA 3HJ8A 1SXJE 2KDLA 1XBTA 1BVSA 1Q3CA 3KXEC 5E6JA 2JZ1A 4XBOA 2LTUA 3DZDA 4OW0A 1V34A 4I5SA 1QZMA 2CHVA 4YHHM 2ERCA 2M60A 5ITQA 1IBLM 1OMUA 2DB6A 4LY6A 4AKIA 1P3QQ 2HKJA 2MJ5B 3CF2A 4X65M 1J7KA 1XXHE 1K7VA 4D80A 4UXIA 3HHXA 4AQYM 3HU1A 2ENZA 1K3WA 4LJAA 4DV6M 1IXSA 2VQEM 3D8LA 1IN7A 1IFYA 2OD1A 2J87A 4QNMA 3FE3A 3DFZA 1V1IA 3UK6A 2LEOA 2L2DA 2K6BA 1Q02A 1UUCA 1HEVA 3L29A 4FCTA 4LF7M 1TR8A 4QOSA 5EXTA 3SATA 3KY9A 1DDEA 4NSRA 4EDVA 1CT4I 1AIPC 4I8OA 2UXCM 1OTRA 2MH8A 3FRIA 3AJIB 2F3CI 1HDLA 4LF4M 4GITA 3KSXA 1XWIA 4MGHA 4CHTB 3QWPA 3GRYA 2LUYA 3ZH9B 1JR3D 2WZJA 2FNFX 3GLIE 2R6FA 1W5SA 1MU5A 4OVZB 3OXLA 1R7RA 4PT5A 1OIZA 2AU3A 2Q2EA 2L6OA 1IN6A 4A3VB 1AUAA 1AN1I 1OIPA 4O6OA 2CEAA 5KPTA 4LCBA 1Z5AA 2M5XA 1NHGC 1HNZM 2J5YA 2XF3A 3ILKA 2KNAA 3UEJA 3HU2A 3UZUA 1L8QA 1IY6A 5E3PA 2Y21A 1TBOA 2LHGA 2D7GA 5ITUA 1NV9A 1KYIA 2EJSA 4M0DA 1G3IA 1SGYI 4IBGA 2H1RA 3GPUA 2N52A 2VF8A 3WHLA 3ZC7B 3UGJA 1GJTA 1CT0I 1Z2IA 2DWMA 4JYAM 1DS3I 3NWLA 3GPPA 1TIHA 3SBJA 4DV0M 1IBMM 4B7HA 3K1JA 4AI6A 2C96A 4OU7A 4LG2A 3B7QA 1ORYB 3J2PB 3ZQJA 1Z5CA 1CGII 1HQYE 3AOEA 5J8CA 1GL6A 4RF1A 4WP2A 3MJ5A 2R46A 4GHLA 4LJ9A 2QQ0A 1XC8A 4JCVE 2NQ8C 4IBDA 1WXQA 1R0RI 1K3XA 1D0KA 1EFUB 4LJ8A 3HHZA 2C98A 3VKGA 1SGNI 1TGUA 1WR1B 3GLFB 2DAEA 4G4NA 2CWBA 1L2BA 3NBIA 1XNQM 4B7FA 2KNZA 4L15A 1R79A 2B8TA 4LF5M 1NHWC 3GLGE 3BBZA 4FWHA 3HHYA 4IBIA 4LGYA 4KLNA 5ITYA 1D0LA 2R4JA 3GQ4A 3T6PA 1ULKA 2JUJA 1A5TA 4LJ5A 1UFZA 1WGNA 3SMSA 3FYCA 2RC4A 2CHGA 2QBYB 1HT2E 1N78A 1WJ7A 1IBKM 4GKKM 1N33M 1T3TA 5DAEA 3PNYA 2XFTA 4WP4A 5IT9S 4B7GA 3SMPA 1NNJA 2NU2I 3W0FA 4A24A 1QYRA 3R5CA 2Y0TA 3QAUA 1TF0B 2R45A 2XGNA 2GKTI 1Q3BA 1SXJB 4UXJA 2OOAA 4II7A 3GO8A 2K47A 3KOWE 1N13A 1K82A 2KMOA 3SHFA 5C1BA 5E3RA 4Z8XA 3U61B 1OFIA 1SXJD 1PCEA 3UGDA 3OXFA 4D81A 1XXHB 4R7GA 1BMOA 3HWSA 5GUJA 5EP3A 3U6QA 3BXWA 3KP0E 2F4VM 7WGAA 1DGBA 1QZEA 3K9OA 3KOXE 4P17A 1XHBA 1OAOC 1OQYA 1R5LA 4GH9A 4AKGA 3LQQA 5EX0A 3TL4X 2RIJA 4IBJA 4MB7A 1TTEA 1Z5BA 3AV0A 2ZANA 5EXPA 1E9RA 3HU3A 4FWGA 2LVNC 2JZ0A 4E1RA 4M0WA 2L7HA 1TBQR 1PTQA 1NNUC 5E3QA 1QQWA 4DV5M 3GP1A 1ZMWA 3GLIB 1MJGM 2APLA 2UU9M 1J09A 4B3MM 4MGIE 3UGLA 1EE8A 1JR3A 2XSZD 2B0UC 4I81A 1OYVI 3R5AA 4PCZA 3A98B 2GIVA 5ITTA 2JY5A 3C3EA 3AL0C 3PNVA 4TUWA 2DVWB 4MGKE 2P5TA 2QNJA 4GMQA 1PPFI 2JY8A 3LVWA 2UXBM 3JR4A 4RF0A 1DO0A 2C99A 2HWJA 2G8LA 4B6DA 4CISA 3TQSA 4LFAM 1X37A 4FCWA 3FTEA 2QQEA 2R0IA 3Q8GA 1G41A 1CGJI 1UHAA 4BBAA 1L1TA 3W68A 1FARA 2JZMA 2LVQD 1DO2A 2WSEF 1K7UA 4BB9A 4NL4H 1YE9A 1MJ9A 3RGPA 2CHQA 5KPRA 2NU0I 3SAVA 1DGGA 2O5RA 2I7PA 2YQPA 2CV0A 3GLHE 3E9SA 1W5TA 1IN4A 1XMQM 4LF6M 4E2KA 2EUCA 2UUCM 5FSWA 2QQDA 3TO9A 2CP8A 3FTCA 1HJAI 4IBFA 3CF0A 1QDTA 4GC9A 5ITXE 1D0MA 3SYLA 1XMOM 3GRUA 3Q8XA 1C7YA 1HNXM 2JYYA 4LRTA 3AKZA 1T6T1 1IY0A 2F5NA 2Y0QA 3R9XB 2K9HA 2OQ4A 3T1YM 3VDPA 4WW0A 4OVOA 1TH2A 1VDDA 1V33A 2R18A 1PJSA 1QUSA 3VK8A 2V1CC 5JHWC 4I4LA 3WHKA 2MROB 5CCLA 1T6OA 4JI5M 4OX9M 1N36M 3CF6E 2D7HA 3GLGB 2FFJA 2WGCA 4G4RA 1G8PA 5FTKA 3I04M 3AOEC 3SARA 3OVOA 2LWXA 3KP1E 3GLFA 4G4QA 1OJLA 2HL7A 2LVPC 2YNMD 2CWHA 1TGSI 4LJ4A 3LMMA 4FW9A 2DWZB 3KDSE 1TBRR 1IM2A 1PGYA 3GOXA 1CT2I 4W5WA 2FOIC 3PFIA 1R4GA 2FE8A 3OL0A 3GQ3A 1UVFA 1KBFA 5DFLA 2BJWA 2DNAA 1D2NA 4L78A 1IQPA 2RKOA 3AFHA 1HR0M 2F5OA 2QBYA 1N75A 4PDGA 4QHSA 4B3SM 1WHCA 4DR3M 3QAHA 3IHPA 3TWMA 3U6OA 1GKIA 4JI0M 3FRHA 4JV5M 2LXEA 3UFFA 4NRVA 3R8FA 2CFOA 2DAMA 3OTOM 1DGHA 3SAWA 2JY7A 2R4EA 1SGPI 1SXJA 1D3YA 2KZSA 4F1IA 1YLAA 5H37D 4PDIA 4X62M 1FAQA 1HJPA 3I4YA 3SGQI 4KHPM 3I51A 2DXIA 3H4JA 3U61A 2KMPA 2UUBM 5EXXA 2X8AA 1HNWM 4NOOB 3SHGB 3W67A 3B7ZA 2JP7A 2C9CA 2VDBB 5GKNA 5FTNA 1BUSA 1EQNA 1NO1A 1WKXA 1H0ZA 3TJQA 3RGSA 4IBBA 2QCUA 4DV2M 2V1CA 1ULMA 5LMNM 1ULNA 1IN5A 1PTRA 3SC3A 1ZQ9A 3U5ZB 2KZUA 5FTJA 4LJ6A 3BJIA 5IWAM 4P16A 1IY1A 4DNCA 4GEWA 5FTMA 1C1KA 2QSFX 2HAKA 4IBEA 2L7XA 1TDHA 3TWLA 2LVAA 2YQZA 2YR0A 3DOAA 3SFZA 1IW4A 2NU4I 3L26A 4JI6M 3FKEA 4LGMA 1G71A 2WSCF 2XSZA 1YSYA 3HH2C 2ZTDA 1MT1A 4X66M 2J9RA 3VDUA 2BWEA 3GLIA 1G59A 3U6CA 3KW6A 3U6PA 5EP4A 1TDZA 1DGFA 1S20A 2EKFA 4B3TM 4IJEA 4IIWA 1QAMA 4DV4M 5FUWA 2X4AA 2KCXA 2CWGA 1I4WA 3U6DA 2HCBA 4AKHA 1FJGM 1VEJA 2DIPA 3IG8A 2DKVA 2SGQI 2VF7A 3I01M 2HHHM 1FY7A 2E5LM 3FUXA 4K0KM 1ZMVA 2L7IA 4MPIA 2D7EA 3QYEA 1WTJA 5FUXA 3CTWB 3U6SA 3GLHB 2F5SA 1MJBA 3J27B 3VFDA 2N1AB 3E46A 4JXJA 3CGWA 3B89A 3K2LA 4KODA 1R2YA 3B39A 2Z4SA 4S12A 4DV3M 1M8CA 2CJSC 3J7BA 1Z6TA 5FTLA 4JI4M 1SGDI 3K92A 2VQFM 2OPFA 2CWFA 3THGA 1TBNA 2F5PA 2ORVA 5HI7A 2DZNB 3FC3A 2DWLA 4DUZM 4HL4A 3FUUA 2JXNA 3E59A 4IBKA 1XB2B 1RFHA 3U60B 5DYGA 2ZBKB 4L16A 1L1ZA 4AMLA 2DZLA 3RU0A 4M9ZA 5IREB 1PM5A 1HPTA 1JB0F 3C9PA 4QOZC 1N77A 2PQ8A 4Q7JA 2JA1A 1I94M 1TH3A 1WGCA 1QANA 3T15A 1RU3A 4LFCM 2ODDA 3HHWA 3GLGA 3EIEA 1SGRI 1FNNA 4EDTA 2DHRA 2OOBA 5KO3A 2LBCA 1K7TA 1LR9A 1S3SA 3UEYA 5EP1A 1GVNA 1WGTA 2W82A 3CXLA 2YFQA 4R3DA 1X4SA 2FNAA 1Y8GA 4QHTA 4AW4A 1YU6C 1NXUA 4EDGA 2EKKA 2UUAM 3HZJA 3AOGA 3RFWA 2BNKA 4X64M 1GL7A 4OVZA 4FCVA 2C9OA 4MGZE 5F3WA 1PJIA 1TOTA 2ZAOA 1PJTA 1LR8A 3R5BA 1OAIA 2KHHA 5FUVA 3M7GA 2JNHA 4JI8M 3C58A 2QPAA 2LNHC 2Z4RA 1V92A 2Z7JA 4DR6M 9WGAA 3JR5A 4BLCA 2J7OA 3FSXA 2F5QA 3MEKA 1KMAA 3SYKA 1Z59A 2QQ8A 5DYIA 4B08A 3JAMS 4L9MA 4B3RM 1X74A 2LVOC 2KMQA 1LR7A 3KFUG 5LMUM 1Y1CA 1SXJC 5A2QS 2DHYA 3TWKA 2Z8YM 4QNRA 1FYBA 3T38A 4EDKA 1GO5A
chains in the Genus database with same CATH topology
1TUSA 2V1UA 3TWMA 3NBIA 3U6OA 1GKIA 4JI0M 1XNQM 4JV5M 4B7FA 1OFHA 2LXEA 5EX3A 3DA1A 3UFFA 4NRVA 3ZCBB 3VLFB 3R8FA 2CFOA 1Q39A 3OTOM 2ORWA 1DGHA 4L15A 3GQ5A 1R79A 2B8TA 2XFSA 3SAWA 3VKHA 5HQ8A 5EXSA 3FTDA 4LF5M 1NHWC 3D8BA 2CV2A 2XZUA 2R4EA 4FWHA 1SGPI 3HHYA 1SXJA 3A46A 1D3YA 2KZSA 4IBIA 4JI2M 2E5RA 4LGYA 3D00A 4KLNA 3E2IA 2WVJA 1R6BX 5ITYA 5H37D 4PDIA 2R4JA 4X62M 1M8BA 1FAQA 3GQ4A 2XZFA 3SASA 3I4YA 4XGIA 3UJNA 2SGEI 3E4RA 2QP9X 3U5ZA 1XA6A 1ZAEA 5KQ8A 3SGQI 4KHPM 4NRWA 3I51A 4DUYM 2DXIA 4LJ5A 4LF8M 3SMSA 3U61A 4LZJA 3HJQA 3FYCA 2KMPA 2UUBM 2CHGA 5EXXA 2QBYB 2X8AA 1HT2E 1N78A 3T1HM 4RNAA 1NVMA 3KSJA 4NXNM 5IZ7D 1HNWM 1XNRM 2VRWB 1IBKM 1IY2A 2I7NA 4NOOB 3SHGB 4GKKM 1N33M 1T3TA 4MM3B 2RGOA 1PJJA 5DAEA 2C9CA 3PNYA 2XFTA 2DWNA 2A20A 5IT9S 4GHAA 4B7GA 2BUSA 3SMPA 5C18A 5BR8M 1NNJA 4YY3M 4L8RC 5GKNA 5E26A 3W0FA 2NU2I 4A24A 1QYRA 2Y0TA 3QAUA 5FTNA 8CATA 1BUSA 2R45A 1EQNA 4EIWA 2XGNA 2GKTI 1H0ZA 1Q3BA 3HGIA 3TJQA 1IXZA 1SXJB 3RGSA 1N34M 4UXJA 4IBBA 5EP2A 5DNYA 2BJVA 4II7A 2QCUA 4DV2M 3GO8A 2V1CA 3BOSA 2W0TA 2K47A 2WCYA 5LMNM 4CGYB 1IN5A 7CATA 1PTRA 3SC3A 2J7NA 4JI1M 1ZQ9A 3U5ZB 1G4AE 3KOWE 2KZUA 4NSOB 5FTJA 2UXDM 1N13A 1K82A 1E9SA 4LJ6A 4LF9M 3SHFA 2KMOA 3BJIA 5IWAM 5C1BA 2QZ4A 4M9XA 1IY1A 4P16A 4ZPXA 1CHOI 2GVIA 2KW0A 4Z8XA 3U61B 4LFBM 4WURA 5BPVA 2N71A 3FTFA 1OFIA 4NXMM 1QAOA 1C1KA 5FTMA 4IBEA 3L28A 3SAUA 1SXJD 4GRIA 2CUZA 2L7XA 1TDHA 3TWLA 1PCEA 3UGDA 1OMTA 2YQZA 2GKRI 2YR0A 1JQJC 2DZOB 2GKVA 1KBEA 3VE5A 3OXFA 2Y20A 3DOAA 1W3SA 2JXDA 4D81A 3HKPA 3SFZA 2ENNA 1IW4A 1XXHB 2NU4I 3L26A 4JI6M 1QVRA 2V6ZM 3FKEA 4LGMA 3HJSA 4JI3M 4R7GA 1BMOA 2NU3I 2XSZA 3HWSA 5GUJA 1YSYA 1UVGA 3FYDA 2RGHA 3HH2C 4EE1A 1HQCA 1Y8FA 2UZ3A 1MT1A 4X66M 5EP3A 3U6QA 2V53A 2J9RA 2JA2A 3B9PA 4DR2M 3VDUA 1J5EM 3KP0E 2F4VM 3MK6A 3GLIA 1DGBA 3KOXE 1YUBA 1G59A 3U6CA 1XHBA 2E73A 3GRVA 2ZAMA 4GIPA 3KW6A 1MX0A 4GH9A 3U6PA 4AKGA 3LQQA 2R62A 5JI2E 5FLXS 5EX0A 1H6UA 3M0EA 5EP4A 3UMMA 4L4UA 1TDZA 4JI7M 1DGFA 3TL4X 4DR4M 2EA0A 4B3TM 4IJEA 1Z7KB 3KVWA 4IIWA 2QENA 3GLHA 3U6MA 4IBJA 4MB7A 4LZZA 1Z5BA 2L8EA 3AV0A 2ZANA 3KOYE 5EXPA 1E9RA 3HU3A 1QAMA 4DV1M 2KRUA 4FWGA 1NSFA 4AG6A 4DV4M 5FUWA 2KRKA 4GC5A 1NJFA 2C5RA 4E1RA 3FUWA 5KPZA 2SGDI 2X4AA 3J81S 2KCXA 4G6ZA 4UXHA 5CCMA 1I4WA 3U6DA 1UM8A 4M0WA 4FKDA 3GRRA 3PDNA 2HCBA 2L7HA 3HJ8A 4AKHA 1SXJE 1TBQR 1PTQA 4E1PA 1NNUC 4LJ7A 2XLJA 1L2CA 1QQWA 5ITXA 1XBTA 1Q3CA 1FJGM 2DIPA 3IG8A 2SGQI 3KXEC 4DV5M 3GP1A 5E6JA 3KS8A 5KQDA 4XBOA 2HHHM 3GLIB 3QWLA 2UU9M 1J09A 3DZDA 4OW0A 3U6LA 2E5LM 4B3MM 4GKJM 4D82A 4I5SA 1QZMA 2CHVA 3FUXA 4MGIE 4YHHM 2QPOA 2ERCA 4K0KM 1L2DA 2M60A 2L7IA 3UGLA 1EE8A 5ITQA 2D7EA 1IBLM 5EJCA 1OMUA 2DB6A 4LY6A 1JR3A 2XSZD 2XEPA 2B0UC 4AKIA 5FUXA 3CTWB 3U6SA 1XXHA 3GLHB 4I81A 2F5SA 1SGQI 1TURA 1OYVI 4O6PB 2HKJA 4IJFA 3J27B 4AG5A 3CF2A 4X65M 1N32M 2YUUA 3VFDA 2SGFI 3RE8A 4PCZA 1J7KA 3A98B 5ITTA 2N1AB 4MH0E 4D80A 4UXIA 4JXJA 3AL0C 3HHXA 3PNVA 4TUWA 1E32A 1Y1BA 3K2LA 4KODA 2DVWB 4AQYM 2R65A 3HU1A 3U60A 1R2YA 3SEKC 4MGKE 2P5TA 2ZBKA 3B39A 2ENZA 1DS2I 2Z4SA 4GMQA 4LJAA 1K3WA 4DV6M 1PPFI 2ELIA 4S12A 4DV3M 1M8CA 3L2AA 3LVWA 2VQEM 3D8LA 2UXBM 2CJSC 1IN7A 3JR4A 3J7BA 2OD1A 2J87A 1Z6TA 4QNMA 5FTLA 2G5GX 4SGBI 3DFZA 1LV7A 1V1IA 4RF0A 3UK6A 4JI4M 1DO0A 1SGDI 3K92A 2VQFM 2LEOA 3FUTA 2C99A 2SGPI 2G8LA 2OPFA 1UUCA 4B6DA 3L29A 4FCTA 3THGA 4LF7M 4CISA 4QOSA 3TQSA 5EXTA 4LFAM 3SATA 4M9SA 3A42A 2F5PA 1TBNA 3KY9A 4NSRA 2ORVA 1DDEA 5HI7A 1X37A 4EDVA 4FCWA 3OXGA 3IG5A 3FTEA 2QQEA 2DZNB 2LH0A 5ITRA 3FC3A 2DWLA 1CT4I 4I8OA 2UXCM 5FUYA 1G41A 4DUZM 1CGJI 3L27A 2NU1I 4GI3C 4BBAA 1L1TA 3VK7A 3AJIB 4HL4A 3FUUA 1FARA 3LVVA 2F3CI 1HDLA 4LF4M 4PD2A 4GITA 3E59A 3KSXA 1OVOA 4FD2A 1V1HA 4IBKA 2JZMA 1RFHA 1XWIA 3U60B 1NJGA 4MGHA 4CHTB 5DYGA 3QWPA 3EIHA 3M6AA 2ZBKB 3GRYA 4L16A 4DV7M 1L1ZA 2ERWA 2LUYA 1DO2A 3ZH9B 1IN8A 1JR3D 2FNFX 1IXSB 4BB9A 4DR5M 4NL4H 1YE9A 2KXEA 1W5SA 3RU0A 3W0LB 4M9ZA 3RGPA 5IREB 1PM5A 1MU5A 2CHQA 4OVZB 5KPRA 3GPYA 3OXLA 2NU0I 3SAVA 1R7RA 1DGGA 2L09A 4PT5A 1HPTA 4QOZC 1N77A 2O5RA 2I7PA 4MGYE 3U6EA 2YQPA 1DD9A 2AU3A 2CV0A 2JA1A 2Q2EA 2L6OA 3E9SA 1W5TA 2AHMA 4REZA 1IN6A 4A3VB 1IN4A 1XMQM 1TH3A 1I94M 4LF6M 4E2KA 1QANA 2EUCA 1GLNA 3T15A 1KFVA 2UUCM 1E94E 5FSWA 2QQDA 1AN1I 4LFCM 1NY6A 3J7AS 2ODDA 4O6OA 2VIIA 2CEAA 3FTCA 5KPTA 3HHWA 1HJAI 4IBFA 3GLGA 4ITQA 1HT1E 4LCBA 1Z5AA 4G4OA 2M5XA 2P6AC 3CF0A 2X49A 3EIEA 3TE6A 1SGRI 1FNNA 1NHGC 1HNZM 4EDTA 4GC9A 5ITXE 3SYLA 2DHRA 2XF3A 4Z6YA 3ILKA 4KO8A 4FVMA 3TPZA 5KO3A 3UEJA 1KSFX 3FUVA 3HU2A 1NY5A 3UZUA 1XMOM 3GRUA 1L8QA 1IY6A 3Q8XA 1LR9A 1S3SA 1HNXM 3UEYA 2Y21A 2JYYA 4LRTA 5EP1A 1TBOA 2CV1A 1GVNA 2CE7A 2D7GA 3AKZA 5ITUA 5JI3E 1T6T1 1IY0A 1KYIA 2W82A 2F5NA 2ROWA 2ZM6M 2Y0QA 3R9XB 3B4VC 4M0DA 1CSOI 2K9HA 2XRCA 1G3IA 3CXLA 2YFQA 2OQ4A 4R3DA 5EQTA 2Q2EB 3T1YM 2FNAA 1SGYI 4IBGA 3VDPA 4WW0A 3I4VA 1X4SA 4OVOA 1TH2A 2H1RA 4QHTA 3GPUA 1VDDA 3GPXA 4AW4A 1YU6C 2N52A 1U5KA 3PXGA 3WHLA 2R18A 3ZC7B 2KMRA 4EDGA 3UGJA 3VK8A 1W4RA 2V1CC 1CT0I 2UUAM 5JHWC 4JN6A 3AOGA 4I4LA 3WHKA 2DWMA 5CCLA 3RFWA 4JYAM 1DS3I 3NWLA 3GPPA 2BNKA 4JI5M 1TIHA 4OX9M 1N36M 3CF6E 2D7HA 4X64M 3GLGB 4HLQA 3SBJA 1GL7A 1DGHB 2FFJA 4OVZA 4FCVA 2OVOA 2C9OA 3KS4A 4MGZE 5F3WA 1PJIA 1TOTA 2ZAOA 3KOZE 1LR8A 4G4RA 1PJUA 1G8PA 3K8ZA 4DR7M 3J80S 5FTKA 4DV0M 1IBMM 3PVSA 2JW6A 5FUVA 3AOEC 1CE3A 4B7HA 1R2ZA 3SARA 3OVOA 3K1JA 2LWXA 4AI6A 3KP1E 3M7GA 4JI8M 2C96A 4HGUA 3GLFA 4G4QA 1SGEI 3L25A 1OJLA 1TH4A 2HL7A 2QPAA 4OU7A 2LNHC 3C58A 2Z4RA 2YNMD 4LG2A 3H4MA 1YTPA 2Z7JA 3QTLD 1ORYB 4EDRA 1TGSI 4LJ4A 3LMMA 4DR6M 3J2PB 4FW9A 2DWZB 2XH9A 1IXRC 3KDSE 1QAQA 1IM2A 1TBRR 3UGIA 4AZFA 1Z5CA 3JR5A 4LRSA 4BLCA 1CGII 1HQYE 1NUBA 3AOEA 4FWDA 2N17A 2J7OA 3GOXA 3A45A 1CT2I 1GL6A 4RF1A 4DR1M 2F5QA 3MEKA 1KMAA 4W5WA 3MJ5A 2FOIC 1Z59A 2R46A 3PFIA 3SYKA 2FE8A 4GHLA 4JCVA 2A5YB 3OL0A 4LJ9A 3GQ3A 2KA6B 1UVFA 2QQ0A 1XC8A 2KEBA 1KBFA 5DYIA 4B08A 2BJWA 2ARPF 4JCVE 1D2NA 2NQ8C 3JAMS 4IBDA 4L9MA 4L78A 1XX6A 3SGBI 4B3RM 1WXQA 1IQPA 2RKOA 1R0RI 1X74A 3AFHA 2QQCA 4IBCA 3FD9A 1K3XA 1HR0M 1IY5A 4LJ8A 3HHZA 2EO2A 3MHVC 2C98A 2KMQA 1LR7A 2F5OA 3KFUG 5LMUM 1Y1CA 3VKGA 2QBYA 1SXJC 1TGUA 5A2QS 1SGNI 3TWKA 3GLFB 2M5ZA 1N75A 4QNRA 2Z3XA 1FYBA 3LQRA 3T38A 4PDGA 4QHSA 4G4NA 4EDKA 4B3SM 1L2BA 4DR3M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O6P B;  4EDR A;  5GUJ A;  1T6T 1;  4EE1 A;  1EQN A;  4EDT A;  3VDP A;  1DD9 A;  2AU3 A;  3VDU A;  2Q2E A;  1VDD A;  4EDG A;  1D3Y A;  3VE5 A;  2V1C A;  4E2K A;  3D00 A;  2ZBK A;  3B39 A;  1DDE A;  4JCV A;  4EDK A;  4EDV A;  4O6O A; 
#chains in the Genus database with same CATH topology
 1TUS A;  2V1U A;  1OFH A;  5EX3 A;  3VLF B;  1VEG A;  1MN3 A;  3GQ5 A;  2XFS A;  5HQ8 A;  3D8B A;  2XZU A;  3E2I A;  1SG9 A;  2WVJ A;  1M8B A;  2XZF A;  3SAS A;  4XGI A;  2QP9 X;  3U5Z A;  1XA6 A;  2DAI A;  2WSF F;  4DUY M;  4LF8 M;  4LZJ A;  2MR9 A;  1VDL A;  4RNA A;  4R71 A;  3KSJ A;  4NXN M;  5IZ7 D;  1XNR M;  1IY2 A;  2LHC A;  4MM3 B;  2RGO A;  1PJJ A;  3LW5 F;  1F4I A;  2I5R A;  3NBX X;  2BUS A;  5BR8 M;  5E26 A;  8CAT A;  3TO6 A;  2K0B X;  3HGI A;  1P9G A;  2W0T A;  2WCY A;  3BOS A;  7CAT A;  2J7N A;  4NC6 A;  1G4A E;  2QZ4 A;  4M9X A;  4ZPX A;  4LFB M;  5BPV A;  2K9D A;  3FTF A;  4NXM M;  1QAO A;  3L28 A;  2CUZ A;  1W3S A;  2JXD A;  2ENN A;  2DAG A;  2V6Z M;  3HJS A;  2NU3 I;  2DI0 A;  4EE1 A;  1HQC A;  2UZ3 A;  1VEK A;  1J5E M;  1LTM A;  2E73 A;  2O25 A;  1H6U A;  3M0E A;  4UN2 B;  3UMM A;  4L4U A;  4JI7 M;  2EA0 A;  3KVW A;  2QEN A;  3GLH A;  3B7N A;  4LZZ A;  3LCV B;  3KOY E;  4DV1 M;  2KRU A;  3R5D A;  2KRK A;  5KPZ A;  2SGD I;  5L8R F;  4G6Z A;  2QHO B;  5CCM A;  1UM8 A;  4FKD A;  3GRR A;  3PDN A;  4E1P A;  4LJ7 A;  2XLJ A;  1WIV A;  1L2C A;  5ITX A;  1P9Z A;  1WGL A;  3KS8 A;  5KQD A;  3QWL A;  3U6L A;  4GKJ M;  4D82 A;  2QPO A;  1L2D A;  5EJC A;  3TO7 A;  2XEP A;  1XXH A;  1SGQ I;  4O6P B;  1PJQ A;  1TUR A;  4IJF A;  4AG5 A;  2YUU A;  1N32 M;  2SGF I;  3RE8 A;  4MH0 E;  3B74 A;  3HX3 A;  1E32 A;  1Y1B A;  3U60 A;  2R65 A;  3SEK C;  4RKU F;  2ZBK A;  1DS2 I;  2ELI A;  3L2A A;  4KT0 F;  2Y0M A;  2FS1 A;  2G5G X;  4SGB I;  1LV7 A;  3FUT A;  2SGP I;  1ZMU A;  4M9S A;  3A42 A;  4G3O A;  3OXG A;  3IG5 A;  2LH0 A;  5ITR A;  5FUY A;  2NU1 I;  3L27 A;  4GI3 C;  3VK7 A;  2DKL A;  3LVV A;  4CJ6 A;  4PD2 A;  1OVO A;  4FD2 A;  2B3T A;  2JWS A;  1V1H A;  1NJG A;  3EIH A;  3M6A A;  4DV7 M;  2ERW A;  3UOE A;  3HY5 A;  1IN8 A;  2ZTC A;  4XK8 F;  1IXS B;  2G3Q A;  4DR5 M;  2KXE A;  3W0L B;  3K9P A;  3GPY A;  2L09 A;  3IEC A;  4MGY E;  1GJS A;  3U6E A;  1DD9 A;  2AHM A;  4REZ A;  1DV0 A;  1GLN A;  1KFV A;  1E94 E;  1VG5 A;  1NY6 A;  3J7A S;  2VII A;  2LB7 A;  4ITQ A;  1HT1 E;  4G4O A;  3FSY A;  2P6A C;  3LCU A;  2X49 A;  3TE6 A;  1Q9B A;  4Z6Y A;  4KO8 A;  4FVM A;  3TPZ A;  1KSF X;  3FUV A;  1NY5 A;  4ANR A;  2CV1 A;  2CE7 A;  2OZU A;  5JI3 E;  2ROW A;  2ZM6 M;  3B4V C;  1JR3 E;  1CSO I;  4F2L A;  2XRC A;  5EQT A;  2Q2E B;  2BWB A;  3I4V A;  3GPX A;  1U5K A;  3PXG A;  2RRU A;  2KMR A;  1CUK A;  1W4R A;  4JN6 A;  2OU2 A;  1T43 A;  4HLQ A;  2OVO A;  1DGH B;  2JY6 B;  3KS4 A;  3KOZ E;  2R44 A;  1PJU A;  4CIZ A;  3K8Z A;  4DR7 M;  3J80 S;  2JW6 A;  3PVS A;  1CE3 A;  1R2Z A;  4HGU A;  3TOA A;  1SGE I;  3L25 A;  1TH4 A;  1YTP A;  3H4M A;  3QTL D;  4EDR A;  3F92 A;  2GQF A;  1IXR C;  2XH9 A;  1QAQ A;  3UGI A;  4AZF A;  4HEO A;  4LRS A;  1NUB A;  4FWD A;  2N17 A;  3A45 A;  4DR1 M;  2X3T A;  2KNV A;  1QDR A;  4JCV A;  2A5Y B;  2KA6 B;  2KEB A;  3V76 A;  2ARP F;  1OKS A;  1XX6 A;  3SGB I;  2QQC A;  2L4E A;  4IBC A;  3FD9 A;  1IY5 A;  2EO2 A;  3MHV C;  2DAK A;  2FH0 A;  2M5Z A;  2Z3X A;  3LQR A;  3DA1 A;  3ZCB B;  1Q39 A;  2ORW A;  3VKH A;  5EXS A;  1VQ1 A;  3FTD A;  2CV2 A;  3A46 A;  4JI2 M;  2E5R A;  3D00 A;  1R6B X;  2CRU A;  2SGE I;  3UJN A;  3E4R A;  1ZAE A;  2X52 A;  5KQ8 A;  3QYB A;  4NRW A;  4DBG B;  3HJQ A;  3T1H M;  1NVM A;  2VRW B;  1GAB A;  2I7N A;  1EIJ A;  1MJA A;  2DWN A;  2A20 A;  4GHA A;  5C18 A;  4L8R C;  4YY3 M;  1ZV1 A;  2MGW A;  4EIW A;  2GNO A;  1IXZ A;  1N34 M;  5DNY A;  5EP2 A;  2BJV A;  2OO9 A;  4CGY B;  3E21 A;  4JI1 M;  4NSO B;  2UXD M;  1E9S A;  4LF9 M;  1CHO I;  3GLF E;  2GVI A;  2KW0 A;  4WUR A;  2N71 A;  3SAU A;  3MMP A;  4GRI A;  3C3D A;  1OMT A;  2GKR I;  1JQJ C;  2DZO B;  2GKV A;  1KBE A;  3VE5 A;  2Y20 A;  3HKP A;  1QVR A;  4JI3 M;  1UVG A;  3FYD A;  2RGH A;  3TOB A;  1NV8 A;  1PRB A;  1Y8F A;  2L4F A;  2O01 F;  2V53 A;  4Y28 F;  2JA2 A;  3B9P A;  4DR2 M;  2UVO A;  3MK6 A;  2DEN A;  1YUB A;  3GRV A;  2ZAM A;  4GIP A;  1MX0 A;  2H5X A;  2R62 A;  5JI2 E;  5FLX S;  4DR4 M;  1Z7K B;  5J8F A;  1QUT A;  3U6M A;  2L8E A;  1NSF A;  4AG6 A;  2FCJ A;  2N35 A;  4GC5 A;  1NJF A;  2C5R A;  4L6V 6;  3FUW A;  3J81 S;  4UXH A;  3HJ8 A;  1SXJ E;  2KDL A;  1XBT A;  1BVS A;  1Q3C A;  3KXE C;  5E6J A;  2JZ1 A;  4XBO A;  2LTU A;  3DZD A;  4OW0 A;  1V34 A;  4I5S A;  1QZM A;  2CHV A;  4YHH M;  2ERC A;  2M60 A;  5ITQ A;  1IBL M;  1OMU A;  2DB6 A;  4LY6 A;  4AKI A;  1P3Q Q;  2HKJ A;  2MJ5 B;  3CF2 A;  4X65 M;  1J7K A;  1XXH E;  1K7V A;  4D80 A;  4UXI A;  3HHX A;  4AQY M;  3HU1 A;  2ENZ A;  1K3W A;  4LJA A;  4DV6 M;  1IXS A;  2VQE M;  3D8L A;  1IN7 A;  1IFY A;  2OD1 A;  2J87 A;  4QNM A;  3FE3 A;  3DFZ A;  1V1I A;  3UK6 A;  2LEO A;  2L2D A;  2K6B A;  1Q02 A;  1UUC A;  1HEV A;  3L29 A;  4FCT A;  4LF7 M;  1TR8 A;  4QOS A;  5EXT A;  3SAT A;  3KY9 A;  1DDE A;  4NSR A;  4EDV A;  1CT4 I;  1AIP C;  4I8O A;  2UXC M;  1OTR A;  2MH8 A;  3FRI A;  3AJI B;  2F3C I;  1HDL A;  4LF4 M;  4GIT A;  3KSX A;  1XWI A;  4MGH A;  4CHT B;  3QWP A;  3GRY A;  2LUY A;  3ZH9 B;  1JR3 D;  2WZJ A;  2FNF X;  3GLI E;  2R6F A;  1W5S A;  1MU5 A;  4OVZ B;  3OXL A;  1R7R A;  4PT5 A;  1OIZ A;  2AU3 A;  2Q2E A;  2L6O A;  1IN6 A;  4A3V B;  1AUA A;  1AN1 I;  1OIP A;  4O6O A;  2CEA A;  5KPT A;  4LCB A;  1Z5A A;  2M5X A;  1NHG C;  1HNZ M;  2J5Y A;  2XF3 A;  3ILK A;  2KNA A;  3UEJ A;  3HU2 A;  3UZU A;  1L8Q A;  1IY6 A;  5E3P A;  2Y21 A;  1TBO A;  2LHG A;  2D7G A;  5ITU A;  1NV9 A;  1KYI A;  2EJS A;  4M0D A;  1G3I A;  1SGY I;  4IBG A;  2H1R A;  3GPU A;  2N52 A;  2VF8 A;  3WHL A;  3ZC7 B;  3UGJ A;  1GJT A;  1CT0 I;  1Z2I A;  2DWM A;  4JYA M;  1DS3 I;  3NWL A;  3GPP A;  1TIH A;  3SBJ A;  4DV0 M;  1IBM M;  4B7H A;  3K1J A;  4AI6 A;  2C96 A;  4OU7 A;  4LG2 A;  3B7Q A;  1ORY B;  3J2P B;  3ZQJ A;  1Z5C A;  1CGI I;  1HQY E;  3AOE A;  5J8C A;  1GL6 A;  4RF1 A;  4WP2 A;  3MJ5 A;  2R46 A;  4GHL A;  4LJ9 A;  2QQ0 A;  1XC8 A;  4JCV E;  2NQ8 C;  4IBD A;  1WXQ A;  1R0R I;  1K3X A;  1D0K A;  1EFU B;  4LJ8 A;  3HHZ A;  2C98 A;  3VKG A;  1SGN I;  1TGU A;  1WR1 B;  3GLF B;  2DAE A;  4G4N A;  2CWB A;  1L2B A;  3NBI A;  1XNQ M;  4B7F A;  2KNZ A;  4L15 A;  1R79 A;  2B8T A;  4LF5 M;  1NHW C;  3GLG E;  3BBZ A;  4FWH A;  3HHY A;  4IBI A;  4LGY A;  4KLN A;  5ITY A;  1D0L A;  2R4J A;  3GQ4 A;  3T6P A;  1ULK A;  2JUJ A;  1A5T A;  4LJ5 A;  1UFZ A;  1WGN A;  3SMS A;  3FYC A;  2RC4 A;  2CHG A;  2QBY B;  1HT2 E;  1N78 A;  1WJ7 A;  1IBK M;  4GKK M;  1N33 M;  1T3T A;  5DAE A;  3PNY A;  2XFT A;  4WP4 A;  5IT9 S;  4B7G A;  3SMP A;  1NNJ A;  2NU2 I;  3W0F A;  4A24 A;  1QYR A;  3R5C A;  2Y0T A;  3QAU A;  1TF0 B;  2R45 A;  2XGN A;  2GKT I;  1Q3B A;  1SXJ B;  4UXJ A;  2OOA A;  4II7 A;  3GO8 A;  2K47 A;  3KOW E;  1N13 A;  1K82 A;  2KMO A;  3SHF A;  5C1B A;  5E3R A;  4Z8X A;  3U61 B;  1OFI A;  1SXJ D;  1PCE A;  3UGD A;  3OXF A;  4D81 A;  1XXH B;  4R7G A;  1BMO A;  3HWS A;  5GUJ A;  5EP3 A;  3U6Q A;  3BXW A;  3KP0 E;  2F4V M;  7WGA A;  1DGB A;  1QZE A;  3K9O A;  3KOX E;  4P17 A;  1XHB A;  1OAO C;  1OQY A;  1R5L A;  4GH9 A;  4AKG A;  3LQQ A;  5EX0 A;  3TL4 X;  2RIJ A;  4IBJ A;  4MB7 A;  1TTE A;  1Z5B A;  3AV0 A;  2ZAN A;  5EXP A;  1E9R A;  3HU3 A;  4FWG A;  2LVN C;  2JZ0 A;  4E1R A;  4M0W A;  2L7H A;  1TBQ R;  1PTQ A;  1NNU C;  5E3Q A;  1QQW A;  4DV5 M;  3GP1 A;  1ZMW A;  3GLI B;  1MJG M;  2APL A;  2UU9 M;  1J09 A;  4B3M M;  4MGI E;  3UGL A;  1EE8 A;  1JR3 A;  2XSZ D;  2B0U C;  4I81 A;  1OYV I;  3R5A A;  4PCZ A;  3A98 B;  2GIV A;  5ITT A;  2JY5 A;  3C3E A;  3AL0 C;  3PNV A;  4TUW A;  2DVW B;  4MGK E;  2P5T A;  2QNJ A;  4GMQ A;  1PPF I;  2JY8 A;  3LVW A;  2UXB M;  3JR4 A;  4RF0 A;  1DO0 A;  2C99 A;  2HWJ A;  2G8L A;  4B6D A;  4CIS A;  3TQS A;  4LFA M;  1X37 A;  4FCW A;  3FTE A;  2QQE A;  2R0I A;  3Q8G A;  1G41 A;  1CGJ I;  1UHA A;  4BBA A;  1L1T A;  3W68 A;  1FAR A;  2JZM A;  2LVQ D;  1DO2 A;  2WSE F;  1K7U A;  4BB9 A;  4NL4 H;  1YE9 A;  1MJ9 A;  3RGP A;  2CHQ A;  5KPR A;  2NU0 I;  3SAV A;  1DGG A;  2O5R A;  2I7P A;  2YQP A;  2CV0 A;  3GLH E;  3E9S A;  1W5T A;  1IN4 A;  1XMQ M;  4LF6 M;  4E2K A;  2EUC A;  2UUC M;  5FSW A;  2QQD A;  3TO9 A;  2CP8 A;  3FTC A;  1HJA I;  4IBF A;  3CF0 A;  1QDT A;  4GC9 A;  5ITX E;  1D0M A;  3SYL A;  1XMO M;  3GRU A;  3Q8X A;  1C7Y A;  1HNX M;  2JYY A;  4LRT A;  3AKZ A;  1T6T 1;  1IY0 A;  2F5N A;  2Y0Q A;  3R9X B;  2K9H A;  2OQ4 A;  3T1Y M;  3VDP A;  4WW0 A;  4OVO A;  1TH2 A;  1VDD A;  1V33 A;  2R18 A;  1PJS A;  1QUS A;  3VK8 A;  2V1C C;  5JHW C;  4I4L A;  3WHK A;  2MRO B;  5CCL A;  1T6O A;  4JI5 M;  4OX9 M;  1N36 M;  3CF6 E;  2D7H A;  3GLG B;  2FFJ A;  2WGC A;  4G4R A;  1G8P A;  5FTK A;  3I04 M;  3AOE C;  3SAR A;  3OVO A;  2LWX A;  3KP1 E;  3GLF A;  4G4Q A;  1OJL A;  2HL7 A;  2LVP C;  2YNM D;  2CWH A;  1TGS I;  4LJ4 A;  3LMM A;  4FW9 A;  2DWZ B;  3KDS E;  1TBR R;  1IM2 A;  1PGY A;  3GOX A;  1CT2 I;  4W5W A;  2FOI C;  3PFI A;  1R4G A;  2FE8 A;  3OL0 A;  3GQ3 A;  1UVF A;  1KBF A;  5DFL A;  2BJW A;  2DNA A;  1D2N A;  4L78 A;  1IQP A;  2RKO A;  3AFH A;  1HR0 M;  2F5O A;  2QBY A;  1N75 A;  4PDG A;  4QHS A;  4B3S M;  1WHC A;  4DR3 M;  3QAH A;  3IHP A;  3TWM A;  3U6O A;  1GKI A;  4JI0 M;  3FRH A;  4JV5 M;  2LXE A;  3UFF A;  4NRV A;  3R8F A;  2CFO A;  2DAM A;  3OTO M;  1DGH A;  3SAW A;  2JY7 A;  2R4E A;  1SGP I;  1SXJ A;  1D3Y A;  2KZS A;  4F1I A;  1YLA A;  5H37 D;  4PDI A;  4X62 M;  1FAQ A;  1HJP A;  3I4Y A;  3SGQ I;  4KHP M;  3I51 A;  2DXI A;  3H4J A;  3U61 A;  2KMP A;  2UUB M;  5EXX A;  2X8A A;  1HNW M;  4NOO B;  3SHG B;  3W67 A;  3B7Z A;  2JP7 A;  2C9C A;  2VDB B;  5GKN A;  5FTN A;  1BUS A;  1EQN A;  1NO1 A;  1WKX A;  1H0Z A;  3TJQ A;  3RGS A;  4IBB A;  2QCU A;  4DV2 M;  2V1C A;  1ULM A;  5LMN M;  1ULN A;  1IN5 A;  1PTR A;  3SC3 A;  1ZQ9 A;  3U5Z B;  2KZU A;  5FTJ A;  4LJ6 A;  3BJI A;  5IWA M;  4P16 A;  1IY1 A;  4DNC A;  4GEW A;  5FTM A;  1C1K A;  2QSF X;  2HAK A;  4IBE A;  2L7X A;  1TDH A;  3TWL A;  2LVA A;  2YQZ A;  2YR0 A;  3DOA A;  3SFZ A;  1IW4 A;  2NU4 I;  3L26 A;  4JI6 M;  3FKE A;  4LGM A;  1G71 A;  2WSC F;  2XSZ A;  1YSY A;  3HH2 C;  2ZTD A;  1MT1 A;  4X66 M;  2J9R A;  3VDU A;  2BWE A;  3GLI A;  1G59 A;  3U6C A;  3KW6 A;  3U6P A;  5EP4 A;  1TDZ A;  1DGF A;  1S20 A;  2EKF A;  4B3T M;  4IJE A;  4IIW A;  1QAM A;  4DV4 M;  5FUW A;  2X4A A;  2KCX A;  2CWG A;  1I4W A;  3U6D A;  2HCB A;  4AKH A;  1FJG M;  1VEJ A;  2DIP A;  3IG8 A;  2DKV A;  2SGQ I;  2VF7 A;  3I01 M;  2HHH M;  1FY7 A;  2E5L M;  3FUX A;  4K0K M;  1ZMV A;  2L7I A;  4MPI A;  2D7E A;  3QYE A;  1WTJ A;  5FUX A;  3CTW B;  3U6S A;  3GLH B;  2F5S A;  1MJB A;  3J27 B;  3VFD A;  2N1A B;  3E46 A;  4JXJ A;  3CGW A;  3B89 A;  3K2L A;  4KOD A;  1R2Y A;  3B39 A;  2Z4S A;  4S12 A;  4DV3 M;  1M8C A;  2CJS C;  3J7B A;  1Z6T A;  5FTL A;  4JI4 M;  1SGD I;  3K92 A;  2VQF M;  2OPF A;  2CWF A;  3THG A;  1TBN A;  2F5P A;  2ORV A;  5HI7 A;  2DZN B;  3FC3 A;  2DWL A;  4DUZ M;  4HL4 A;  3FUU A;  2JXN A;  3E59 A;  4IBK A;  1XB2 B;  1RFH A;  3U60 B;  5DYG A;  2ZBK B;  4L16 A;  1L1Z A;  4AML A;  2DZL A;  3RU0 A;  4M9Z A;  5IRE B;  1PM5 A;  1HPT A;  1JB0 F;  3C9P A;  4QOZ C;  1N77 A;  2PQ8 A;  4Q7J A;  2JA1 A;  1I94 M;  1TH3 A;  1WGC A;  1QAN A;  3T15 A;  1RU3 A;  4LFC M;  2ODD A;  3HHW A;  3GLG A;  3EIE A;  1SGR I;  1FNN A;  4EDT A;  2DHR A;  2OOB A;  5KO3 A;  2LBC A;  1K7T A;  1LR9 A;  1S3S A;  3UEY A;  5EP1 A;  1GVN A;  1WGT A;  2W82 A;  3CXL A;  2YFQ A;  4R3D A;  1X4S A;  2FNA A;  1Y8G A;  4QHT A;  4AW4 A;  1YU6 C;  1NXU A;  4EDG A;  2EKK A;  2UUA M;  3HZJ A;  3AOG A;  3RFW A;  2BNK A;  4X64 M;  1GL7 A;  4OVZ A;  4FCV A;  2C9O A;  4MGZ E;  5F3W A;  1PJI A;  1TOT A;  2ZAO A;  1PJT A;  1LR8 A;  3R5B A;  1OAI A;  2KHH A;  5FUV A;  3M7G A;  2JNH A;  4JI8 M;  3C58 A;  2QPA A;  2LNH C;  2Z4R A;  1V92 A;  2Z7J A;  4DR6 M;  9WGA A;  3JR5 A;  4BLC A;  2J7O A;  3FSX A;  2F5Q A;  3MEK A;  1KMA A;  3SYK A;  1Z59 A;  2QQ8 A;  5DYI A;  4B08 A;  3JAM S;  4L9M A;  4B3R M;  1X74 A;  2LVO C;  2KMQ A;  1LR7 A;  3KFU G;  5LMU M;  1Y1C A;  1SXJ C;  5A2Q S;  2DHY A;  3TWK A;  2Z8Y M;  4QNR A;  1FYB A;  3T38 A;  4EDK A;  1GO5 A; 
#chains in the Genus database with same CATH homology
 1TUS A;  2V1U A;  3TWM A;  3NBI A;  3U6O A;  1GKI A;  4JI0 M;  1XNQ M;  4JV5 M;  4B7F A;  1OFH A;  2LXE A;  5EX3 A;  3DA1 A;  3UFF A;  4NRV A;  3ZCB B;  3VLF B;  3R8F A;  2CFO A;  1Q39 A;  3OTO M;  2ORW A;  1DGH A;  4L15 A;  3GQ5 A;  1R79 A;  2B8T A;  2XFS A;  3SAW A;  3VKH A;  5HQ8 A;  5EXS A;  3FTD A;  4LF5 M;  1NHW C;  3D8B A;  2CV2 A;  2XZU A;  2R4E A;  4FWH A;  1SGP I;  3HHY A;  1SXJ A;  3A46 A;  1D3Y A;  2KZS A;  4IBI A;  4JI2 M;  2E5R A;  4LGY A;  3D00 A;  4KLN A;  3E2I A;  2WVJ A;  1R6B X;  5ITY A;  5H37 D;  4PDI A;  2R4J A;  4X62 M;  1M8B A;  1FAQ A;  3GQ4 A;  2XZF A;  3SAS A;  3I4Y A;  4XGI A;  3UJN A;  2SGE I;  3E4R A;  2QP9 X;  3U5Z A;  1XA6 A;  1ZAE A;  5KQ8 A;  3SGQ I;  4KHP M;  4NRW A;  3I51 A;  4DUY M;  2DXI A;  4LJ5 A;  4LF8 M;  3SMS A;  3U61 A;  4LZJ A;  3HJQ A;  3FYC A;  2KMP A;  2UUB M;  2CHG A;  5EXX A;  2QBY B;  2X8A A;  1HT2 E;  1N78 A;  3T1H M;  4RNA A;  1NVM A;  3KSJ A;  4NXN M;  5IZ7 D;  1HNW M;  1XNR M;  2VRW B;  1IBK M;  1IY2 A;  2I7N A;  4NOO B;  3SHG B;  4GKK M;  1N33 M;  1T3T A;  4MM3 B;  2RGO A;  1PJJ A;  5DAE A;  2C9C A;  3PNY A;  2XFT A;  2DWN A;  2A20 A;  5IT9 S;  4GHA A;  4B7G A;  2BUS A;  3SMP A;  5C18 A;  5BR8 M;  1NNJ A;  4YY3 M;  4L8R C;  5GKN A;  5E26 A;  3W0F A;  2NU2 I;  4A24 A;  1QYR A;  2Y0T A;  3QAU A;  5FTN A;  8CAT A;  1BUS A;  2R45 A;  1EQN A;  4EIW A;  2XGN A;  2GKT I;  1H0Z A;  1Q3B A;  3HGI A;  3TJQ A;  1IXZ A;  1SXJ B;  3RGS A;  1N34 M;  4UXJ A;  4IBB A;  5EP2 A;  5DNY A;  2BJV A;  4II7 A;  2QCU A;  4DV2 M;  3GO8 A;  2V1C A;  3BOS A;  2W0T A;  2K47 A;  2WCY A;  5LMN M;  4CGY B;  1IN5 A;  7CAT A;  1PTR A;  3SC3 A;  2J7N A;  4JI1 M;  1ZQ9 A;  3U5Z B;  1G4A E;  3KOW E;  2KZU A;  4NSO B;  5FTJ A;  2UXD M;  1N13 A;  1K82 A;  1E9S A;  4LJ6 A;  4LF9 M;  3SHF A;  2KMO A;  3BJI A;  5IWA M;  5C1B A;  2QZ4 A;  4M9X A;  1IY1 A;  4P16 A;  4ZPX A;  1CHO I;  2GVI A;  2KW0 A;  4Z8X A;  3U61 B;  4LFB M;  4WUR A;  5BPV A;  2N71 A;  3FTF A;  1OFI A;  4NXM M;  1QAO A;  1C1K A;  5FTM A;  4IBE A;  3L28 A;  3SAU A;  1SXJ D;  4GRI A;  2CUZ A;  2L7X A;  1TDH A;  3TWL A;  1PCE A;  3UGD A;  1OMT A;  2YQZ A;  2GKR I;  2YR0 A;  1JQJ C;  2DZO B;  2GKV A;  1KBE A;  3VE5 A;  3OXF A;  2Y20 A;  3DOA A;  1W3S A;  2JXD A;  4D81 A;  3HKP A;  3SFZ A;  2ENN A;  1IW4 A;  1XXH B;  2NU4 I;  3L26 A;  4JI6 M;  1QVR A;  2V6Z M;  3FKE A;  4LGM A;  3HJS A;  4JI3 M;  4R7G A;  1BMO A;  2NU3 I;  2XSZ A;  3HWS A;  5GUJ A;  1YSY A;  1UVG A;  3FYD A;  2RGH A;  3HH2 C;  4EE1 A;  1HQC A;  1Y8F A;  2UZ3 A;  1MT1 A;  4X66 M;  5EP3 A;  3U6Q A;  2V53 A;  2J9R A;  2JA2 A;  3B9P A;  4DR2 M;  3VDU A;  1J5E M;  3KP0 E;  2F4V M;  3MK6 A;  3GLI A;  1DGB A;  3KOX E;  1YUB A;  1G59 A;  3U6C A;  1XHB A;  2E73 A;  3GRV A;  2ZAM A;  4GIP A;  3KW6 A;  1MX0 A;  4GH9 A;  3U6P A;  4AKG A;  3LQQ A;  2R62 A;  5JI2 E;  5FLX S;  5EX0 A;  1H6U A;  3M0E A;  5EP4 A;  3UMM A;  4L4U A;  1TDZ A;  4JI7 M;  1DGF A;  3TL4 X;  4DR4 M;  2EA0 A;  4B3T M;  4IJE A;  1Z7K B;  3KVW A;  4IIW A;  2QEN A;  3GLH A;  3U6M A;  4IBJ A;  4MB7 A;  4LZZ A;  1Z5B A;  2L8E A;  3AV0 A;  2ZAN A;  3KOY E;  5EXP A;  1E9R A;  3HU3 A;  1QAM A;  4DV1 M;  2KRU A;  4FWG A;  1NSF A;  4AG6 A;  4DV4 M;  5FUW A;  2KRK A;  4GC5 A;  1NJF A;  2C5R A;  4E1R A;  3FUW A;  5KPZ A;  2SGD I;  2X4A A;  3J81 S;  2KCX A;  4G6Z A;  4UXH A;  5CCM A;  1I4W A;  3U6D A;  1UM8 A;  4M0W A;  4FKD A;  3GRR A;  3PDN A;  2HCB A;  2L7H A;  3HJ8 A;  4AKH A;  1SXJ E;  1TBQ R;  1PTQ A;  4E1P A;  1NNU C;  4LJ7 A;  2XLJ A;  1L2C A;  1QQW A;  5ITX A;  1XBT A;  1Q3C A;  1FJG M;  2DIP A;  3IG8 A;  2SGQ I;  3KXE C;  4DV5 M;  3GP1 A;  5E6J A;  3KS8 A;  5KQD A;  4XBO A;  2HHH M;  3GLI B;  3QWL A;  2UU9 M;  1J09 A;  3DZD A;  4OW0 A;  3U6L A;  2E5L M;  4B3M M;  4GKJ M;  4D82 A;  4I5S A;  1QZM A;  2CHV A;  3FUX A;  4MGI E;  4YHH M;  2QPO A;  2ERC A;  4K0K M;  1L2D A;  2M60 A;  2L7I A;  3UGL A;  1EE8 A;  5ITQ A;  2D7E A;  1IBL M;  5EJC A;  1OMU A;  2DB6 A;  4LY6 A;  1JR3 A;  2XSZ D;  2XEP A;  2B0U C;  4AKI A;  5FUX A;  3CTW B;  3U6S A;  1XXH A;  3GLH B;  4I81 A;  2F5S A;  1SGQ I;  1TUR A;  1OYV I;  4O6P B;  2HKJ A;  4IJF A;  3J27 B;  4AG5 A;  3CF2 A;  4X65 M;  1N32 M;  2YUU A;  3VFD A;  2SGF I;  3RE8 A;  4PCZ A;  1J7K A;  3A98 B;  5ITT A;  2N1A B;  4MH0 E;  4D80 A;  4UXI A;  4JXJ A;  3AL0 C;  3HHX A;  3PNV A;  4TUW A;  1E32 A;  1Y1B A;  3K2L A;  4KOD A;  2DVW B;  4AQY M;  2R65 A;  3HU1 A;  3U60 A;  1R2Y A;  3SEK C;  4MGK E;  2P5T A;  2ZBK A;  3B39 A;  2ENZ A;  1DS2 I;  2Z4S A;  4GMQ A;  4LJA A;  1K3W A;  4DV6 M;  1PPF I;  2ELI A;  4S12 A;  4DV3 M;  1M8C A;  3L2A A;  3LVW A;  2VQE M;  3D8L A;  2UXB M;  2CJS C;  1IN7 A;  3JR4 A;  3J7B A;  2OD1 A;  2J87 A;  1Z6T A;  4QNM A;  5FTL A;  2G5G X;  4SGB I;  3DFZ A;  1LV7 A;  1V1I A;  4RF0 A;  3UK6 A;  4JI4 M;  1DO0 A;  1SGD I;  3K92 A;  2VQF M;  2LEO A;  3FUT A;  2C99 A;  2SGP I;  2G8L A;  2OPF A;  1UUC A;  4B6D A;  3L29 A;  4FCT A;  3THG A;  4LF7 M;  4CIS A;  4QOS A;  3TQS A;  5EXT A;  4LFA M;  3SAT A;  4M9S A;  3A42 A;  2F5P A;  1TBN A;  3KY9 A;  4NSR A;  2ORV A;  1DDE A;  5HI7 A;  1X37 A;  4EDV A;  4FCW A;  3OXG A;  3IG5 A;  3FTE A;  2QQE A;  2DZN B;  2LH0 A;  5ITR A;  3FC3 A;  2DWL A;  1CT4 I;  4I8O A;  2UXC M;  5FUY A;  1G41 A;  4DUZ M;  1CGJ I;  3L27 A;  2NU1 I;  4GI3 C;  4BBA A;  1L1T A;  3VK7 A;  3AJI B;  4HL4 A;  3FUU A;  1FAR A;  3LVV A;  2F3C I;  1HDL A;  4LF4 M;  4PD2 A;  4GIT A;  3E59 A;  3KSX A;  1OVO A;  4FD2 A;  1V1H A;  4IBK A;  2JZM A;  1RFH A;  1XWI A;  3U60 B;  1NJG A;  4MGH A;  4CHT B;  5DYG A;  3QWP A;  3EIH A;  3M6A A;  2ZBK B;  3GRY A;  4L16 A;  4DV7 M;  1L1Z A;  2ERW A;  2LUY A;  1DO2 A;  3ZH9 B;  1IN8 A;  1JR3 D;  2FNF X;  1IXS B;  4BB9 A;  4DR5 M;  4NL4 H;  1YE9 A;  2KXE A;  1W5S A;  3RU0 A;  3W0L B;  4M9Z A;  3RGP A;  5IRE B;  1PM5 A;  1MU5 A;  2CHQ A;  4OVZ B;  5KPR A;  3GPY A;  3OXL A;  2NU0 I;  3SAV A;  1R7R A;  1DGG A;  2L09 A;  4PT5 A;  1HPT A;  4QOZ C;  1N77 A;  2O5R A;  2I7P A;  4MGY E;  3U6E A;  2YQP A;  1DD9 A;  2AU3 A;  2CV0 A;  2JA1 A;  2Q2E A;  2L6O A;  3E9S A;  1W5T A;  2AHM A;  4REZ A;  1IN6 A;  4A3V B;  1IN4 A;  1XMQ M;  1TH3 A;  1I94 M;  4LF6 M;  4E2K A;  1QAN A;  2EUC A;  1GLN A;  3T15 A;  1KFV A;  2UUC M;  1E94 E;  5FSW A;  2QQD A;  1AN1 I;  4LFC M;  1NY6 A;  3J7A S;  2ODD A;  4O6O A;  2VII A;  2CEA A;  3FTC A;  5KPT A;  3HHW A;  1HJA I;  4IBF A;  3GLG A;  4ITQ A;  1HT1 E;  4LCB A;  1Z5A A;  4G4O A;  2M5X A;  2P6A C;  3CF0 A;  2X49 A;  3EIE A;  3TE6 A;  1SGR I;  1FNN A;  1NHG C;  1HNZ M;  4EDT A;  4GC9 A;  5ITX E;  3SYL A;  2DHR A;  2XF3 A;  4Z6Y A;  3ILK A;  4KO8 A;  4FVM A;  3TPZ A;  5KO3 A;  3UEJ A;  1KSF X;  3FUV A;  3HU2 A;  1NY5 A;  3UZU A;  1XMO M;  3GRU A;  1L8Q A;  1IY6 A;  3Q8X A;  1LR9 A;  1S3S A;  1HNX M;  3UEY A;  2Y21 A;  2JYY A;  4LRT A;  5EP1 A;  1TBO A;  2CV1 A;  1GVN A;  2CE7 A;  2D7G A;  3AKZ A;  5ITU A;  5JI3 E;  1T6T 1;  1IY0 A;  1KYI A;  2W82 A;  2F5N A;  2ROW A;  2ZM6 M;  2Y0Q A;  3R9X B;  3B4V C;  4M0D A;  1CSO I;  2K9H A;  2XRC A;  1G3I A;  3CXL A;  2YFQ A;  2OQ4 A;  4R3D A;  5EQT A;  2Q2E B;  3T1Y M;  2FNA A;  1SGY I;  4IBG A;  3VDP A;  4WW0 A;  3I4V A;  1X4S A;  4OVO A;  1TH2 A;  2H1R A;  4QHT A;  3GPU A;  1VDD A;  3GPX A;  4AW4 A;  1YU6 C;  2N52 A;  1U5K A;  3PXG A;  3WHL A;  2R18 A;  3ZC7 B;  2KMR A;  4EDG A;  3UGJ A;  3VK8 A;  1W4R A;  2V1C C;  1CT0 I;  2UUA M;  5JHW C;  4JN6 A;  3AOG A;  4I4L A;  3WHK A;  2DWM A;  5CCL A;  3RFW A;  4JYA M;  1DS3 I;  3NWL A;  3GPP A;  2BNK A;  4JI5 M;  1TIH A;  4OX9 M;  1N36 M;  3CF6 E;  2D7H A;  4X64 M;  3GLG B;  4HLQ A;  3SBJ A;  1GL7 A;  1DGH B;  2FFJ A;  4OVZ A;  4FCV A;  2OVO A;  2C9O A;  3KS4 A;  4MGZ E;  5F3W A;  1PJI A;  1TOT A;  2ZAO A;  3KOZ E;  1LR8 A;  4G4R A;  1PJU A;  1G8P A;  3K8Z A;  4DR7 M;  3J80 S;  5FTK A;  4DV0 M;  1IBM M;  3PVS A;  2JW6 A;  5FUV A;  3AOE C;  1CE3 A;  4B7H A;  1R2Z A;  3SAR A;  3OVO A;  3K1J A;  2LWX A;  4AI6 A;  3KP1 E;  3M7G A;  4JI8 M;  2C96 A;  4HGU A;  3GLF A;  4G4Q A;  1SGE I;  3L25 A;  1OJL A;  1TH4 A;  2HL7 A;  2QPA A;  4OU7 A;  2LNH C;  3C58 A;  2Z4R A;  2YNM D;  4LG2 A;  3H4M A;  1YTP A;  2Z7J A;  3QTL D;  1ORY B;  4EDR A;  1TGS I;  4LJ4 A;  3LMM A;  4DR6 M;  3J2P B;  4FW9 A;  2DWZ B;  2XH9 A;  1IXR C;  3KDS E;  1QAQ A;  1IM2 A;  1TBR R;  3UGI A;  4AZF A;  1Z5C A;  3JR5 A;  4LRS A;  4BLC A;  1CGI I;  1HQY E;  1NUB A;  3AOE A;  4FWD A;  2N17 A;  2J7O A;  3GOX A;  3A45 A;  1CT2 I;  1GL6 A;  4RF1 A;  4DR1 M;  2F5Q A;  3MEK A;  1KMA A;  4W5W A;  3MJ5 A;  2FOI C;  1Z59 A;  2R46 A;  3PFI A;  3SYK A;  2FE8 A;  4GHL A;  4JCV A;  2A5Y B;  3OL0 A;  4LJ9 A;  3GQ3 A;  2KA6 B;  1UVF A;  2QQ0 A;  1XC8 A;  2KEB A;  1KBF A;  5DYI A;  4B08 A;  2BJW A;  2ARP F;  4JCV E;  1D2N A;  2NQ8 C;  3JAM S;  4IBD A;  4L9M A;  4L78 A;  1XX6 A;  3SGB I;  4B3R M;  1WXQ A;  1IQP A;  2RKO A;  1R0R I;  1X74 A;  3AFH A;  2QQC A;  4IBC A;  3FD9 A;  1K3X A;  1HR0 M;  1IY5 A;  4LJ8 A;  3HHZ A;  2EO2 A;  3MHV C;  2C98 A;  2KMQ A;  1LR7 A;  2F5O A;  3KFU G;  5LMU M;  1Y1C A;  3VKG A;  2QBY A;  1SXJ C;  1TGU A;  5A2Q S;  1SGN I;  3TWK A;  3GLF B;  2M5Z A;  1N75 A;  4QNR A;  2Z3X A;  1FYB A;  3LQR A;  3T38 A;  4PDG A;  4QHS A;  4G4N A;  4EDK A;  4B3S M;  1L2B A;  4DR3 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...