1CR8A

Low density lipoprotein receptor-related protein complement repeat 8
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
42
structure length
42
Chain Sequence
PGGCHTDEFQCRLDGLCIPLRWRCDGDTDCMDSSDEKSCEGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords PROTEIN (LOW DENSITY LIPOPROTEIN RECEPTOR RELATED PROTEIN)
publication title NMR solution structure of complement-like repeat CR8 from the low density lipoprotein receptor-related protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 1998-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 1cr8A00
1XFEA 2FYLB 1CR8A 2FCWB 1D2LA 2KNYA 1JRFA 1N7DA 1J8EA 2FYJA 1K7BA 1F5YA 1LDRA 1LDLA 2M0PA 2I1PA 2M7PA 2LGPA 2JM4A 1D2JA 2KNXA 2M96A
chains in the Genus database with same CATH superfamily
1XFEA 2FYLB 1CR8A 2FCWB 1D2LA 2KNYA 1JRFA 1N7DA 1J8EA 2FYJA 1K7BA 1F5YA 1LDRA 1LDLA 2M0PA 2I1PA 2M7PA 2LGPA 2JM4A 1D2JA 2KNXA 2M96A
chains in the Genus database with same CATH topology
1XFEA 2FYLB 1CR8A 2FCWB 1D2LA 2KNYA 1JRFA 1N7DA 1J8EA 2FYJA 1K7BA 1F5YA 1LDRA 1LDLA 2M0PA 2I1PA 2M7PA 2LGPA 2JM4A 1D2JA 2KNXA 2M96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFE A;  2FYL B;  1CR8 A;  2FCW B;  1D2L A;  2KNY A;  1JRF A;  1N7D A;  1J8E A;  2FYJ A;  1K7B A;  1F5Y A;  1LDR A;  1LDL A;  2M0P A;  2I1P A;  2M7P A;  2LGP A;  2JM4 A;  1D2J A;  2KNX A;  2M96 A; 
#chains in the Genus database with same CATH topology
 1XFE A;  2FYL B;  1CR8 A;  2FCW B;  1D2L A;  2KNY A;  1JRF A;  1N7D A;  1J8E A;  2FYJ A;  1K7B A;  1F5Y A;  1LDR A;  1LDL A;  2M0P A;  2I1P A;  2M7P A;  2LGP A;  2JM4 A;  1D2J A;  2KNX A;  2M96 A; 
#chains in the Genus database with same CATH homology
 1XFE A;  2FYL B;  1CR8 A;  2FCW B;  1D2L A;  2KNY A;  1JRF A;  1N7D A;  1J8E A;  2FYJ A;  1K7B A;  1F5Y A;  1LDR A;  1LDL A;  2M0P A;  2I1P A;  2M7P A;  2LGP A;  2JM4 A;  1D2J A;  2KNX A;  2M96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...