1D2JA

Ldl receptor ligand-binding module 6
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
40
structure length
40
Chain Sequence
VATCRPDEFQCSDGNCIHGSRQCDREYDCKDLSDEVGCVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords LOW-DENSITY LIPOPROTEIN RECEPTOR
publication title Solution structure of the sixth LDL-A module of the LDL receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 3
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 1999-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 1d2jA00
2M96A 1N7DA 1D2LA 1F5YA 2LGPA 2M0PA 1JRFA 1LDRA 1LDLA 2I1PA 2KNYA 1XFEA 2FYJA 1J8EA 1D2JA 2FCWB 2FYLB 2JM4A 2M7PA 1CR8A 2KNXA 1K7BA
chains in the Genus database with same CATH superfamily
2M96A 1N7DA 1D2LA 1F5YA 2LGPA 2M0PA 1JRFA 1LDRA 1LDLA 2I1PA 2KNYA 1XFEA 2FYJA 1J8EA 1D2JA 2FCWB 2FYLB 2JM4A 2M7PA 1CR8A 2KNXA 1K7BA
chains in the Genus database with same CATH topology
2M96A 1N7DA 1D2LA 1F5YA 2LGPA 2M0PA 1JRFA 1LDRA 1LDLA 2I1PA 2KNYA 1XFEA 2FYJA 1J8EA 1D2JA 2FCWB 2FYLB 2JM4A 2M7PA 1CR8A 2KNXA 1K7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M96 A;  1N7D A;  1D2L A;  1F5Y A;  2LGP A;  2M0P A;  1JRF A;  1LDR A;  1LDL A;  2I1P A;  2KNY A;  1XFE A;  2FYJ A;  1J8E A;  1D2J A;  2FCW B;  2FYL B;  2JM4 A;  2M7P A;  1CR8 A;  2KNX A;  1K7B A; 
#chains in the Genus database with same CATH topology
 2M96 A;  1N7D A;  1D2L A;  1F5Y A;  2LGP A;  2M0P A;  1JRF A;  1LDR A;  1LDL A;  2I1P A;  2KNY A;  1XFE A;  2FYJ A;  1J8E A;  1D2J A;  2FCW B;  2FYL B;  2JM4 A;  2M7P A;  1CR8 A;  2KNX A;  1K7B A; 
#chains in the Genus database with same CATH homology
 2M96 A;  1N7D A;  1D2L A;  1F5Y A;  2LGP A;  2M0P A;  1JRF A;  1LDR A;  1LDL A;  2I1P A;  2KNY A;  1XFE A;  2FYJ A;  1J8E A;  1D2J A;  2FCW B;  2FYL B;  2JM4 A;  2M7P A;  1CR8 A;  2KNX A;  1K7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...