1D2LA

Nmr solution structure of complement-like repeat cr3 from the low density lipoprotein receptor-related protein (lrp). evidence for specific binding to the receptor binding domain of human alpha-2 macroglobulin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
45
structure length
45
Chain Sequence
GSPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords LIPOPROTEIN RECEPTOR RELATED PROTEIN
publication title NMR solution structure of complement-like repeat CR3 from the low density lipoprotein receptor-related protein. Evidence for specific binding to the receptor binding domain of human alpha(2)-macroglobulin.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1999-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 1d2lA00
2FYJA 1XFEA 2M96A 1F5YA 2KNXA 1J8EA 1D2LA 1D2JA 2FYLB 2KNYA 2JM4A 2M7PA 2LGPA 1N7DA 1CR8A 2FCWB 1K7BA 1LDLA 1JRFA 1LDRA 2M0PA 2I1PA
chains in the Genus database with same CATH superfamily
2FYJA 1XFEA 2M96A 1F5YA 2KNXA 1J8EA 1D2LA 1D2JA 2FYLB 2KNYA 2JM4A 2M7PA 2LGPA 1N7DA 1CR8A 2FCWB 1K7BA 1LDLA 1JRFA 1LDRA 2M0PA 2I1PA
chains in the Genus database with same CATH topology
2FYJA 1XFEA 2M96A 1F5YA 2KNXA 1J8EA 1D2LA 1D2JA 2FYLB 2KNYA 2JM4A 2M7PA 2LGPA 1N7DA 1CR8A 2FCWB 1K7BA 1LDLA 1JRFA 1LDRA 2M0PA 2I1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYJ A;  1XFE A;  2M96 A;  1F5Y A;  2KNX A;  1J8E A;  1D2L A;  1D2J A;  2FYL B;  2KNY A;  2JM4 A;  2M7P A;  2LGP A;  1N7D A;  1CR8 A;  2FCW B;  1K7B A;  1LDL A;  1JRF A;  1LDR A;  2M0P A;  2I1P A; 
#chains in the Genus database with same CATH topology
 2FYJ A;  1XFE A;  2M96 A;  1F5Y A;  2KNX A;  1J8E A;  1D2L A;  1D2J A;  2FYL B;  2KNY A;  2JM4 A;  2M7P A;  2LGP A;  1N7D A;  1CR8 A;  2FCW B;  1K7B A;  1LDL A;  1JRF A;  1LDR A;  2M0P A;  2I1P A; 
#chains in the Genus database with same CATH homology
 2FYJ A;  1XFE A;  2M96 A;  1F5Y A;  2KNX A;  1J8E A;  1D2L A;  1D2J A;  2FYL B;  2KNY A;  2JM4 A;  2M7P A;  2LGP A;  1N7D A;  1CR8 A;  2FCW B;  1K7B A;  1LDL A;  1JRF A;  1LDR A;  2M0P A;  2I1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...