1F5YA

Nmr structure of a concatemer of the first and second ligand-binding modules of the human ldl receptor
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
85
structure length
85
Chain Sequence
GSAVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords LOW-DENSITY LIPOPROTEIN RECEPTOR
publication title NMR structure of a concatemer of the first and second ligand-binding modules of the human low-density lipoprotein receptor.
pubmed rcsb
source organism Homo sapiens
total genus 10
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2000-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 1f5yA02
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 1f5yA01
1N7DA 2FCWB 1K7BA 1F5YA 1LDLA 2M96A 2KNYA 2FYLB 1CR8A 2M0PA 1D2LA 2I1PA 2JM4A 2LGPA 1JRFA 2KNXA 1J8EA 1LDRA 1D2JA 2M7PA 2FYJA 1XFEA
chains in the Genus database with same CATH superfamily
1N7DA 2FCWB 1K7BA 1F5YA 1LDLA 2M96A 2KNYA 2FYLB 1CR8A 2M0PA 1D2LA 2I1PA 2JM4A 2LGPA 1JRFA 2KNXA 1J8EA 1LDRA 1D2JA 2M7PA 2FYJA 1XFEA
chains in the Genus database with same CATH topology
1N7DA 2FCWB 1K7BA 1F5YA 1LDLA 2M96A 2KNYA 2FYLB 1CR8A 2M0PA 1D2LA 2I1PA 2JM4A 2LGPA 1JRFA 2KNXA 1J8EA 1LDRA 1D2JA 2M7PA 2FYJA 1XFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7D A;  2FCW B;  1K7B A;  1F5Y A;  1LDL A;  2M96 A;  2KNY A;  2FYL B;  1CR8 A;  2M0P A;  1D2L A;  2I1P A;  2JM4 A;  2LGP A;  1JRF A;  2KNX A;  1J8E A;  1LDR A;  1D2J A;  2M7P A;  2FYJ A;  1XFE A; 
#chains in the Genus database with same CATH topology
 1N7D A;  2FCW B;  1K7B A;  1F5Y A;  1LDL A;  2M96 A;  2KNY A;  2FYL B;  1CR8 A;  2M0P A;  1D2L A;  2I1P A;  2JM4 A;  2LGP A;  1JRF A;  2KNX A;  1J8E A;  1LDR A;  1D2J A;  2M7P A;  2FYJ A;  1XFE A; 
#chains in the Genus database with same CATH homology
 1N7D A;  2FCW B;  1K7B A;  1F5Y A;  1LDL A;  2M96 A;  2KNY A;  2FYL B;  1CR8 A;  2M0P A;  1D2L A;  2I1P A;  2JM4 A;  2LGP A;  1JRF A;  2KNX A;  1J8E A;  1LDR A;  1D2J A;  2M7P A;  2FYJ A;  1XFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...