The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
3
|
sequence length |
47
|
structure length |
47
|
Chain Sequence |
GSSRCPPGQFRCSEPPGAHGECYPQDWLCDGHPDCDDGRDEWGCGTS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution structure of the viral receptor domain of Tva and its implications in viral entry.
pubmed doi rcsb |
| molecule keywords |
SUBGROUP A ROUS SARCOMA VIRUS RECEPTORS PG800 AND PG950
|
| molecule tags |
Signaling protein, membrane protein
|
| source organism |
Coturnix japonica
|
| total genus |
3
|
| structure length |
47
|
| sequence length |
47
|
| ec nomenclature | |
| pdb deposition date | 2001-08-13 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00057 | Ldl_recept_a | Low-density lipoprotein receptor domain class A |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Low-density Lipoprotein Receptor | Low-density Lipoprotein Receptor |
#chains in the Genus database with same CATH superfamily 2I1P A; 2M0P A; 2M7P A; 1LDR A; 1CR8 A; 2KNX A; 1D2L A; 2M96 A; 2FCW B; 1XFE A; 1F5Y A; 1K7B A; 1D2J A; 1JRF A; 2FYL B; 1LDL A; 1N7D A; 1J8E A; 2FYJ A; 2JM4 A; 2KNY A; 2LGP A; #chains in the Genus database with same CATH topology 2I1P A; 2M0P A; 2M7P A; 1LDR A; 1CR8 A; 2KNX A; 1D2L A; 2M96 A; 2FCW B; 1XFE A; 1F5Y A; 1K7B A; 1D2J A; 1JRF A; 2FYL B; 1LDL A; 1N7D A; 1J8E A; 2FYJ A; 2JM4 A; 2KNY A; 2LGP A; #chains in the Genus database with same CATH homology 2I1P A; 2M0P A; 2M7P A; 1LDR A; 1CR8 A; 2KNX A; 1D2L A; 2M96 A; 2FCW B; 1XFE A; 1F5Y A; 1K7B A; 1D2J A; 1JRF A; 2FYL B; 1LDL A; 1N7D A; 1J8E A; 2FYJ A; 2JM4 A; 2KNY A; 2LGP A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...