1K7BA

Nmr solution structure of stva47, the viral-binding domain of tva
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
42
structure length
42
Chain Sequence
SCPPGQFRCSEPPGAHGECYPQDWLCDGHPDCDDGRDEWGCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords SUBGROUP A ROUS SARCOMA VIRUS RECEPTOR PG800 AND PG950
publication title The solution structure of the viral binding domain of Tva, the cellular receptor for subgroup A avian leukosis and sarcoma virus.
pubmed doi rcsb
source organism Coturnix coturnix
total genus 7
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2001-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 1k7bA00
1J8EA 1CR8A 1LDRA 1LDLA 2FYLB 1JRFA 2FCWB 1N7DA 2JM4A 2I1PA 2LGPA 2M96A 1K7BA 1D2LA 2M0PA 2M7PA 1XFEA 2FYJA 1F5YA 2KNYA 2KNXA 1D2JA
chains in the Genus database with same CATH superfamily
1J8EA 1CR8A 1LDRA 1LDLA 2FYLB 1JRFA 2FCWB 1N7DA 2JM4A 2I1PA 2LGPA 2M96A 1K7BA 1D2LA 2M0PA 2M7PA 1XFEA 2FYJA 1F5YA 2KNYA 2KNXA 1D2JA
chains in the Genus database with same CATH topology
1J8EA 1CR8A 1LDRA 1LDLA 2FYLB 1JRFA 2FCWB 1N7DA 2JM4A 2I1PA 2LGPA 2M96A 1K7BA 1D2LA 2M0PA 2M7PA 1XFEA 2FYJA 1F5YA 2KNYA 2KNXA 1D2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J8E A;  1CR8 A;  1LDR A;  1LDL A;  2FYL B;  1JRF A;  2FCW B;  1N7D A;  2JM4 A;  2I1P A;  2LGP A;  2M96 A;  1K7B A;  1D2L A;  2M0P A;  2M7P A;  1XFE A;  2FYJ A;  1F5Y A;  2KNY A;  2KNX A;  1D2J A; 
#chains in the Genus database with same CATH topology
 1J8E A;  1CR8 A;  1LDR A;  1LDL A;  2FYL B;  1JRF A;  2FCW B;  1N7D A;  2JM4 A;  2I1P A;  2LGP A;  2M96 A;  1K7B A;  1D2L A;  2M0P A;  2M7P A;  1XFE A;  2FYJ A;  1F5Y A;  2KNY A;  2KNX A;  1D2J A; 
#chains in the Genus database with same CATH homology
 1J8E A;  1CR8 A;  1LDR A;  1LDL A;  2FYL B;  1JRF A;  2FCW B;  1N7D A;  2JM4 A;  2I1P A;  2LGP A;  2M96 A;  1K7B A;  1D2L A;  2M0P A;  2M7P A;  1XFE A;  2FYJ A;  1F5Y A;  2KNY A;  2KNX A;  1D2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...