The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
3
|
sequence length |
43
|
structure length |
43
|
Chain Sequence |
AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Determination of the three-dimensional solution structure of the antihypertensive and antiviral protein BDS-I from the sea anemone Anemonia sulcata: a study using nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing.
pubmed doi rcsb |
| molecule keywords |
BDS-I
|
| molecule tags |
Anti-hypertensive, anti-viral protein
|
| source organism |
Anemonia sulcata
|
| total genus |
3
|
| structure length |
43
|
| sequence length |
43
|
| ec nomenclature | |
| pdb deposition date | 1988-11-14 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF07936 | Defensin_4 | Potassium-channel blocking toxin |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Single Sheet | Anthopleurin-A | Anthopleurin-A |
#chains in the Genus database with same CATH superfamily 4GV5 A; 1SHI A; 1H5O A; 1ATX A; 2MN3 A; 1ZUE A; 2K2X A; 1BDS A; 2RNG A; 2MUB A; 2SH1 A; 1WXN A; 1AHL A; 1Z99 A; 3LMS B; 2JTO A; 1ZLH B; 1D6B A; 1ZUF A; 2BDS A; 2H9X A; 1ZLI B; 3D4U B; 1SH1 A; 1APF A; 1WQK A; 1B8W A; #chains in the Genus database with same CATH topology 2B9K A; 4GV5 A; 1SHI A; 1H5O A; 1ATX A; 2HJ9 C; 2IKD A; 3C38 A; 2MN3 A; 2QSH A; 1ZUE A; 1GKU B; 2JR3 A; 2K2X A; 3KEZ A; 1ZHH B; 3MYV A; 3MCX A; 1BDS A; 2RNG A; 2MUB A; 2SH1 A; 1WXN A; 1AHL A; 1Z99 A; 1EL6 A; 3LMS B; 2HJE A; 2JTO A; 1ZLH B; 1GL9 B; 1D6B A; 1ZUF A; 2BDS A; 3C30 A; 2H9X A; 2IKE A; 3IF4 A; 2DLA A; 1ZLI B; 2QSF A; 2QSG A; 3D4U B; 1SH1 A; 2XXL A; 1APF A; 1WQK A; 1B8W A; 4YIR A; #chains in the Genus database with same CATH homology 2B9K A; 4GV5 A; 1SHI A; 1H5O A; 1ATX A; 2HJ9 C; 2IKD A; 3C38 A; 2MN3 A; 2QSH A; 1ZUE A; 2JR3 A; 2K2X A; 3KEZ A; 1ZHH B; 3MYV A; 3MCX A; 1BDS A; 2RNG A; 2MUB A; 2SH1 A; 1WXN A; 1AHL A; 1Z99 A; 3LMS B; 2HJE A; 2JTO A; 1ZLH B; 1D6B A; 1ZUF A; 2BDS A; 3C30 A; 2H9X A; 2IKE A; 2DLA A; 1ZLI B; 2QSF A; 2QSG A; 3D4U B; 1SH1 A; 2XXL A; 1APF A; 1WQK A; 1B8W A; 4YIR A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
