The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
38
|
sequence length |
114
|
structure length |
114
|
Chain Sequence |
MRRVEKVIIVEGRSDKQKVAAVLNEPVVIVCTNGTISDARLEELADELEGYDVYLLADADEAGEKLRRQFRRMFPEAEHLYIDRAYREVAAAPIWHLAQVLLRARFDVRIESLM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure and putative function of small Toprim domain-containing protein from Bacillus stearothermophilus.
pubmed doi rcsb |
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Geobacillus stearothermophilus
|
| molecule keywords |
small TOPRIM domain protein
|
| total genus |
38
|
| structure length |
114
|
| sequence length |
114
|
| chains with identical sequence |
B, C
|
| ec nomenclature | |
| pdb deposition date | 2005-12-12 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01751 | Toprim | Toprim domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 | Toprim domain |
#chains in the Genus database with same CATH superfamily 2FCJ A; 2I5R A; #chains in the Genus database with same CATH topology 4JCV A; 1DDE A; 3VDP A; 2V1C A; 4O6O A; 4EDK A; 1VDD A; 4E2K A; 2FCJ A; 2Q2E A; 1T6T 1; 4EDG A; 4EDV A; 4EE1 A; 3VE5 A; 2ZBK A; 4O6P B; 3VDU A; 1EQN A; 2AU3 A; 5GUJ A; 1D3Y A; 3B39 A; 2I5R A; 4EDR A; 1DD9 A; 4EDT A; #chains in the Genus database with same CATH homology 2FCJ A; 2I5R A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
