The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
5
|
sequence length |
47
|
structure length |
46
|
Chain Sequence |
GVCRCDSDGPSVHGNTLSGTVWVGSCASGWHKCNDEYNIAYECCKQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Toxin
|
publication title |
CgNa, a type I toxin from the giant Caribbean sea anemone Condylactis gigantea shows structural similarities to both type I and II toxins, as well as distinctive structural and functional properties(1).
pubmed doi rcsb |
molecule keywords |
Toxin CgNa
|
total genus |
5
|
structure length |
46
|
sequence length |
47
|
ec nomenclature | |
pdb deposition date | 2006-06-12 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00706 | Toxin_4 | Anenome neurotoxin |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Single Sheet | Anthopleurin-A | Anthopleurin-A |
#chains in the Genus database with same CATH superfamily 1WXN A; 2H9X A; 1APF A; 1ZLI B; 2MUB A; 2RNG A; 3D4U B; 2BDS A; 4GV5 A; 1B8W A; 2MN3 A; 1H5O A; 1ZUF A; 1WQK A; 2SH1 A; 1ZLH B; 1Z99 A; 1SH1 A; 1ATX A; 3LMS B; 1AHL A; 1D6B A; 1ZUE A; 1SHI A; 2JTO A; 2K2X A; 1BDS A; #chains in the Genus database with same CATH topology 3C30 A; 1WXN A; 2H9X A; 1APF A; 1ZLI B; 2MUB A; 2RNG A; 3MCX A; 3D4U B; 2BDS A; 4GV5 A; 2QSH A; 1B8W A; 2MN3 A; 2QSG A; 3IF4 A; 2QSF A; 1H5O A; 3C38 A; 1ZUF A; 1WQK A; 2SH1 A; 1GKU B; 1ZLH B; 2IKD A; 2JR3 A; 1Z99 A; 1SH1 A; 3KEZ A; 1ATX A; 3LMS B; 1ZHH B; 1AHL A; 1D6B A; 1ZUE A; 2HJ9 C; 2HJE A; 2XXL A; 1SHI A; 1EL6 A; 2IKE A; 2JTO A; 2DLA A; 2K2X A; 3MYV A; 2B9K A; 1BDS A; 1GL9 B; 4YIR A; #chains in the Genus database with same CATH homology 3C30 A; 1WXN A; 2H9X A; 1APF A; 1ZLI B; 2MUB A; 2RNG A; 3MCX A; 3D4U B; 2BDS A; 4GV5 A; 2QSH A; 1B8W A; 2MN3 A; 2QSG A; 2QSF A; 1H5O A; 3C38 A; 1ZUF A; 1WQK A; 2SH1 A; 1ZLH B; 2IKD A; 2JR3 A; 1Z99 A; 1SH1 A; 3KEZ A; 1ATX A; 3LMS B; 1ZHH B; 1AHL A; 1D6B A; 1ZUE A; 2HJ9 C; 2HJE A; 2XXL A; 1SHI A; 2IKE A; 2JTO A; 2DLA A; 2K2X A; 3MYV A; 2B9K A; 1BDS A; 4YIR A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...