The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
45
|
sequence length |
211
|
structure length |
211
|
Chain Sequence |
PEVATYHCGDNLLESYDIFASLPNTNAAKVAAYCRLAAAGGVVSGTIQVTSYAGRWPKVGNSVTDGIKFAIVVSPPMDKDPRSNLSQWLGATVFPAGATTALFSPNPYGSLNTITTLPSIASDWYVPESNLVTYTKIHFKPTGSQQLQLASGELVVAAAKSPVQTTKYELIYLGFTLKQNSSGTNFFDPNASSDLSFLTPPIPFTYLGYYQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of the C-terminal head domain of the fowl adenovirus type 1 long fiber.
pubmed doi rcsb |
molecule tags |
Viral protein
|
source organism |
Avian adenovirus gal1
|
molecule keywords |
AVIAN ADENOVIRUS CELO LONG FIBRE
|
total genus |
45
|
structure length |
211
|
sequence length |
211
|
chains with identical sequence |
B, C, D, E, F
|
ec nomenclature | |
pdb deposition date | 2006-06-06 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF16812 | AdHead_fibreRBD | C-terminal head domain of the fowl adenovirus type 1 long fibre |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Adenovirus Type 5 Fiber Protein (Receptor Binding Domain) | Adenovirus Type 5 Fiber Protein (Receptor Binding Domain) |
#chains in the Genus database with same CATH superfamily 2VTW A; 2IUN A; 2IUM A; #chains in the Genus database with same CATH topology 2J2J A; 3CNC A; 1QHV A; 4XQB A; 2WBW A; 2O39 A; 1QIU A; 4CW8 A; 4D63 A; 2BT8 A; 3F0Y A; 3EOY A; 4LIY A; 4K6U A; 3EXV A; 3ZPE A; 2WGU A; 2J12 A; 1P6A A; 4XC5 A; 1UXB A; 2J1K C; 1KAC A; 3N0I A; 3O8E A; 4XL8 A; 3L88 A; 2OJ5 A; 2VTW A; 2BSF A; 4K6T A; 4GU4 A; 1UXE A; 3ZPF A; 2QLK A; 2VRS A; 2BT7 A; 2W9L C; 4K6W A; 2WST A; 3S6X A; 1NOB A; 1KKE A; 4ODB A; 3EXW A; 4ZDG A; 2WGT A; 4D62 A; 4ATZ A; 4K6V A; 2JJL A; 4XQA A; 1H7Z A; 1KNB A; 5MHS A; 1UXA A; 2BZV A; 3BQ4 A; 2IUM A; 2OJ6 A; 3L89 A; 2BZU A; 3QND A; 4WYJ A; 2IUN A; 1P69 A; 2WBV A; 4GU3 A; #chains in the Genus database with same CATH homology 3ZPF A; 2JJL A; 2VRS A; 2BT7 A; 4D62 A; 2IUM A; 4CW8 A; 4D63 A; 2IUN A; 2BT8 A; 2VTW A; 2BSF A; 3ZPE A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...