The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
9
|
sequence length |
75
|
structure length |
75
|
Chain Sequence |
NECVSKGFGCLPQSDCPQEARLSYGGCSTVCCDLSKLTGCKGKGGECNPLDRQCKELQAESASCGKGQKCCVWLH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The NMR structure and dynamics of the two-domain tick carboxypeptidase inhibitor reveal flexibility in its free form and stiffness upon binding to human carboxypeptidase B.
pubmed doi rcsb |
molecule tags |
Hydrolase inhibitor
|
source organism |
Rhipicephalus bursa
|
molecule keywords |
Carboxypeptidase inhibitor
|
total genus |
9
|
structure length |
75
|
sequence length |
75
|
ec nomenclature | |
pdb deposition date | 2007-08-03 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Single Sheet | Anthopleurin-A | Anthopleurin-A | ||
Mainly Beta | Single Sheet | Anthopleurin-A | Anthopleurin-A |
#chains in the Genus database with same CATH superfamily 2MUB A; 2MN3 A; 1SH1 A; 2RNG A; 1ZLH B; 1Z99 A; 2BDS A; 1WQK A; 3D4U B; 1ZUE A; 4GV5 A; 1SHI A; 1WXN A; 1ATX A; 3LMS B; 1ZLI B; 1BDS A; 2K2X A; 1D6B A; 1ZUF A; 1H5O A; 2H9X A; 1B8W A; 2SH1 A; 1AHL A; 2JTO A; 1APF A; #chains in the Genus database with same CATH topology 3MYV A; 2MUB A; 1GKU B; 2MN3 A; 2IKD A; 1SH1 A; 2RNG A; 2QSH A; 1ZLH B; 1Z99 A; 2XXL A; 1GL9 B; 3IF4 A; 2BDS A; 1WQK A; 2B9K A; 3D4U B; 1ZUE A; 3C38 A; 2DLA A; 1WXN A; 1SHI A; 2HJ9 C; 4GV5 A; 1ATX A; 3LMS B; 1ZLI B; 2JR3 A; 1BDS A; 2QSG A; 2K2X A; 1D6B A; 1ZUF A; 1H5O A; 2QSF A; 3KEZ A; 3MCX A; 3C30 A; 2H9X A; 2IKE A; 4YIR A; 1ZHH B; 1B8W A; 2SH1 A; 1AHL A; 2JTO A; 2HJE A; 1APF A; 1EL6 A; #chains in the Genus database with same CATH homology 3MYV A; 2MUB A; 2MN3 A; 2IKD A; 1SH1 A; 2RNG A; 2QSH A; 1ZLH B; 1Z99 A; 2XXL A; 2BDS A; 1WQK A; 2B9K A; 3D4U B; 1ZUE A; 3C38 A; 2DLA A; 2HJ9 C; 1SHI A; 1WXN A; 4GV5 A; 1ATX A; 3LMS B; 1ZLI B; 2JR3 A; 1BDS A; 2QSG A; 2K2X A; 1D6B A; 1ZUF A; 1H5O A; 2QSF A; 3KEZ A; 3MCX A; 3C30 A; 2H9X A; 2IKE A; 4YIR A; 1ZHH B; 1B8W A; 2SH1 A; 1AHL A; 2JTO A; 2HJE A; 1APF A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...