The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
33
|
sequence length |
162
|
structure length |
162
|
Chain Sequence |
PNLRYPIADVSGGIGMSPNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVNDYIHICLPAFDGFSIADGGDLSLNFVTGLLPPLLTGDTEPAFHNDVVTYGAQTVAIGLSSGGTPQYMSKNLWVEQWQDGVLRLRVEGGGSITHSNSKWPAMTVSYPRSFT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The Reovirus Sigma1 Aspartic Acid Sandwich: A TRIMERIZATION MOTIF POISED FOR CONFORMATIONAL CHANGE.
pubmed doi rcsb |
| molecule keywords |
Viral attachment protein sigma 1
|
| molecule tags |
Viral protein
|
| source organism |
Reovirus sp.
|
| total genus |
33
|
| structure length |
162
|
| sequence length |
162
|
| chains with identical sequence |
B, C, D, E, F
|
| ec nomenclature | |
| pdb deposition date | 2007-01-12 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Adenovirus Type 5 Fiber Protein (Receptor Binding Domain) | Virus attachment protein , globular domain |
#chains in the Genus database with same CATH superfamily 4XC5 A; 5MHS A; 4GU4 A; 2OJ5 A; 1KKE A; 4GU3 A; 4ODB A; 2OJ6 A; 3EOY A; 3S6X A; #chains in the Genus database with same CATH topology 4XC5 A; 4D62 A; 2VRS A; 3BQ4 A; 2JJL A; 1QHV A; 3EXV A; 1NOB A; 3F0Y A; 3N0I A; 4K6T A; 5MHS A; 2BSF A; 4K6W A; 4K6V A; 2J2J A; 1KKE A; 4GU3 A; 4GU4 A; 4LIY A; 3O8E A; 2O39 A; 4XQB A; 3QND A; 1UXB A; 2WST A; 2WGU A; 1UXA A; 1QIU A; 3EOY A; 4ODB A; 3ZPF A; 2WBW A; 3L88 A; 2BZV A; 4ZDG A; 1P69 A; 2WBV A; 2OJ5 A; 4D63 A; 1UXE A; 3ZPE A; 3L89 A; 4K6U A; 4XL8 A; 4XQA A; 4CW8 A; 2IUM A; 3CNC A; 3EXW A; 3S6X A; 2IUN A; 2W9L C; 1H7Z A; 2QLK A; 2BZU A; 4WYJ A; 1P6A A; 2BT8 A; 2VTW A; 4ATZ A; 2BT7 A; 2J1K C; 1KNB A; 2WGT A; 1KAC A; 2OJ6 A; 2J12 A; #chains in the Genus database with same CATH homology 4XC5 A; 5MHS A; 4GU4 A; 2OJ5 A; 1KKE A; 4GU3 A; 4ODB A; 2OJ6 A; 3EOY A; 3S6X A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...