The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
33
|
sequence length |
105
|
structure length |
105
|
Chain Sequence |
MNDSEFIQLADQLYQKIEEKIEESGADVDYDQNGSLLTLEFENHTKLIINRQQPLHQVWLATLENGHHYDYNNGKWIDDRSGDEFLTFLSAAIFKQSKETVDFTE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Frataxin from Psychromonas ingrahamii as a model to study stability modulation within the CyaY protein family
pubmed doi rcsb |
molecule tags |
Metal binding protein
|
source organism |
Psychromonas ingrahamii
|
molecule keywords |
Protein CyaY
|
total genus |
33
|
structure length |
105
|
sequence length |
105
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2012-10-29 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01491 | Frataxin_Cyay | Frataxin-like domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Metal Transport, Frataxin; Chain A | Frataxin/CyaY |
#chains in the Genus database with same CATH superfamily 1SOY A; 2EFF A; 3S5F A; 3T3X A; 4EC2 A; 3S4M A; 2P1X A; 3T3L A; 3OEQ A; 4LK8 A; 3T3K A; 3T3T A; 4LP1 A; 3S5D A; 1LY7 A; 4HS5 A; 2FQL A; 3OER A; 3T3J A; 4JPD A; 1EW4 A; 2GA5 A; 1EKG A; 3S5E A; #chains in the Genus database with same CATH topology 3S5E A; 1SOY A; 3IAM 7; 3IMO A; 2EFF A; 3S5F A; 3T3X A; 4EC2 A; 3SSE A; 3S4M A; 2P1X A; 3T3L A; 1D2M A; 3OEQ A; 4LK8 A; 4P78 C; 3T3K A; 3T3T A; 4LP1 A; 3S5D A; 3IAS 7; 1LY7 A; 3A5P A; 1V5R A; 4HS5 A; 3SSD A; 3SSC A; 2FQL A; 3GD0 A; 3OER A; 3I9V 7; 3T3J A; 4JPD A; 1EW4 A; 2GA5 A; 3GD9 A; 1WHZ A; 2FUG 7; 4C26 A; 1EKG A; 4HEA 7; #chains in the Genus database with same CATH homology 1SOY A; 2EFF A; 3S5F A; 3T3X A; 4EC2 A; 3S4M A; 2P1X A; 3T3L A; 3OEQ A; 4LK8 A; 3T3K A; 3T3T A; 4LP1 A; 3S5D A; 1LY7 A; 4HS5 A; 2FQL A; 3OER A; 3T3J A; 4JPD A; 1EW4 A; 2GA5 A; 1EKG A; 3S5E A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...