The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
30
|
sequence length |
162
|
structure length |
162
|
Chain Sequence |
LPTYRYPLELDTANNRVQVADRFGMRTGTWTGQLQYQHPQLSWRANVTLNLMKVDDWLVLSFSQMTTNSIMADGKFVINFVSGLSSGWQTGDTEPSSTIDPLSTTFAAVQFLNNGQRIDAFRIMGVSEWTDGELEIKNYGGTYTGHTQVYWAPWTIMYPCNV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The JAM-A binding site is conserved in reovirus sigma1: Structure of the T1L sigma1-JAM-A complex
rcsb |
molecule tags |
Viral protein
|
source organism |
Mammalian orthoreovirus 1
|
molecule keywords |
Outer capsid protein sigma-1
|
total genus |
30
|
structure length |
162
|
sequence length |
162
|
chains with identical sequence |
B, C
|
ec nomenclature | |
pdb deposition date | 2014-01-10 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Adenovirus Type 5 Fiber Protein (Receptor Binding Domain) | Virus attachment protein , globular domain |
#chains in the Genus database with same CATH superfamily 1KKE A; 5MHS A; 2OJ5 A; 4GU4 A; 4ODB A; 4GU3 A; 4XC5 A; 3S6X A; 2OJ6 A; 3EOY A; #chains in the Genus database with same CATH topology 1KKE A; 2BT7 A; 2WGT A; 2IUM A; 1QIU A; 2BSF A; 1NOB A; 2W9L C; 4GU3 A; 4XQA A; 3ZPE A; 1P69 A; 3EXV A; 3O8E A; 4WYJ A; 2JJL A; 3L88 A; 1UXA A; 1P6A A; 2BZU A; 2BT8 A; 2J1K C; 2VTW A; 2WBW A; 4GU4 A; 4D62 A; 4LIY A; 4XQB A; 3EXW A; 3S6X A; 3ZPF A; 2OJ6 A; 1UXE A; 1KAC A; 3N0I A; 4K6V A; 4ODB A; 2QLK A; 1UXB A; 4ZDG A; 4XC5 A; 2IUN A; 4K6T A; 4ATZ A; 2BZV A; 2J2J A; 2WBV A; 3QND A; 2WGU A; 4K6U A; 1QHV A; 2WST A; 5MHS A; 2OJ5 A; 3F0Y A; 4CW8 A; 4D63 A; 3CNC A; 1KNB A; 2J12 A; 3L89 A; 4K6W A; 3BQ4 A; 1H7Z A; 4XL8 A; 2VRS A; 3EOY A; 2O39 A; #chains in the Genus database with same CATH homology 1KKE A; 5MHS A; 2OJ5 A; 4GU4 A; 4ODB A; 4GU3 A; 4XC5 A; 3S6X A; 2OJ6 A; 3EOY A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...