The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
75
|
sequence length |
295
|
structure length |
292
|
Chain Sequence |
EKNLDGDTKMYTRTATTSDSQKNITQSLQFNFLTEPNYDKETVFIKAKGTIGSGLRILDPNGYWNSTLRWPGSYSVSIQNVDDNNNTNVTDFAPKNQDESREVKYTYGYKTGGDFSINLTGNITKESNYSETISYQQPSYRTLLDQSTSHKGVGWKVEAHLINNMGHDHTRQLTNDSDNRTKSEIFSLTRNGNLWAKDNFTPKDKMPVTVSEGFNPEFLAVMSHDKKDKGKSQFVVHYKRSMDEFKIDWNRHGFWGYWSGENHVDKKEEKLSALYEVDWKTHNVKFVKVLND
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Context matters: The importance of dimerization-induced conformation of the LukGH leukocidin of Staphylococcus aureus for the generation of neutralizing antibodies.
pubmed doi rcsb |
| molecule tags |
Immune system
|
| source organism |
Staphylococcus aureus (strain usa300)
|
| molecule keywords |
Uncharacterized leukocidin-like protein 2
|
| total genus |
75
|
| structure length |
292
|
| sequence length |
295
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2016-05-23 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF07968 | Leukocidin | Leukocidin/Hemolysin toxin family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Distorted Sandwich | Leukocidin-like | Leukocidin/porin MspA |
#chains in the Genus database with same CATH superfamily 5K59 A; 4TW1 A; 2YGT A; 3O44 A; 4IZL A; 1PVL A; 4P1Y A; 4P1X A; 4U6V A; 4IYC A; 3LKF A; 4J0O A; 4IYA A; 3M3R A; 3M4D A; 3M2L A; 4IDJ A; 2LKF A; 4YHD A; 5K59 C; 4IYT A; 3M4E A; 1T5R A; 1LKF A; 7AHL A; 2QK7 B; 3B07 B; 4I0N A; 3ROH A; 4Q7G A; 3ANZ A; 4TW1 B; 4H56 A; 2QK7 A; 4P24 A; 4P1Y B; 3B07 A; 4P1X B; #chains in the Genus database with same CATH topology 5K59 A; 4TW1 A; 2YGT A; 3O44 A; 4IZL A; 1PVL A; 4P1Y A; 4P1X A; 4U6V A; 4IYC A; 3LKF A; 4J0O A; 4IYA A; 3M3R A; 3M4D A; 3M2L A; 4IDJ A; 2LKF A; 4YHD A; 5K59 C; 4IYT A; 3M4E A; 1T5R A; 1LKF A; 7AHL A; 2QK7 B; 1XEZ A; 3B07 B; 4I0N A; 3ROH A; 4Q7G A; 3ANZ A; 4TW1 B; 4H56 A; 2QK7 A; 4P24 A; 4P1Y B; 3B07 A; 4P1X B; #chains in the Genus database with same CATH homology 5K59 A; 4TW1 A; 2YGT A; 3O44 A; 4IZL A; 1PVL A; 4P1Y A; 4P1X A; 4U6V A; 4IYC A; 3LKF A; 4J0O A; 4IYA A; 3M3R A; 3M4D A; 3M2L A; 4IDJ A; 2LKF A; 4YHD A; 5K59 C; 4IYT A; 3M4E A; 1T5R A; 1LKF A; 7AHL A; 2QK7 B; 3B07 B; 4I0N A; 3ROH A; 4Q7G A; 3ANZ A; 4TW1 B; 4H56 A; 2QK7 A; 4P24 A; 4P1Y B; 3B07 A; 4P1X B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
