1A2IA

Solution structure of desulfovibrio vulgaris (hildenborough) ferrocytochrome c3, nmr, 20 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
107
structure length
107
Chain Sequence
b'APKAPADGLKMEATKQPVVFNHSTHKSVKCGDCHHPVNGKEDYRKCGTAGCHDSMDKKDKSAKGYYHVMHDKNTKFKSCVGCHVEVAGADAAKKKDLTGCKKSKCHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C3
publication title Solution structure of Desulfovibrio vulgaris (Hildenborough) ferrocytochrome c3: structural basis for functional cooperativity.
pubmed doi rcsb
molecule tags Electron transport
total genus 15
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1998-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.10.10 Alpha Beta Alpha-Beta Complex Cytochrome C3 Cytochrome C3 1a2iA00
1EHJA 2N91A 1GM4A 1NEWA 1L3OA 1W7OA 2YYXA 1H29A 1DUWA 1CZJA 2EWUA 2YXCA 1GYOA 2CVCA 1UPDA 2FFNA 3OV0A 1HH5A 1QN0A 2Z47A 2CDVA 19HCA 3SJ0X 1GMBA 3CYRA 2CYMA 1OFWA 1OS6A 2EWKA 3H34A 1KWJA 1Z1NX 3BXUA 1WR5A 4HDLA 2KMYA 1J0OA 2A3PA 3CAOA 2E84A 1MDVA 3SELX 3H33A 1AQEA 2MZ9A 2A3MA 3OUQA 1I77A 2BQ4A 4HC3A 2YYWA 1LM2A 4HB8A 1F22A 1UP9A 2LZZA 2BPNA 1A2IA 1OFYA 2EWIA 3CARA 1J0PA 1RWJA 4HAJA 2KSUA 2LDOA 4HBFA 3H4NA 1GWSA 1WADA 3SJ4X 1IT1A 1QN1A 2CTHA 2CY3A 4HB6A 3SJ1X 3OUEA
chains in the Genus database with same CATH superfamily
1EHJA 2N91A 1GM4A 1NEWA 1L3OA 1W7OA 2YYXA 1H29A 1DUWA 1CZJA 2EWUA 2YXCA 1GYOA 2CVCA 1UPDA 2FFNA 3OV0A 1HH5A 1QN0A 2Z47A 2CDVA 19HCA 3SJ0X 1GMBA 3CYRA 2CYMA 1OFWA 1OS6A 2EWKA 3H34A 1KWJA 1Z1NX 3BXUA 1WR5A 4HDLA 2KMYA 1J0OA 2A3PA 3CAOA 2E84A 1MDVA 3SELX 3H33A 1AQEA 2MZ9A 2A3MA 3OUQA 1I77A 2BQ4A 4HC3A 2YYWA 1LM2A 4HB8A 1F22A 1UP9A 2LZZA 2BPNA 1A2IA 1OFYA 2EWIA 3CARA 1J0PA 1RWJA 4HAJA 2KSUA 2LDOA 4HBFA 3H4NA 1GWSA 1WADA 3SJ4X 1IT1A 1QN1A 2CTHA 2CY3A 4HB6A 3SJ1X 3OUEA
chains in the Genus database with same CATH topology
1EHJA 2N91A 1GM4A 1NEWA 1L3OA 1W7OA 2YYXA 1H29A 1DUWA 1CZJA 2EWUA 2YXCA 1GYOA 2CVCA 1UPDA 2FFNA 3OV0A 1HH5A 1QN0A 2Z47A 2CDVA 19HCA 3SJ0X 1GMBA 3CYRA 2CYMA 1OFWA 1OS6A 2EWKA 3H34A 1KWJA 1Z1NX 3BXUA 1WR5A 4HDLA 2KMYA 1J0OA 2A3PA 3CAOA 2E84A 1MDVA 3SELX 3H33A 1AQEA 2MZ9A 2A3MA 3OUQA 1I77A 2BQ4A 4HC3A 2YYWA 1LM2A 4HB8A 1F22A 1UP9A 2LZZA 2BPNA 1A2IA 1OFYA 2EWIA 3CARA 1J0PA 1RWJA 4HAJA 2KSUA 2LDOA 4HBFA 3H4NA 1GWSA 1WADA 3SJ4X 1IT1A 1QN1A 2CTHA 2CY3A 4HB6A 3SJ1X 3OUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EHJ A;  2N91 A;  1GM4 A;  1NEW A;  1L3O A;  1W7O A;  2YYX A;  1H29 A;  1DUW A;  1CZJ A;  2EWU A;  2YXC A;  1GYO A;  2CVC A;  1UPD A;  2FFN A;  3OV0 A;  1HH5 A;  1QN0 A;  2Z47 A;  2CDV A;  19HC A;  3SJ0 X;  1GMB A;  3CYR A;  2CYM A;  1OFW A;  1OS6 A;  2EWK A;  3H34 A;  1KWJ A;  1Z1N X;  3BXU A;  1WR5 A;  4HDL A;  2KMY A;  1J0O A;  2A3P A;  3CAO A;  2E84 A;  1MDV A;  3SEL X;  3H33 A;  1AQE A;  2MZ9 A;  2A3M A;  3OUQ A;  1I77 A;  2BQ4 A;  4HC3 A;  2YYW A;  1LM2 A;  4HB8 A;  1F22 A;  1UP9 A;  2LZZ A;  2BPN A;  1A2I A;  1OFY A;  2EWI A;  3CAR A;  1J0P A;  1RWJ A;  4HAJ A;  2KSU A;  2LDO A;  4HBF A;  3H4N A;  1GWS A;  1WAD A;  3SJ4 X;  1IT1 A;  1QN1 A;  2CTH A;  2CY3 A;  4HB6 A;  3SJ1 X;  3OUE A; 
#chains in the Genus database with same CATH topology
 1EHJ A;  2N91 A;  1GM4 A;  1NEW A;  1L3O A;  1W7O A;  2YYX A;  1H29 A;  1DUW A;  1CZJ A;  2EWU A;  2YXC A;  1GYO A;  2CVC A;  1UPD A;  2FFN A;  3OV0 A;  1HH5 A;  1QN0 A;  2Z47 A;  2CDV A;  19HC A;  3SJ0 X;  1GMB A;  3CYR A;  2CYM A;  1OFW A;  1OS6 A;  2EWK A;  3H34 A;  1KWJ A;  1Z1N X;  3BXU A;  1WR5 A;  4HDL A;  2KMY A;  1J0O A;  2A3P A;  3CAO A;  2E84 A;  1MDV A;  3SEL X;  3H33 A;  1AQE A;  2MZ9 A;  2A3M A;  3OUQ A;  1I77 A;  2BQ4 A;  4HC3 A;  2YYW A;  1LM2 A;  4HB8 A;  1F22 A;  1UP9 A;  2LZZ A;  2BPN A;  1A2I A;  1OFY A;  2EWI A;  3CAR A;  1J0P A;  1RWJ A;  4HAJ A;  2KSU A;  2LDO A;  4HBF A;  3H4N A;  1GWS A;  1WAD A;  3SJ4 X;  1IT1 A;  1QN1 A;  2CTH A;  2CY3 A;  4HB6 A;  3SJ1 X;  3OUE A; 
#chains in the Genus database with same CATH homology
 1EHJ A;  2N91 A;  1GM4 A;  1NEW A;  1L3O A;  1W7O A;  2YYX A;  1H29 A;  1DUW A;  1CZJ A;  2EWU A;  2YXC A;  1GYO A;  2CVC A;  1UPD A;  2FFN A;  3OV0 A;  1HH5 A;  1QN0 A;  2Z47 A;  2CDV A;  19HC A;  3SJ0 X;  1GMB A;  3CYR A;  2CYM A;  1OFW A;  1OS6 A;  2EWK A;  3H34 A;  1KWJ A;  1Z1N X;  3BXU A;  1WR5 A;  4HDL A;  2KMY A;  1J0O A;  2A3P A;  3CAO A;  2E84 A;  1MDV A;  3SEL X;  3H33 A;  1AQE A;  2MZ9 A;  2A3M A;  3OUQ A;  1I77 A;  2BQ4 A;  4HC3 A;  2YYW A;  1LM2 A;  4HB8 A;  1F22 A;  1UP9 A;  2LZZ A;  2BPN A;  1A2I A;  1OFY A;  2EWI A;  3CAR A;  1J0P A;  1RWJ A;  4HAJ A;  2KSU A;  2LDO A;  4HBF A;  3H4N A;  1GWS A;  1WAD A;  3SJ4 X;  1IT1 A;  1QN1 A;  2CTH A;  2CY3 A;  4HB6 A;  3SJ1 X;  3OUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...