4RRCA

N-terminal editing domain of threonyl-trna synthetase from aeropyrum pernix with l-thr3aa (snapshot 3)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
136
Chain Sequence
MRLLYLHADRFEYKTVKPALKNPPDPPGEASFGEALVVFTTVEDGDGPQTVMYAASDIASHSSRLKVTTVILYPYAHLSSRLAKPMAAHKRLIELEGALRTKFPGHVHRAPFGWYKSFSIACKGHPLAELSRSFTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Probable threonine--tRNA ligase 2
publication title Specificity and catalysis hardwired at the RNA-protein interface in a translational proofreading enzyme.
pubmed doi rcsb
source organism Aeropyrum pernix k1
total genus 41
structure length 136
sequence length 136
ec nomenclature ec 6.1.1.3: Threonine--tRNA ligase.
pdb deposition date 2014-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08915 tRNA-Thr_ED Archaea-specific editing domain of threonyl-tRNA synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.80.10 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 4rrcA01
3KO3A 3PD5A 4RRBA 4RRJA 4RRRA 2HL1A 2HL2A 3KODA 4NBJA 4RRIA 4S0LA 3PD2A 4RR9A 4S02A 2DBOA 4S0JA 1Y2QA 4RRAA 4RRQA 5J61A 2OKVA 4RRKA 4S03A 3LMUA 4RRHA 4RRCA 1JKEA 3PD4A 4RR8A 2HKZA 3KO5A 3KOBA 4RRFA 4NBIA 3LMTA 3KNFA 3PD3A 4RRDA 4RRMA 4RRGA 4RR7A 4RR6A 3KO7A 3LMVA 3KO9A 3KNPA 1J7GA 3KOCA 4S0IA 2HL0A 4S0KA 3KO4A 1TC5A 4RRLA
chains in the Genus database with same CATH superfamily
4BENA 3A3FA 4RRRA 2J9PA 3KODA 4RRIA 4S0JA 2DBOA 4RRQA 2Y55A 4RRCA 2EXAA 2HKZA 3A3IA 3KNFA 4RRDA 4RRMA 4B4XA 3KO7A 1J7GA 3A3EA 4S0KA 2HL0A 2XDMA 4RRLA 3KO3A 3ZCZA 1W8QA 4S0LA 3PD2A 4RR9A 4S02A 5J61A 1Y2QA 3LMUA 5CEBA 2EX2A 1JKEA 2VGKA 2EX6A 2Y4AA 5CECA 3KOBA 4RRFA 3LMTA 1W8YA 4RR6A 5CERA 3LMVA 2Y59A 3KOCA 4S0IA 3KO4A 1TC5A 3PD5A 4RRBA 4RRJA 4B4ZA 4NBJA 2OKVA 1W5DA 3PD4A 4RR8A 3V39A 4NBIA 4RR7A 2EX8A 3KO9A 2EXBA 2HL1A 2HL2A 2XLNA 4RRAA 4RRKA 3A3DA 4S03A 2WKEA 2VGJA 4RRHA 5CEDA 3ZVWA 3KO5A 1W79A 3PD3A 4RRGA 2EX9A 3KNPA 2XK1A 3ZVTA
chains in the Genus database with same CATH topology
4BENA 3A3FA 4RRRA 2J9PA 3KODA 4RRIA 4S0JA 2DBOA 4RRQA 2Y55A 4RRCA 2EXAA 2HKZA 3A3IA 3KNFA 4RRDA 4RRMA 4B4XA 3KO7A 1J7GA 3A3EA 4S0KA 2HL0A 2XDMA 4RRLA 3KO3A 3ZCZA 1W8QA 4S0LA 3PD2A 4RR9A 4S02A 5J61A 1Y2QA 3LMUA 5CEBA 2EX2A 1JKEA 2VGKA 2EX6A 2Y4AA 5CECA 3KOBA 4RRFA 3LMTA 1W8YA 4RR6A 5CERA 3LMVA 2Y59A 3KOCA 4S0IA 3KO4A 1TC5A 3PD5A 4RRBA 4RRJA 4B4ZA 4NBJA 2OKVA 1W5DA 3PD4A 4RR8A 3V39A 4NBIA 4RR7A 2EX8A 3KO9A 2EXBA 2HL1A 2HL2A 2XLNA 4RRAA 4RRKA 3A3DA 4S03A 2WKEA 2VGJA 4RRHA 5CEDA 3ZVWA 3KO5A 1W79A 3PD3A 4RRGA 2EX9A 3KNPA 2XK1A 3ZVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KO3 A;  3PD5 A;  4RRB A;  4RRJ A;  4RRR A;  2HL1 A;  2HL2 A;  3KOD A;  4NBJ A;  4RRI A;  4S0L A;  3PD2 A;  4RR9 A;  4S02 A;  2DBO A;  4S0J A;  1Y2Q A;  4RRA A;  4RRQ A;  5J61 A;  2OKV A;  4RRK A;  4S03 A;  3LMU A;  4RRH A;  4RRC A;  1JKE A;  3PD4 A;  4RR8 A;  2HKZ A;  3KO5 A;  3KOB A;  4RRF A;  4NBI A;  3LMT A;  3KNF A;  3PD3 A;  4RRD A;  4RRM A;  4RRG A;  4RR7 A;  4RR6 A;  3KO7 A;  3LMV A;  3KO9 A;  3KNP A;  1J7G A;  3KOC A;  4S0I A;  2HL0 A;  4S0K A;  3KO4 A;  1TC5 A;  4RRL A; 
#chains in the Genus database with same CATH topology
 4BEN A;  3A3F A;  4RRR A;  2J9P A;  3KOD A;  4RRI A;  4S0J A;  2DBO A;  4RRQ A;  2Y55 A;  4RRC A;  2EXA A;  2HKZ A;  3A3I A;  3KNF A;  4RRD A;  4RRM A;  4B4X A;  3KO7 A;  1J7G A;  3A3E A;  4S0K A;  2HL0 A;  2XDM A;  4RRL A;  3KO3 A;  3ZCZ A;  1W8Q A;  4S0L A;  3PD2 A;  4RR9 A;  4S02 A;  5J61 A;  1Y2Q A;  3LMU A;  5CEB A;  2EX2 A;  1JKE A;  2VGK A;  2EX6 A;  2Y4A A;  5CEC A;  3KOB A;  4RRF A;  3LMT A;  1W8Y A;  4RR6 A;  5CER A;  3LMV A;  2Y59 A;  3KOC A;  4S0I A;  3KO4 A;  1TC5 A;  3PD5 A;  4RRB A;  4RRJ A;  4B4Z A;  4NBJ A;  2OKV A;  1W5D A;  3PD4 A;  4RR8 A;  3V39 A;  4NBI A;  4RR7 A;  2EX8 A;  3KO9 A;  2EXB A;  2HL1 A;  2HL2 A;  2XLN A;  4RRA A;  4RRK A;  3A3D A;  4S03 A;  2WKE A;  2VGJ A;  4RRH A;  5CED A;  3ZVW A;  3KO5 A;  1W79 A;  3PD3 A;  4RRG A;  2EX9 A;  3KNP A;  2XK1 A;  3ZVT A; 
#chains in the Genus database with same CATH homology
 4BEN A;  3A3F A;  4RRR A;  2J9P A;  3KOD A;  4RRI A;  4S0J A;  2DBO A;  4RRQ A;  2Y55 A;  4RRC A;  2EXA A;  2HKZ A;  3A3I A;  3KNF A;  4RRD A;  4RRM A;  4B4X A;  3KO7 A;  1J7G A;  3A3E A;  4S0K A;  2HL0 A;  2XDM A;  4RRL A;  3KO3 A;  3ZCZ A;  1W8Q A;  4S0L A;  3PD2 A;  4RR9 A;  4S02 A;  5J61 A;  1Y2Q A;  3LMU A;  5CEB A;  2EX2 A;  1JKE A;  2VGK A;  2EX6 A;  2Y4A A;  5CEC A;  3KOB A;  4RRF A;  3LMT A;  1W8Y A;  4RR6 A;  5CER A;  3LMV A;  2Y59 A;  3KOC A;  4S0I A;  3KO4 A;  1TC5 A;  3PD5 A;  4RRB A;  4RRJ A;  4B4Z A;  4NBJ A;  2OKV A;  1W5D A;  3PD4 A;  4RR8 A;  3V39 A;  4NBI A;  4RR7 A;  2EX8 A;  3KO9 A;  2EXB A;  2HL1 A;  2HL2 A;  2XLN A;  4RRA A;  4RRK A;  3A3D A;  4S03 A;  2WKE A;  2VGJ A;  4RRH A;  5CED A;  3ZVW A;  3KO5 A;  1W79 A;  3PD3 A;  4RRG A;  2EX9 A;  3KNP A;  2XK1 A;  3ZVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...