2EX8A

Crystal structure of penicillin binding protein 4 (dacb) from escherichia coli, complexed with penicillin-g
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
456
structure length
456
Chain Sequence
NVDEYITQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKYELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYAVEPADQRNRRIPLVRFESRLYKDIYQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Penicillin-binding protein 4
publication title Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, both in the native form and covalently linked to various antibiotics
pubmed doi rcsb
source organism Escherichia coli
total genus 147
structure length 456
sequence length 456
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2005-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2ex8A01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 2ex8A02
4EUZA 3WRTA 4MLLA 3UE0A 4ZJ1A 3Q7VB 1IKIA 3QNCA 4H8RA 4KZAA 3BFCA 1MWRA 5HAIA 5GL9A 2C5WB 3FYZA 1K25A 1L0GA 3SH8A 3NDEA 4BD0A 1PIOA 1M6KA 4E3LA 1O7EA 2WAEA 1BLSA 1ZG4A 2JE5A 4X53A 1ONHA 1W8YA 5FQQA 4QHCA 1RCJA 4XUZA 1SCWA 1K56A 4IVKA 5F82A 4E6WA 4EBNA 1PW1A 4K91A 1HVBA 4KZ4A 3BFDA 2Y2HA 3FV7A 4OP5A 5JYPA 1KGFA 2XEPA 3BM6A 3HL9A 4IBXA 3FKVA 5E2EA 4BL3A 4DE0A 4JF5A 4OOYA 1G68A 1NY0A 1KE4A 3UNWA 4EWFA 3GQZA 3IWQA 4OLDA 4OP8A 3BFEA 2WGVA 5HAPA 1K6RA 5EECA 4Y0TA 4P0MA 2J8YA 1DJBA 2WYXA 3IH9A 4UA6A 3O3VA 3D4FA 2DRWA 4HBTA 4HEFA 3S4XA 3UPPA 5DTTA 3MZEA 3NIAA 4WZ5A 3UE1A 2A3UA 5HAQA 4GN2A 4S2OA 4U0TA 3G31A 4QY5A 4UA9A 3SS3A 3ZHHA 1L0DA 3G35A 5HL1A 1NZUA 3EQUA 4KQRA 2XD5A 4YINA 4E3KA 4NK3A 4P87A 1ESUA 4JKTA 4BQMA 2ZQ7A 1BUEA 3BEBA 2XR0A 1EROA 3N8LA 1RGYA 4GDNA 4ZDXA 2WGIA 3NDGA 2Y2MA 5CECA 1KDWA 5CTNA 1CEGA 2Y2NA 4JF4A 4KZ9A 4DXCA 1WE4A 3AGFA 4C6YA 3O88A 3BLMA 4DE3A 5E43A 3UPNA 2QPNA 3A3DA 2Z2LB 5CEBA 1ERMA 2WGWB 1H8ZA 4FD8A 5FAOA 3A3EA 5CHJA 5M1AA 2CC1A 4B88A 4DDYA 3A3IA 2WADA 3VOYA 4MNRA 4ZAMA 1PYYA 4P85A 3P98A 1ERQA 3HVFA 3ZG0A 1FR6A 3WS5A 4Y0UA 2Y2KA 1ONGA 1MWSA 2ZC7A 4CJNA 1MKIA 4DKIA 4X6TA 2XF3A 4GNUA 3OC2A 4A5RA 2WKHA 3AGDA 3ZFZA 3MBZA 4ZJ2A 1K55C 5TR7A 3G4PA 5CGXA 1K55A 5FQJA 1K56D 3C5AA 3UDFA 1U60A 1LLBA 5DF8A 3W4QA 3WS0A 1KDSA 1MPLA 4PM9A 1E3UD 2JBFA 2WKIA 1BSGA 3PTEA 2XFSA 3HLWA 3B3XA 5DVAA 2H10A 2Y4AA 1IYPA 3HBRA 3LY4A 1GA9A 1PI4A 1KE0A 3FZCA 2HDRA 2EX2A 5E2FA 3LEZA 3OPPA 3OPLA 1GCEA 4UA7A 3PBQA 2ZD8A 4MBFA 5FAQA 4BLMA 3UE3A 4OOMA 5EPHA 3SS4A 4OONA 1WYCA 2J9OA 3O87A 3G30A 4O7DA 3WS1A 4GD8A 2Y2LA 1KE3A 4UHUA 3HLEA 3VP0A 4BL2A 2EFXA 4KQOA 1J9MA 3NCKA 1PWGA 4QB8A 1XGJA 2G2WA 1SDNA 4C75A 4KZ6A 4QY6A 4JF6A 5FSRA 1OMEA 5FI2A 1BTLA 3CMZA 1K57A 2X71A 3WWXA 1DY6A 1S0WA 1IEMA 3HLGA 1M40A 1I2SA 1FQGA 1GHIA 3GRJA 3ZVTA 4RX3A 4E6XA 3VSLA 5TGFA 1IYQA 5DTSA 3UN7A 1N4OA 4Y0OA 1FCOA 4N1HA 5IHVA 1FCMA 2PU2A 5EVIC 3DWKA 1E3UA 1YM1A 1K4EA 4R3BA 3W4PA 1JWVA 2IWCA 3CZDA 5EVIA 4B4ZA 1JVJA 5F1FA 5J8XA 4DXBA 1LHYA 1W8QA 3E2LA 2EX8A 3IF6C 1K6SA 5M19A 4DDSA 1HD8A 1FSWA 2QMIA 2XH9A 3IF6A 1ALQA 3P09A 1ES4A 2ZC4B 4PM7A 1YQSA 4OVDA 3ZNYA 1LI9A 4FCFA 4KZ3A 1NRFA 4DE2A 4N9LA 4OLGA 4BD1A 1CK3A 1ES3A 3OCNA 3PBRA 2XD1A 3ISGA 4HESA 5HX9A 4DF6A 1YLYA 2J7VA 4FH2A 5EUAA 4MEZA 2J9PA 1E25A 3A3JA 4N9KA 5DTKA 5CRFA 4S2NC 5A92A 5HW3A 4D2OA 1IYOA 2XFTA 4IVIA 3S22A 3V3SA 4K0WA 4E3IA 1TVFA 2VGJA 4LV3A 1YLTA 3NC8A 3WS2A 1VM1A 1ZG6A 4WYYA 4KG6A 5FQ9A 1KGGA 1NJ4A 1KGEA 2V1ZA 4OOLA 4WEKA 4R23A 5CTMA 2XGNA 3LY3A 2Y91A 3W8KA 5CGWA 5U47A 1G6AA 3GTCA 4WMCA 1YMSA 5F83A 1I2WA 3VMAA 4DE1A 4GOGA 4N1XA 5GLAA 3IHBA 5CERA 1K4FA 3C4PA 4S2MA 5GHZA 1IYSA 2Y2QA 1LI0A 1Y54A 5F1GA 4JXSA 1Q2QA 3MZDA 2Y2OA 4OKPA 3SS5A 4UAAA 1I5QA 4BENA 4Q8IA 2HP5A 4RX2A 2H0YA 3WS4A 1QMFA 3I7JA 4XXRA 5EE8A 1XXMA 3HUNA 3UDIA 2HP9A 4LV0A 4EBLA 3UY6A 2Q9NA 3GVBA 1BULA 3RJUA 1RP5A 2ZQCA 3DW0A 1N9BA 4ZJ3A 2EFUA 4R4RA 3IQAA 3N6IA 3PBNA 4PM5A 3JYIA 4S2IA 1O07A 3G2YA 3G34A 3HLCA 4LV2A 3UO9A 1AXBA 2DNSA 4S2LA 5E2HA 5TFQA 4KZ8A 2GDNA 1YLPA 1NYMA 3VP2A 4LCMA 1XA7A 4NETA 5EVID 5FAPA 3MFDA 4M3KA 5FI7A 2XK1A 3NI9A 5GLCA 2OSUA 1LL9A 3NBLA 2PBYA 3IXGA 2WZZA 2FFFB 1YLZA 2XDMA 1C3BA 4KQQA 4KZ7A 3VSKA 4B4XA 1ES2A 2R9WA 4K0XA 5JYOA 5A91A 5G18A 4F94A 4WM9A 4P6BA 3M6BA 4JLFA 3PAGA 4OQIA 3C7UA 4PM6A 2BLSA 4DRTA 1LL5A 4X69A 1PI5A 4KZBA 4E3OA 1YLWA 3M2KA 3E2KA 3HLFA 3IWOA 4EQIA 5AQAA 2EXAA 3N8SA 4EV4A 4X55A 4PMAA 2WZXA 3PBTA 1EWZA 3ZG5A 1PZPA 5GHXA 3M2JA 4LV1A 2UWXA 1GHPA 2A49A 3IF6B 5GHYA 2HPBA 1Q2PA 5CHUA 4WMCD 2JCHA 4KG2A 3BFGA 3EQVA 3VFFA 4BJPA 4QU3A 1PWDA 4OPRA 4WBGA 3M6HA 1TEMA 1L0FA 1ES5A 3PBSA 2Z2MB 1BLHA 2Y2PA 3IXHA 3MXSA 2QZ6A 4PPRA 3C4OA 2Y2JA 5KSCA 2Y2IA 1FCNA 4OH0A 4U3TA 3GV9A 4Z9QA 1JTDA 2BG1A 1XA1A 2HDUA 2EX9A 4R1GA 1XPBA 3C7VA 3SH9A 2P9VA 5AQ9A 4LENA 4E3MA 4WELA 3VP4A 1FR1A 3QHYA 4ZBEA 1SKFA 1HZOA 2XQZA 4FH4A 1FSYA 4R3JA 5L2FA 1MWUA 2RCXA 3GSGA 4S2JA 1TDLA 2ZQDA 2ZC6B 5FDHA 5GLDA 2ZM8A 3ZVWA 5CGSA 5CEDA 2Y59A 4X68A 1JWPA 2FFYA 3BLSA 2C6WB 5E2GA 1QMEA 2OV5A 2JC7A 3Q07A 3OPRA 5KSHA 4GZBA 1K38A 2I72A 3MXRA 4XUXA 2IWDA 1IELA 3MZFA 3SOIA 3HLDA 3IF5A 3OZHA 3IXDA 3DTMA 4S2NA 4YFMA 4IEDA 1Z6FA 3GMWA 3ZDJA 3Q7VA 5KMWA 1SDEA 1K54C 2ZLYA 2ZQAA 1W79A 3LO7A 2WUQA 1K54A 5CXWA 3VP3A 3DWZA 1CEFA 1L2SA 3ZCZA 5EOEA 3S1YA 3O86A 1XP4A 3HUOA 5D3OA 3V50A 5AQBA 4RA7A 4WZ5C 3AGEA 1JTGA 2OLVA 2WKEA 2R9XA 3IT9A 4OPYA 3VOZA 1W7FA 4GDBA 4GKUA 5EOOA 1E4DA 4RVAA 5EVLA 3TOIA 5FQKA 1SHVA 4E3JA 1PW8A 3G2ZA 4RYEA 3LCEA 1MBLA 2E8IA 3Q82A 3Q81A 4KZ5A 1NYYA 2V2FF 1YLJA 2ZC5B 5FQMA 4S2PA 3UPOA 3Q7ZA 3VP1A 1DJAA 2EXBA 1BLPA 4QJGA 5FQIA 3RXWA 3HUMA 3VFHA 2EX6A 2ZC3B 4EBPA 4OPZA 2G2UA 3GR2A 3TSGA 3G32A 4QD4A 1ZC2A 4R0QA 5FASA 2P74A 1MXOA 1ZKJA 1S6RA 1XGIA 5FI6A 3V5MA 1VQQA 2X02A 3HREA 1PZOA 4S2KA 5A93A 2ZQ8A 3FWLA 3N7WA 2RL3A 2ZQ9A 3V39A 3ZG7B 1H8YA 3ITAA 3BFFA 4JBFA 3WRZA 3A3FA 3FKWA 1XX2A 5HARA 3NY4A 2XLNA 2HDSA 1YT4A 1HTZA 2PU4A 4WEJA 4GB7A 1W5DA 3UDXA 1CI8A 1RGZA 1XKZA 5HFOA 5A90A 5BOHA 1BT5A 3QNBA 3V3RA 3PAEA 2HP6A 2IWBA 1NZOA 5M18A 2B5RA 2H0TA 1BZAA 1KVMA 2WK0A 1JWZA 2VGKA 4L0LA 4Y7PA 3ZG9B 3MKEA 4OQGA 2WGWA 3ZGAB 4CPKA 1BLCA 1NXYA 2ZMAA 4U0XA 2ZM0A 3CJMA 4JXVA 4MBKA 2OLUA 2X01A 1GA0A 3CG5A 3RXXA 2Y2GA 3BYDA 4IBRA 2H5SA 4OPQA 4JPMA 3W4OA 3N4IA 4HBUA 5EVIB 5I94A 3Q1FA 4E3NA 3BECA 3PBOA 5FA7A 2P9VB 1DJCA 3OPHA 4OQHA 3HLBA 4KENB 4GD6A 4MBHA 1CI9A 1MY8A 5AQ7A 5DF7A 4C3QA 2V20A 1FOFA 2Q9MA 2DCFA 2Y55A 3ZG8B 5CHMA 3IH8A 4ID4A 1H5XA 3SH7A 4N92A 4PM8A 4ZTKA 5KZHA 2HDQA 4FSFA 1ESIA 3IWIA 4R4SA 1PWCA 2ZJ9A 4WZ4A 5DF9A 1KVLA 1IKGA 1EI5A 2ZM2A 3IXBA 4OQ0A 1MWTA 4LCLA 3IHAA 4KG5A 3N8RA 5FATA 1WYBA 3ZNTA 3ITBA 3MKFA 1GHMA 1L0EA 1YMXA 4JXWA 1TDGA 4X56A 4JXGA 3OCLA 3TG9A 2WAFA 3BRMA 1K57C 5GLBA
chains in the Genus database with same CATH superfamily
4KZAA 4R6LA 2C5WB 2W3DA 3R7WA 1M6KA 2WAEA 1W8YA 2K7SA 2OOLA 4E6WA 4JGPA 1PW1A 4K91A 5HD3A 3T4OA 1UGUA 3P7NA 5E2EA 3K3DA 3LR4A 1H8MA 3CUEA 3UNWA 4EWFA 4OP8A 2WGVA 1XJ6A 1G5UA 3IH9A 4UA6A 2YKHA 1VB6A 1Y28A 3E98A 4S0KA 3S4XA 1OPXA 4EUVA 3SS3A 4KQRA 2D02A 4NK3A 2XR0A 3KO6A 4ZDXA 2Y2MA 4EQ1A 4GS9A 5CTNA 1WA9A 5EM0A 1CEGA 1A0KA 1F9IA 4DE3A 4DMZA 4RRBA 1ERMA 4FD8A 1H8ZA 5FAOA 1S4SA 3A3IA 4NXFA 3ZG0A 4GNUA 4PAUA 2B18A 1SZVA 3MBZA 4ZJ2A 2VA0A 5FQJA 3CLOA 2K31A 1KDSA 2Y8HA 1E3UD 2XFSA 4RRIA 1IYPA 1DP9A 5HSQA 3BY8A 2HL2A 2ZL1A 1GCEA 5FAQA 2LB5A 4OOMA 4S0JA 3KO3A 5EPHA 4DJ3A 4OONA 3MR0A 2Y2LA 1KE3A 2PRFA 3HLEA 1GSWA 2EFXA 5DFXA 3NCKA 5HWTA 1Y4OA 5L07A 1YSPA 2A24B 5FI2A 3LGOA 1IEMA 4EETB 1GHIA 3GRJA 4AFIA 3VSLA 5TGFA 1S66L 4Y0OA 1W63Q 1E3UA 1K4EA 1JWVA 2IWCA 3CZDA 4B4ZA 1LL8A 1LHYA 1K6SA 5M19A 2BASA 3IF6A 1ALQA 3ZNYA 1LI9A 4FCFA 4Y17A 5CX7A 4KZ3A 5A8BA 4DE2A 4OLGA 2INWA 1ES3A 3GECA 3PBRA 5HX9A 2J7VA 2PYRA 5EUAA 4S2NC 4NXBA 2XA7S 4S03A 2XFTA 5J61A 4K0WA 5FEGA 2V8FA 3NC8A 3WS2A 3C38A 1KGGA 4WEKA 1OJGA 3F1NB 3W8KA 2PD8A 2J3WA 4GOGA 5GLAA 3IHBA 5CERA 4EW7A 3EWKA 5GHZA 1IYSA 3L9KA 2HL1A 2GJ3A 4Q0HA 2B02A 3SS5A 4UAAA 1I5QA 4RX2A 4NG2A 2H0YA 3LI8A 3WS4A 3KOBA 1XXMA 2FH5A 3RJUA 2ZQCA 3DW0A 1N9BA 3UB9A 2EFUA 2OKVA 4I3JA 3JYIA 3NOPC 1VETB 4GCZA 4S2IA 2JKRM 3TW8A 5E2HA 3QP6A 2HF6A 5FAPA 3MFDA 5FI7A 3NI9A 1LL9A 3H7WB 4EBPA 3U2AA 2I9VA 1S1YA 4B4XA 4OQIA 2OWJA 2BLSA 3QP5A 5HPFA 3E4OA 4JGRA 4E3OA 1YLWA 1G6OA 2Y79A 4PMAA 1VEUA 4Z1WA 2WKRA 3M2JA 2PYPA 4WMCD 2JCHA 2QKPA 4KG2A 5G4YA 5J3WA 2HGVA 2Y2PA 2QZ6A 5KSCA 4OH0A 3GV9A 4Z9QA 2B95A 3LIBA 2HDUA 3E0YA 4E3MA 1SKFA 4R3JA 4RRJA 2RCXA 5GLDA 3ZVWA 5CEDA 2K2NA 5CGSA 2FFYA 2OV5A 3Q07A 5KSHA 4E04A 3KO4A 4LPZA 3OZHA 4S2NA 1Z6FA 2L4RA 1K54C 4O0PA 1Z09A 5CXWA 4DE0A 1CEFA 1XP4A 3HUOA 3PXPA 3C8CA 4RA7A 4H6JA 4WZ5C 2OLVA 2WKEA 3VOZA 4OPYA 4GKUA 3TRCA 1GSXA 1SHVA 3QP8A 4E3JA 4NXEA 2E8IA 1J7GA 3Q7ZA 2EX6A 1BYWA 3TSGA 3G32A 4RRAA 4K08A 2V0UA 5I5LA 4RRCA 3FWLA 3N7WA 3OLOA 2WKQA 3DAVA 3SZTA 3B47A 3WRZA 1DRMA 1LT0A 2XLNA 1YT4A 1HTZA 1NLZA 4WEJA 4GB7A 2D01A 1XKZA 1NZOA 1KVMA 3ZG9B 1MZUA 4OQGA 3ZGAB 2HV1A 3QP2A 1BLCA 1TS8A 4U0XA 2ZM0A 1GA0A 4WL9A 4IBRA 3MQOA 4OPQA 4JPMA 3W4OA 4HBUA 3MS6A 1DJCA 4GD6A 2MJ6A 2V20A 1T18A 2DCFA 4RQ9A 4G3WA 4PM8A 5KZHA 4NBJA 4FSFA 1JKEA 1PWCA 5DF9A 1H0MA 2ZM2A 4OQ0A 4ME4A 3ITBA 1GHMA 1L0EA 3EOIA 1TDGA 4X56A 3OCLA 2WAFA 5HDSA 1LSXA 5GLBA 4EUZA 3WRTA 3EEAA 4ZJ1A 3Q7VB 4H8RA 3D72A 1TD5A 4Y13A 5HAIA 5GL9A 4EESA 3KNFA 1PIOA 4E3LA 1BLSA 4X53A 5FQQA 4GJ4A 4KZ4A 3ICYA 3FV7A 4GW9A 1N9NA 3FC7A 1NLYA 4L9EA 3UE6A 3BM6A 2A24A 5FDSA 3JPUA 3GQZA 1K6RA 4WZ5A 3UE1A 4R38A 3ZHHA 4FTXA 3T4QA 3EQUA 2XD5A 4YINA 4E3KA 4P87A 1ESUA 1PRQA 3BEBA 3UMDA 3UB5P 2WGIA 3NDGA 4FUWA 4X25A 5CECA 3PD3A 4JF4A 4DXCA 3AGFA 3O88A 5E43A 2QPNA 2Z2LB 4YWZA 4NBIA 2WGWB 4DDYA 1VHMA 2WADA 3VOYA 2W1RA 1PYYA 3P98A 4KUKA 3KX0X 3HVFA 3T1SA 4Y0UA 3F1NA 4RR7A 1ONGA 1MWSA 4CJNA 4DKIA 4X6TA 4A5RA 2EWWA 3NOUC 3AGDA 3ZFZA 5L10A 1K55A 5DF8A 2OWHA 3W4QA 3NHQA 2JBFA 3KYQA 4YNRA 3PTEA 5DVAA 2PT7A 3HBRA 3LY4A 1PI4A 2NUTC 5HPIA 3KSHA 2EX2A 4BMWA 3LEZA 2H28A 3S7PA 4BLMA 1NWZA 1VETA 2J9OA 3WS1A 1YAXA 1J3WA 4GD8A 3GDIA 4Y2FA 4F3LB 1PWGA 1XGJA 3T50A 3H7WA 5FSRA 1T1CA 4FOFA 3WWXA 1T1BA 2WKPA 3ZVTA 4H6JB 4RX3A 4E6XA 1IYQA 3UN7A 3LEQA 3LYXA 3CI6A 2PU2A 4R3BA 5EVIA 1TF1A 4DXBA 4Y5FA 3E2LA 1H3QA 3IF6C 4D60A 1HD8A 3P09A 1FSWA 4PM7A 2GX5A 1ES4A 1YQSA 4OVDA 2BTFP 3H9WA 1P0ZA 3MSHA 4BD1A 1CK3A 3LIEA 2ZMFA 3KSFA 1YLYA 1E25A 3A3JA 4N9KA 5DTKA 1ZTUA 3V3SA 3V67A 2QJ5A 4LV3A 1VM1A 1NJ4A 1KGEA 4HJ6A 3CITA 1YMSA 4DE1A 1I2WA 4UQIS 3IX8A 3LICA 4S2MA 2QJ7A 3K3CA 1LI0A 5F1GA 4JXSA 1Q2QA 2Y2OA 4OKPA 1T19A 3EGXC 4JGQA 4ETXA 3ZYTA 3S7NA 4EBLA 3JVUA 3UY6A 2Q9NA 1BULA 2QWSA 4PHTA 1O07A 3UO9A 2HKZA 2GDNA 3VP2A 3KYEA 4WN5A 3PYPA 2OSUA 3NBLA 4KQQA 2PBYA 2WZZA 2FFFB 1YLZA 3S7OA 1C3BA 3LUQA 3VSKA 1ES2A 1DP8A 5JYOA 5G18A 4WM9A 4P6BA 4RRHA 3M6BA 2QHKA 4S0LA 1XFQA 3E4PA 5HDCA 4EQIA 5AQAA 3CWFA 2EXAA 4WUJA 2WZXA 3PBTA 4LV1A 2A49A 4DN0A 3EQVA 3KYZA 1PWDA 4OPRA 4WBGA 3M6HA 1L0FA 2Z2MB 3MXSA 4EEPA 2O9BA 2Y2JA 4R1GA 3SH9A 3NOTC 3QHYA 1HZOA 4FH4A 5L2FA 1MWUA 1TDLA 2ZQDA 2ZC6B 3KSGA 3PD2A 2AVXA 1JWPA 3DTKA 5TBMA 3UB7A 2JC7A 2VX8A 5DFYA 4GZBA 1K38A 2I72A 1IELA 3HLDA 3IF5A 3F1PB 1HLUP 3DTMA 1XJ3A 3Q7VA 5KMWA 3T12B 3LO7A 2WUQA 3VP3A 5D3OA 3V50A 1JTGA 2J3TC 4BWIA 4GDBA 3MXQA 1E4DA 4RVAA 5FQKA 5J7EA 1ACFA 1PW8A 2JKTI 2Q0OA 3Q81A 2V2FF 4KUOA 4UQIM 2ZC5B 4XT2B 3VP1A 1BLPA 5FQIA 3RXWA 3VFHA 2ZC3B 1PFLA 4RRDA 2G2UA 4HJ4A 4PKYA 4QD4A 1ZC2A 3KO5A 5FASA 3F1OA 5FI6A 3V5MA 3DTIA 4S2KA 5A93A 1P97A 2RL3A 3ZG7B 3ZQ5A 1H8YA 1YPRA 3BFFA 4JBFA 1XX2A 2VKSA 3NY4A 2HDSA 4L9GA 3S7QA 3T4JA 4UEYA 4II7A 1V9YA 5BOHA 1BT5A 3QNBA 3V3RA 3PAEA 2IWBA 5M18A 4L0LA 4Y7PA 3HJKA 2WGWA 2EWVA 4WF0A 4HNBA 4B93A 1NXYA 3CJMA 4HIAA 2X01A 3CG5A 2Y2GA 3BWLA 5DKKA 4ESPA 3N4IA 5EVIB 3Q1FA 3BECA 5FA7A 2P9VB 3LIFA 2VZWA 5DF7A 2J3TD 5CHMA 4ID4A 3LR0A 1JNUA 4N92A 4ZTKA 3H82B 2HDQA 1ESIA 3IWIA 4R4SA 4WZ4A 4RRQA 3IXBA 3ZNTA 3IHAA 3MKFA 4EERA 4LRZE 2JHEA 4ZRRA 3BRMA 4MLLA 3UE0A 3QNCA 1IKIA 2JKGA 3PHYA 2KLIA 5HL6A 2R78A 3FYZA 3SH8A 4BD0A 1PNEA 4QPRA 5IU1A 4LGWA 3EEHA 1X0OA 2JE5A 1ONHA 2E8JA 4QHCA 4IVKA 1K56A 4EBNA 1HVBA 4F3LA 3BFDA 2Y2HA 4OP5A 1TC5A 5JYPA 2M7UA 1EW0A 1KGFA 2XEPA 4IBXA 5F69A 3FKVA 4BL3A 4JF5A 4OOYA 1G68A 1NY0A 1KE4A 3BFEA 5K5BA 5HAPA 5EECA 4P0MA 2J8YA 2O9AA 2WYXA 1IFQA 3O3VA 1TS7A 2DRWA 4I3AA 4HEFA 4I38A 4CLCA 3NIAA 5AJGA 4S2OA 3G31A 4QY5A 4UA9A 2P7JA 3G35A 1NZUA 4BQMA 2FZ0A 1EROA 4G3VA 2GNXA 3G6OA 4BBVA 1KDWA 4MDZA 4EU0A 2Y2NA 3T1RA 1WE4A 1CJFA 3BY9A 3A3EA 5FEFA 4QWOA 4ZAMA 1ERQA 2GZAA 1MC0A 1NRJA 1N9OA 1FR6A 1MKIA 4MN7A 4LFUA 1K55C 5CGXA 2V0WA 3C5AA 1U60A 3WS0A 4PM9A 2WKIA 4DJ2A 3HLWA 3P01A 2IA2A 3E4QA 2Y4AA 1KE0A 1DP6A 5E2FA 3OPPA 2UV0E 4UA7A 2ZD8A 5DKLA 1WYCA 2PDRA 4P6ZM 4HP4A 5TBMB 3NJAA 4KQOA 1SKOB 3LFVA 4Q0JA 4Q0IA 3HCYA 3DTEA 2G2WA 1SDNA 2L1MA 3C2WA 4C75A 3UMEA 4JF6A 2QYBA 1BTLA 3CMZA 3CPTB 2X71A 3U4LP 1DY6A 1F5MA 1S0WA 1M40A 2W3FA 1I2SA 5DTSA 1N4OA 1FCOA 4N1HA 1FCMA 4BBUA 2VGLM 5EVIC 3DWKA 4NXGA 1YM1A 3W4PA 3C30A 5HWVA 1JVJA 3OOVA 5HDDA 1FIKA 1W8QA 2Z6CA 2EX8A 3OBFA 1UWPX 2VJWA 4N9LA 1CQAA 1OTDA 3F1OB 3OCNA 4DF6A 3MQQA 4CLCE 5CRFA 4D2OA 1IYOA 5AVFA 4E3IA 1TVFA 1P9WA 1ZG6A 4OOLA 4R23A 2XGNA 2Y91A 5CGWA 2HZ5A 2JN7A 5U47A 2W3HA 5EVEA 4N1XA 4M4XA 1K4FA 3C4PA 2CMNA 2Y2QA 5HWWA 5TJJA 3F1PA 2HP5A 3MQ0A 3HUNA 2HP9A 4LV0A 2W1TB 1RP5A 4ZJ3A 3TE8A 3N6IA 3PBNA 2OAQ1 4PM5A 3G34A 3HLCA 4LV2A 4KZ8A 1K0KA 1NYMA 4LCMA 4Y15A 1S4RA 1XA7A 5EVID 4XT2A 2VV7A 2XK1A 4KZ7A 3IXGA 2XDMA 3PD5A 1Y2QA 4NKPA 5A91A 4F94A 4IJGA 4JLFA 3PAGA 2W0NA 1YKDA 2W3EA 4HP9A 4PM6A 4DRTA 1PI5A 4KZBA 3M2KA 3HLFA 3IWOA 3K2NA 4MCWA 4EV4A 3ZG5A 5GHXA 3T4TA 2HPBA 1Q2PA 5CHUA 3MFXA 3BFGA 3VFFA 3RH8B 4CLCB 4JGOA 3BJNA 3IXHA 2W27A 4PPRA 2PBDP 5LBRA 4U3TA 3ULFA 4HOIA 2EX9A 1XPBA 3C7VA 2P9VA 5AQ9A 4LENA 3VP4A 1FR1A 4RRRA 2XQZA 4MN6A 4S2JA 2C6WB 5E2GA 3H82A 3OPRA 2LB9A 3SOIA 4R3AA 3UB8A 2O0YA 3GMWA 3NECA 3ZDJA 2A2LA 3DWZA 1L2SA 5EOEA 4MMNA 3O86A 3S1YA 1T1AA 1D1JA 1OTAA 1G28A 3AGEA 2ZBBA 2V9AA 3T4LA 3O5YA 3IT9A 1W7FA 5EVLA 4B9OA 2Z6DA 3G2ZA 4RYEA 3LCEA 1MBLA 1NYYA 2ZMVA 3UPOA 2EXBA 3NULA 3HUMA 4ETZA 1XJ2A 1MXOA 1ZKJA 1S6RA 3FG8A 2X02A 2ZQ8A 4I5SA 2XRNA 3V39A 3ITAA 3A3FA 3FKWA 1LSWA 2J80A 4GHIB 5L8MA 2PU4A 3L7HA 1W5DA 1CI8A 5A90A 5F68A 2M7VA 2H0TA 1ZHHB 1JWZA 5AVEA 3MKEA 2PAVP 5HD5A 4CPKA 3KOCA 3VOLA 2H5SA 5I94A 3PBOA 3OPHA 1STZA 4OQHA 4KENB 4HJ3A 4HY8A 3ZG8B 4BBTA 1H5XA 5L09A 3SH7A 3RTYA 4RRLA 4Y3IA 2DBOA 1KVLA 3D9YA 1EI5A 5FATA 1MWTA 4LCLA 4KG5A 2V8CA 1MKMA 3IBRA 3IX4A 4JXGA 1K57C 2JKTM 3BFCA 1MWRA 1K25A 3KO9A 1L0GA 3NDEA 2VLGA 4X1LA 1O7EA 1ZG4A 1RCJA 2KDKA 1SCWA 3BW6A 4XUZA 3KSIA 5F82A 4RRMA 1SKOA 2G7UA 3HL9A 4RRFA 5F6AA 3IWQA 4OLDA 3CPTA 4Y0TA 1DJBA 4NEED 4CLCC 3D4FA 4HBTA 3T1QB 1D06A 4HH3A 3UPPA 5DTTA 3MZEA 1IOUA 2A3UA 5HAQA 4GN2A 4U0TA 5HL1A 1L0DA 2KOIA 4JKTA 4RRKA 2ZQ7A 1BUEA 4LRYC 3N8LA 1RGYA 4GDNA 1TS0A 4L9FA 4KZ9A 1OTBA 4HH2A 4C6YA 3BLMA 1UWNX 3UPNA 3A3DA 3KNPA 5CEBA 4ARZB 5CHJA 5M1AA 2CC1A 4PKYG 1FILA 4B88A 4MNRA 4P85A 3D3OA 3WS5A 1KOUA 2Y2KA 3LR5A 2OAP1 2YKFA 2ZC7A 2XF3A 3OC2A 1F2KA 2M1CA 2WKHA 5TR7A 3G4PA 3UDFA 1K56D 3IS2A 4KQDA 1LLBA 1MPLA 1BSGA 2L0WA 3B3XA 2H10A 3B33A 1GA9A 2W1TA 3FZCA 4P6ZS 2HDRA 3HJIA 4EXOA 3OPLA 3PBQA 4MBFA 4CLCD 3UE3A 3R7WB 3SS4A 3O87A 3G30A 4O7DA 4UHUA 3VP0A 4BL2A 4RR9A 1J9MA 2PD7A 2NUPC 3VE3A 3MF0A 4QB8A 1CF0A 4KZ6A 4QY6A 4HQAA 3W2ZA 1OMEA 2JKRI 4LLOB 5IS1A 4IUHA 4MN5A 2VGLS 1K57A 2W3GA 5MC7A 3HLGA 1N9LA 3IBJA 1FQGA 1YSQA 3VV4A 3T1XA 2XROA 4GLQA 2VEAA 5IHVA 5F1FA 5J8XA 1TS6A 4WLAA 2VK3A 3CAXA 4DDSA 2XH9A 2QMIA 2ZC4B 3UB6A 3EGDC 4GS9B 5J4EA 3CHWP 1NRFA 1S67L 3LIAA 5KIZA 2P04A 5DJTA 2XD1A 3ISGA 4HESA 4FH2A 4EEUA 4MEZA 2J9PA 4I39A 5A92A 2VV8A 5HW3A 4IVIA 3QP1A 3S22A 2XSSA 2VGJA 1YLTA 2PHYA 5EV0A 4WYYA 4KG6A 5FQ9A 2V1ZA 5CTMA 3LY3A 3LIDA 4IHQA 1G6AA 3GTCA 4WMCA 4IUKA 2XA7M 5F83A 3VMAA 3T4SA 3TJZC 3QP4A 1Y54A 3PR6A 3MZDA 4BENA 4Q8IA 1QMFA 3I7JA 4XXRA 5EE8A 3UDIA 3GVBA 4HHDA 2O99A 2ZL1B 4R4RA 3IQAA 5EFWA 1W63M 2PR6A 4RRGA 3G2YA 1AXBA 2DNSA 4S2LA 5TFQA 4X1MA 2ZOIA 1YLPA 3A0RA 4NETA 4M3KA 3R4KA 3MJQA 5GLCA 2HL0A 3BQ8A 3LMVA 4YOFA 2EA9A 4LRXC 2R9WA 4K0XA 3KODA 3C7UA 4CQHA 1LL5A 2HJ9C 4X69A 5G4ZA 3E2KA 1XFNA 1OTIA 3N8SA 4GHIA 3RFBA 4X55A 1EWZA 1OT9A 1PZPA 1L3LA 2UWXA 1GHPA 3IF6B 5GHYA 4BJPA 4QU3A 4O01A 2HJEA 2JKFA 1TEMA 1ES5A 3PBSA 1BLHA 4G3KA 3T4KA 3A0VA 5FL3A 3C4OA 2Y2IA 1FCNA 1JTDA 2BG1A 4R70A 1XA1A 4RR6A 1D7EA 3LR3A 4WELA 1P9RA 4ZBEA 2KX6A 1FSYA 3GSGA 5FDHA 2ZM8A 2Y59A 4X68A 2O9CA 3BLSA 1QMEA 1GSVA 2VV6A 4XUXA 3MXRA 2IWDA 3MZFA 3PD4A 1V9ZA 3BQAA 3IXDA 2ACGA 3CUEC 4YFMA 4IEDA 1S1ZA 1SDEA 2ZQAA 2ZLYA 1W79A 3ZCZA 1K54A 3IX3A 1XJ4A 3KO7A 3LI9A 5AQBA 2R9XA 5EOOA 3TOIA 4HI4A 1OTEA 3VE4A 3IS2B 4RR8A 2P08A 5EM1A 3Q82A 4KZ5A 1YLJA 5FQMA 4S2PA 1DJAA 4QJGA 4OPZA 3GR2A 5F5YA 4R0QA 2P74A 1XGIA 5C5KA 3JVVA 1VQQA 3HREA 1PZOA 5DJUA 2ZQ9A 4O8GA 1OT6A 1LSVA 3SW1A 5HARA 2PR5A 1VEUB 3UDXA 3LMTA 1RGZA 5HFOA 2HP6A 2B5RA 1BZAA 2WK0A 2VGKA 3A0SA 3DBAA 1AWIA 4ARZA 3FPVA 2ZMAA 4JXVA 2DMWA 2OLUA 4I3IA 4MBKA 1ODVA 5HZHA 3RXXA 3BYDA 5IT5A 4E3NA 4S0IA 2V1BA 2ZOHA 3HLBA 4MBHA 1CI9A 1MY8A 3FPWA 5AQ7A 3MMHA 4S02A 4C3QA 1FOFA 2Q9MA 2Y55A 3IH8A 2V1AA 3B42A 3LMUA 2ZJ9A 1IKGA 1F98A 3N8RA 1WYBA 1OJ5A 1YMXA 4JXWA 3TG9A
chains in the Genus database with same CATH topology
4EUZA 3WRTA 4MLLA 3UE0A 4ZJ1A 3Q7VB 1IKIA 3QNCA 4H8RA 4KZAA 3BFCA 1MWRA 5HAIA 5GL9A 2C5WB 3FYZA 1K25A 3KO9A 1L0GA 3SH8A 3NDEA 4BD0A 3KNFA 1PIOA 1M6KA 4E3LA 1O7EA 2WAEA 1BLSA 1ZG4A 2JE5A 4X53A 1ONHA 1W8YA 5FQQA 4QHCA 1RCJA 4XUZA 1SCWA 1K56A 4IVKA 5F82A 4E6WA 4EBNA 4RRMA 1PW1A 4K91A 1HVBA 4KZ4A 3BFDA 2Y2HA 3FV7A 4OP5A 1TC5A 5JYPA 1KGFA 2XEPA 3BM6A 3HL9A 4IBXA 3FKVA 5E2EA 4BL3A 4DE0A 4JF5A 4RRFA 4OOYA 1G68A 1NY0A 1KE4A 3UNWA 4EWFA 3GQZA 3IWQA 4OLDA 4OP8A 3BFEA 2WGVA 5HAPA 1K6RA 5EECA 4Y0TA 4P0MA 2J8YA 1DJBA 2WYXA 3IH9A 4UA6A 3O3VA 3D4FA 2DRWA 4HBTA 4HEFA 4S0KA 3S4XA 3UPPA 5DTTA 3MZEA 3NIAA 4WZ5A 3UE1A 2A3UA 5HAQA 4GN2A 4S2OA 4U0TA 3G31A 4QY5A 4UA9A 3SS3A 3ZHHA 1L0DA 3G35A 5HL1A 1NZUA 3EQUA 4KQRA 2XD5A 4YINA 4E3KA 4NK3A 4P87A 1ESUA 4JKTA 4BQMA 4RRKA 2ZQ7A 1BUEA 3BEBA 2XR0A 1EROA 3N8LA 1RGYA 4GDNA 4ZDXA 2WGIA 3NDGA 2Y2MA 5CECA 1KDWA 5CTNA 3PD3A 1CEGA 2Y2NA 4JF4A 4KZ9A 4DXCA 1WE4A 3AGFA 4C6YA 4RRBA 3O88A 3BLMA 4DE3A 5E43A 3UPNA 2QPNA 3A3DA 3KNPA 2Z2LB 5CEBA 1ERMA 4NBIA 2WGWB 1H8ZA 4FD8A 5FAOA 3A3EA 5CHJA 5M1AA 2CC1A 4B88A 4DDYA 3A3IA 2WADA 3VOYA 4MNRA 4ZAMA 1PYYA 4P85A 3P98A 1ERQA 3HVFA 3ZG0A 1FR6A 3WS5A 4Y0UA 4RR7A 2Y2KA 1ONGA 1MWSA 2ZC7A 4CJNA 1MKIA 4DKIA 4X6TA 2XF3A 4GNUA 3OC2A 4A5RA 2WKHA 3AGDA 3ZFZA 3MBZA 4ZJ2A 1K55C 5TR7A 3G4PA 5CGXA 1K55A 5FQJA 1K56D 3C5AA 3UDFA 1U60A 1LLBA 5DF8A 3W4QA 3WS0A 1KDSA 1MPLA 4PM9A 1E3UD 2JBFA 2WKIA 1BSGA 3PTEA 2XFSA 3HLWA 3B3XA 5DVAA 4RRIA 2H10A 2Y4AA 1IYPA 3HBRA 3LY4A 1GA9A 1PI4A 1KE0A 3FZCA 2HDRA 2EX2A 2HL2A 5E2FA 3LEZA 3OPPA 3OPLA 1GCEA 4UA7A 3PBQA 2ZD8A 4MBFA 5FAQA 4BLMA 3UE3A 4OOMA 4S0JA 3KO3A 5EPHA 3SS4A 4OONA 1WYCA 2J9OA 3O87A 3G30A 4O7DA 3WS1A 4GD8A 2Y2LA 1KE3A 4UHUA 3HLEA 3VP0A 4BL2A 2EFXA 4KQOA 4RR9A 1J9MA 3NCKA 1PWGA 4QB8A 1XGJA 2G2WA 1SDNA 4C75A 4KZ6A 4QY6A 4JF6A 5FSRA 1OMEA 5FI2A 1BTLA 3CMZA 1K57A 2X71A 3WWXA 1DY6A 1S0WA 1IEMA 3HLGA 1M40A 1I2SA 1FQGA 1GHIA 3GRJA 3ZVTA 4RX3A 4E6XA 3VSLA 5TGFA 1IYQA 5DTSA 3UN7A 1N4OA 4Y0OA 1FCOA 4N1HA 5IHVA 1FCMA 2PU2A 5EVIC 3DWKA 1E3UA 1YM1A 1K4EA 4R3BA 3W4PA 1JWVA 2IWCA 3CZDA 5EVIA 4B4ZA 1JVJA 5F1FA 5J8XA 4DXBA 1LHYA 1W8QA 3E2LA 2EX8A 3IF6C 1K6SA 5M19A 4DDSA 1HD8A 1FSWA 2QMIA 2XH9A 3IF6A 1ALQA 3P09A 1ES4A 2ZC4B 4PM7A 1YQSA 4OVDA 3ZNYA 1LI9A 4FCFA 4KZ3A 1NRFA 4DE2A 4N9LA 4OLGA 4BD1A 1CK3A 1ES3A 3OCNA 3PBRA 2XD1A 3ISGA 4HESA 5HX9A 4DF6A 1YLYA 2J7VA 4FH2A 5EUAA 4MEZA 2J9PA 1E25A 3A3JA 4N9KA 5DTKA 5CRFA 4S2NC 5A92A 5HW3A 4D2OA 1IYOA 4S03A 2XFTA 4IVIA 3S22A 5J61A 3V3SA 4K0WA 4E3IA 1TVFA 2VGJA 4LV3A 1YLTA 3NC8A 3WS2A 1VM1A 1ZG6A 4WYYA 4KG6A 5FQ9A 1KGGA 1NJ4A 1KGEA 2V1ZA 4OOLA 4WEKA 4R23A 5CTMA 2XGNA 3LY3A 2Y91A 3W8KA 5CGWA 5U47A 1G6AA 3GTCA 4WMCA 1YMSA 5F83A 1I2WA 3VMAA 4DE1A 4GOGA 4N1XA 5GLAA 3IHBA 5CERA 1K4FA 3C4PA 4S2MA 5GHZA 1IYSA 2Y2QA 1LI0A 2HL1A 1Y54A 5F1GA 4JXSA 1Q2QA 3MZDA 2Y2OA 4OKPA 3SS5A 4UAAA 1I5QA 4BENA 4Q8IA 2HP5A 4RX2A 2H0YA 3WS4A 1QMFA 3I7JA 4XXRA 5EE8A 3KOBA 1XXMA 3HUNA 3UDIA 2HP9A 4LV0A 4EBLA 3UY6A 2Q9NA 3GVBA 1BULA 3RJUA 1RP5A 2ZQCA 3DW0A 1N9BA 4ZJ3A 2EFUA 4R4RA 3IQAA 3N6IA 2OKVA 3PBNA 4RRJA 4PM5A 3JYIA 4S2IA 4RRGA 1O07A 3G2YA 3G34A 3HLCA 4LV2A 3UO9A 1AXBA 2DNSA 4S2LA 5E2HA 5TFQA 2HKZA 4KZ8A 2GDNA 1YLPA 1NYMA 3VP2A 4LCMA 1XA7A 4NETA 5EVID 5FAPA 3MFDA 4M3KA 5FI7A 2XK1A 3NI9A 5GLCA 2OSUA 1LL9A 3NBLA 2PBYA 3IXGA 2WZZA 2FFFB 1YLZA 2XDMA 1C3BA 4KQQA 4KZ7A 3VSKA 2HL0A 3LMVA 3PD5A 1Y2QA 4B4XA 1ES2A 2R9WA 4K0XA 5JYOA 5A91A 5G18A 4F94A 4WM9A 4P6BA 4RRHA 3M6BA 4JLFA 3PAGA 4S0LA 4OQIA 3C7UA 3KODA 4PM6A 2BLSA 4DRTA 1LL5A 4X69A 1PI5A 4KZBA 4E3OA 1YLWA 3M2KA 3E2KA 3HLFA 3IWOA 4EQIA 5AQAA 2EXAA 3N8SA 4EV4A 4X55A 4PMAA 2WZXA 3PBTA 1EWZA 3ZG5A 1PZPA 5GHXA 3M2JA 4LV1A 2UWXA 1GHPA 2A49A 3IF6B 5GHYA 2HPBA 1Q2PA 5CHUA 4WMCD 2JCHA 4KG2A 3BFGA 3EQVA 3VFFA 4BJPA 4QU3A 1PWDA 4OPRA 4WBGA 3M6HA 1TEMA 1L0FA 1ES5A 3PBSA 2Z2MB 1BLHA 2Y2PA 3IXHA 3MXSA 2QZ6A 4PPRA 3C4OA 2Y2JA 5KSCA 2Y2IA 1FCNA 4OH0A 4U3TA 3GV9A 4Z9QA 1JTDA 2BG1A 1XA1A 2HDUA 4RR6A 2EX9A 4R1GA 1XPBA 3C7VA 3SH9A 2P9VA 5AQ9A 4LENA 4E3MA 4WELA 3VP4A 1FR1A 3QHYA 4ZBEA 1SKFA 1HZOA 4RRRA 2XQZA 4FH4A 1FSYA 4R3JA 5L2FA 1MWUA 2RCXA 3GSGA 4S2JA 1TDLA 2ZQDA 2ZC6B 5FDHA 5GLDA 2ZM8A 3ZVWA 5CGSA 5CEDA 3PD2A 2Y59A 4X68A 1JWPA 2FFYA 3BLSA 2C6WB 5E2GA 1QMEA 2OV5A 2JC7A 3Q07A 3OPRA 5KSHA 4GZBA 1K38A 2I72A 3MXRA 4XUXA 2IWDA 1IELA 3MZFA 3SOIA 3KO4A 3PD4A 3HLDA 3IF5A 3OZHA 3IXDA 3DTMA 4S2NA 4YFMA 4IEDA 1Z6FA 3GMWA 3ZDJA 3Q7VA 5KMWA 1SDEA 1K54C 2ZLYA 2ZQAA 1W79A 3LO7A 2WUQA 1K54A 5CXWA 3VP3A 3DWZA 1CEFA 1L2SA 3ZCZA 5EOEA 3S1YA 3O86A 1XP4A 3HUOA 5D3OA 3V50A 3KO7A 5AQBA 4RA7A 4WZ5C 3AGEA 1JTGA 2OLVA 2WKEA 2R9XA 3IT9A 4OPYA 3VOZA 1W7FA 4GDBA 4GKUA 5EOOA 1E4DA 4RVAA 5EVLA 3TOIA 5FQKA 1SHVA 4RR8A 4E3JA 1PW8A 3G2ZA 4RYEA 3LCEA 1MBLA 2E8IA 3Q82A 3Q81A 4KZ5A 1NYYA 2V2FF 1YLJA 2ZC5B 5FQMA 4S2PA 1J7GA 3UPOA 3Q7ZA 3VP1A 1DJAA 2EXBA 1BLPA 4QJGA 5FQIA 3RXWA 3HUMA 3VFHA 2EX6A 2ZC3B 4RRDA 4EBPA 4OPZA 2G2UA 3GR2A 3TSGA 3G32A 4QD4A 1ZC2A 4R0QA 5FASA 2P74A 1MXOA 3KO5A 1ZKJA 4RRAA 1S6RA 1XGIA 5FI6A 3V5MA 1VQQA 2X02A 3HREA 1PZOA 4S2KA 5A93A 4RRCA 2ZQ8A 3FWLA 3N7WA 2RL3A 2ZQ9A 3V39A 3ZG7B 1H8YA 3ITAA 3BFFA 4JBFA 3WRZA 3A3FA 3FKWA 1XX2A 5HARA 3NY4A 2XLNA 2HDSA 1YT4A 1HTZA 2PU4A 4WEJA 4GB7A 1W5DA 3UDXA 3LMTA 1CI8A 1RGZA 1XKZA 5HFOA 5A90A 5BOHA 1BT5A 3QNBA 3V3RA 3PAEA 2HP6A 2IWBA 1NZOA 5M18A 2B5RA 2H0TA 1BZAA 1KVMA 2WK0A 1JWZA 2VGKA 4L0LA 4Y7PA 3ZG9B 3MKEA 4OQGA 2WGWA 3ZGAB 4CPKA 1BLCA 1NXYA 2ZMAA 4U0XA 2ZM0A 3CJMA 4JXVA 4MBKA 2OLUA 2X01A 3KOCA 1GA0A 3CG5A 3RXXA 2Y2GA 3BYDA 4IBRA 2H5SA 4OPQA 4JPMA 3W4OA 3N4IA 4HBUA 5EVIB 5I94A 3Q1FA 4E3NA 3BECA 3PBOA 5FA7A 4S0IA 2P9VB 1DJCA 3OPHA 4OQHA 3HLBA 4KENB 4GD6A 4MBHA 1CI9A 1MY8A 5AQ7A 4S02A 5DF7A 4C3QA 2V20A 1FOFA 2Q9MA 2DCFA 2Y55A 3ZG8B 5CHMA 3IH8A 4ID4A 1H5XA 3SH7A 4N92A 4PM8A 4ZTKA 5KZHA 3LMUA 4NBJA 2HDQA 4FSFA 1ESIA 3IWIA 4R4SA 1PWCA 2ZJ9A 4WZ4A 5DF9A 1JKEA 2DBOA 1KVLA 4RRLA 1IKGA 4RRQA 1EI5A 2ZM2A 3IXBA 4OQ0A 1MWTA 4LCLA 3IHAA 4KG5A 3N8RA 5FATA 1WYBA 3ZNTA 3ITBA 3MKFA 1GHMA 1L0EA 1YMXA 4JXWA 1TDGA 4X56A 4JXGA 3OCLA 3TG9A 2WAFA 3BRMA 1K57C 5GLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EUZ A;  3WRT A;  4MLL A;  3UE0 A;  4ZJ1 A;  3Q7V B;  1IKI A;  3QNC A;  4H8R A;  4KZA A;  3BFC A;  1MWR A;  5HAI A;  5GL9 A;  2C5W B;  3FYZ A;  1K25 A;  1L0G A;  3SH8 A;  3NDE A;  4BD0 A;  1PIO A;  1M6K A;  4E3L A;  1O7E A;  2WAE A;  1BLS A;  1ZG4 A;  2JE5 A;  4X53 A;  1ONH A;  1W8Y A;  5FQQ A;  4QHC A;  1RCJ A;  4XUZ A;  1SCW A;  1K56 A;  4IVK A;  5F82 A;  4E6W A;  4EBN A;  1PW1 A;  4K91 A;  1HVB A;  4KZ4 A;  3BFD A;  2Y2H A;  3FV7 A;  4OP5 A;  5JYP A;  1KGF A;  2XEP A;  3BM6 A;  3HL9 A;  4IBX A;  3FKV A;  5E2E A;  4BL3 A;  4DE0 A;  4JF5 A;  4OOY A;  1G68 A;  1NY0 A;  1KE4 A;  3UNW A;  4EWF A;  3GQZ A;  3IWQ A;  4OLD A;  4OP8 A;  3BFE A;  2WGV A;  5HAP A;  1K6R A;  5EEC A;  4Y0T A;  4P0M A;  2J8Y A;  1DJB A;  2WYX A;  3IH9 A;  4UA6 A;  3O3V A;  3D4F A;  2DRW A;  4HBT A;  4HEF A;  3S4X A;  3UPP A;  5DTT A;  3MZE A;  3NIA A;  4WZ5 A;  3UE1 A;  2A3U A;  5HAQ A;  4GN2 A;  4S2O A;  4U0T A;  3G31 A;  4QY5 A;  4UA9 A;  3SS3 A;  3ZHH A;  1L0D A;  3G35 A;  5HL1 A;  1NZU A;  3EQU A;  4KQR A;  2XD5 A;  4YIN A;  4E3K A;  4NK3 A;  4P87 A;  1ESU A;  4JKT A;  4BQM A;  2ZQ7 A;  1BUE A;  3BEB A;  2XR0 A;  1ERO A;  3N8L A;  1RGY A;  4GDN A;  4ZDX A;  2WGI A;  3NDG A;  2Y2M A;  5CEC A;  1KDW A;  5CTN A;  1CEG A;  2Y2N A;  4JF4 A;  4KZ9 A;  4DXC A;  1WE4 A;  3AGF A;  4C6Y A;  3O88 A;  3BLM A;  4DE3 A;  5E43 A;  3UPN A;  2QPN A;  3A3D A;  2Z2L B;  5CEB A;  1ERM A;  2WGW B;  1H8Z A;  4FD8 A;  5FAO A;  3A3E A;  5CHJ A;  5M1A A;  2CC1 A;  4B88 A;  4DDY A;  3A3I A;  2WAD A;  3VOY A;  4MNR A;  4ZAM A;  1PYY A;  4P85 A;  3P98 A;  1ERQ A;  3HVF A;  3ZG0 A;  1FR6 A;  3WS5 A;  4Y0U A;  2Y2K A;  1ONG A;  1MWS A;  2ZC7 A;  4CJN A;  1MKI A;  4DKI A;  4X6T A;  2XF3 A;  4GNU A;  3OC2 A;  4A5R A;  2WKH A;  3AGD A;  3ZFZ A;  3MBZ A;  4ZJ2 A;  1K55 C;  5TR7 A;  3G4P A;  5CGX A;  1K55 A;  5FQJ A;  1K56 D;  3C5A A;  3UDF A;  1U60 A;  1LLB A;  5DF8 A;  3W4Q A;  3WS0 A;  1KDS A;  1MPL A;  4PM9 A;  1E3U D;  2JBF A;  2WKI A;  1BSG A;  3PTE A;  2XFS A;  3HLW A;  3B3X A;  5DVA A;  2H10 A;  2Y4A A;  1IYP A;  3HBR A;  3LY4 A;  1GA9 A;  1PI4 A;  1KE0 A;  3FZC A;  2HDR A;  2EX2 A;  5E2F A;  3LEZ A;  3OPP A;  3OPL A;  1GCE A;  4UA7 A;  3PBQ A;  2ZD8 A;  4MBF A;  5FAQ A;  4BLM A;  3UE3 A;  4OOM A;  5EPH A;  3SS4 A;  4OON A;  1WYC A;  2J9O A;  3O87 A;  3G30 A;  4O7D A;  3WS1 A;  4GD8 A;  2Y2L A;  1KE3 A;  4UHU A;  3HLE A;  3VP0 A;  4BL2 A;  2EFX A;  4KQO A;  1J9M A;  3NCK A;  1PWG A;  4QB8 A;  1XGJ A;  2G2W A;  1SDN A;  4C75 A;  4KZ6 A;  4QY6 A;  4JF6 A;  5FSR A;  1OME A;  5FI2 A;  1BTL A;  3CMZ A;  1K57 A;  2X71 A;  3WWX A;  1DY6 A;  1S0W A;  1IEM A;  3HLG A;  1M40 A;  1I2S A;  1FQG A;  1GHI A;  3GRJ A;  3ZVT A;  4RX3 A;  4E6X A;  3VSL A;  5TGF A;  1IYQ A;  5DTS A;  3UN7 A;  1N4O A;  4Y0O A;  1FCO A;  4N1H A;  5IHV A;  1FCM A;  2PU2 A;  5EVI C;  3DWK A;  1E3U A;  1YM1 A;  1K4E A;  4R3B A;  3W4P A;  1JWV A;  2IWC A;  3CZD A;  5EVI A;  4B4Z A;  1JVJ A;  5F1F A;  5J8X A;  4DXB A;  1LHY A;  1W8Q A;  3E2L A;  2EX8 A;  3IF6 C;  1K6S A;  5M19 A;  4DDS A;  1HD8 A;  1FSW A;  2QMI A;  2XH9 A;  3IF6 A;  1ALQ A;  3P09 A;  1ES4 A;  2ZC4 B;  4PM7 A;  1YQS A;  4OVD A;  3ZNY A;  1LI9 A;  4FCF A;  4KZ3 A;  1NRF A;  4DE2 A;  4N9L A;  4OLG A;  4BD1 A;  1CK3 A;  1ES3 A;  3OCN A;  3PBR A;  2XD1 A;  3ISG A;  4HES A;  5HX9 A;  4DF6 A;  1YLY A;  2J7V A;  4FH2 A;  5EUA A;  4MEZ A;  2J9P A;  1E25 A;  3A3J A;  4N9K A;  5DTK A;  5CRF A;  4S2N C;  5A92 A;  5HW3 A;  4D2O A;  1IYO A;  2XFT A;  4IVI A;  3S22 A;  3V3S A;  4K0W A;  4E3I A;  1TVF A;  2VGJ A;  4LV3 A;  1YLT A;  3NC8 A;  3WS2 A;  1VM1 A;  1ZG6 A;  4WYY A;  4KG6 A;  5FQ9 A;  1KGG A;  1NJ4 A;  1KGE A;  2V1Z A;  4OOL A;  4WEK A;  4R23 A;  5CTM A;  2XGN A;  3LY3 A;  2Y91 A;  3W8K A;  5CGW A;  5U47 A;  1G6A A;  3GTC A;  4WMC A;  1YMS A;  5F83 A;  1I2W A;  3VMA A;  4DE1 A;  4GOG A;  4N1X A;  5GLA A;  3IHB A;  5CER A;  1K4F A;  3C4P A;  4S2M A;  5GHZ A;  1IYS A;  2Y2Q A;  1LI0 A;  1Y54 A;  5F1G A;  4JXS A;  1Q2Q A;  3MZD A;  2Y2O A;  4OKP A;  3SS5 A;  4UAA A;  1I5Q A;  4BEN A;  4Q8I A;  2HP5 A;  4RX2 A;  2H0Y A;  3WS4 A;  1QMF A;  3I7J A;  4XXR A;  5EE8 A;  1XXM A;  3HUN A;  3UDI A;  2HP9 A;  4LV0 A;  4EBL A;  3UY6 A;  2Q9N A;  3GVB A;  1BUL A;  3RJU A;  1RP5 A;  2ZQC A;  3DW0 A;  1N9B A;  4ZJ3 A;  2EFU A;  4R4R A;  3IQA A;  3N6I A;  3PBN A;  4PM5 A;  3JYI A;  4S2I A;  1O07 A;  3G2Y A;  3G34 A;  3HLC A;  4LV2 A;  3UO9 A;  1AXB A;  2DNS A;  4S2L A;  5E2H A;  5TFQ A;  4KZ8 A;  2GDN A;  1YLP A;  1NYM A;  3VP2 A;  4LCM A;  1XA7 A;  4NET A;  5EVI D;  5FAP A;  3MFD A;  4M3K A;  5FI7 A;  2XK1 A;  3NI9 A;  5GLC A;  2OSU A;  1LL9 A;  3NBL A;  2PBY A;  3IXG A;  2WZZ A;  2FFF B;  1YLZ A;  2XDM A;  1C3B A;  4KQQ A;  4KZ7 A;  3VSK A;  4B4X A;  1ES2 A;  2R9W A;  4K0X A;  5JYO A;  5A91 A;  5G18 A;  4F94 A;  4WM9 A;  4P6B A;  3M6B A;  4JLF A;  3PAG A;  4OQI A;  3C7U A;  4PM6 A;  2BLS A;  4DRT A;  1LL5 A;  4X69 A;  1PI5 A;  4KZB A;  4E3O A;  1YLW A;  3M2K A;  3E2K A;  3HLF A;  3IWO A;  4EQI A;  5AQA A;  2EXA A;  3N8S A;  4EV4 A;  4X55 A;  4PMA A;  2WZX A;  3PBT A;  1EWZ A;  3ZG5 A;  1PZP A;  5GHX A;  3M2J A;  4LV1 A;  2UWX A;  1GHP A;  2A49 A;  3IF6 B;  5GHY A;  2HPB A;  1Q2P A;  5CHU A;  4WMC D;  2JCH A;  4KG2 A;  3BFG A;  3EQV A;  3VFF A;  4BJP A;  4QU3 A;  1PWD A;  4OPR A;  4WBG A;  3M6H A;  1TEM A;  1L0F A;  1ES5 A;  3PBS A;  2Z2M B;  1BLH A;  2Y2P A;  3IXH A;  3MXS A;  2QZ6 A;  4PPR A;  3C4O A;  2Y2J A;  5KSC A;  2Y2I A;  1FCN A;  4OH0 A;  4U3T A;  3GV9 A;  4Z9Q A;  1JTD A;  2BG1 A;  1XA1 A;  2HDU A;  2EX9 A;  4R1G A;  1XPB A;  3C7V A;  3SH9 A;  2P9V A;  5AQ9 A;  4LEN A;  4E3M A;  4WEL A;  3VP4 A;  1FR1 A;  3QHY A;  4ZBE A;  1SKF A;  1HZO A;  2XQZ A;  4FH4 A;  1FSY A;  4R3J A;  5L2F A;  1MWU A;  2RCX A;  3GSG A;  4S2J A;  1TDL A;  2ZQD A;  2ZC6 B;  5FDH A;  5GLD A;  2ZM8 A;  3ZVW A;  5CGS A;  5CED A;  2Y59 A;  4X68 A;  1JWP A;  2FFY A;  3BLS A;  2C6W B;  5E2G A;  1QME A;  2OV5 A;  2JC7 A;  3Q07 A;  3OPR A;  5KSH A;  4GZB A;  1K38 A;  2I72 A;  3MXR A;  4XUX A;  2IWD A;  1IEL A;  3MZF A;  3SOI A;  3HLD A;  3IF5 A;  3OZH A;  3IXD A;  3DTM A;  4S2N A;  4YFM A;  4IED A;  1Z6F A;  3GMW A;  3ZDJ A;  3Q7V A;  5KMW A;  1SDE A;  1K54 C;  2ZLY A;  2ZQA A;  1W79 A;  3LO7 A;  2WUQ A;  1K54 A;  5CXW A;  3VP3 A;  3DWZ A;  1CEF A;  1L2S A;  3ZCZ A;  5EOE A;  3S1Y A;  3O86 A;  1XP4 A;  3HUO A;  5D3O A;  3V50 A;  5AQB A;  4RA7 A;  4WZ5 C;  3AGE A;  1JTG A;  2OLV A;  2WKE A;  2R9X A;  3IT9 A;  4OPY A;  3VOZ A;  1W7F A;  4GDB A;  4GKU A;  5EOO A;  1E4D A;  4RVA A;  5EVL A;  3TOI A;  5FQK A;  1SHV A;  4E3J A;  1PW8 A;  3G2Z A;  4RYE A;  3LCE A;  1MBL A;  2E8I A;  3Q82 A;  3Q81 A;  4KZ5 A;  1NYY A;  2V2F F;  1YLJ A;  2ZC5 B;  5FQM A;  4S2P A;  3UPO A;  3Q7Z A;  3VP1 A;  1DJA A;  2EXB A;  1BLP A;  4QJG A;  5FQI A;  3RXW A;  3HUM A;  3VFH A;  2EX6 A;  2ZC3 B;  4EBP A;  4OPZ A;  2G2U A;  3GR2 A;  3TSG A;  3G32 A;  4QD4 A;  1ZC2 A;  4R0Q A;  5FAS A;  2P74 A;  1MXO A;  1ZKJ A;  1S6R A;  1XGI A;  5FI6 A;  3V5M A;  1VQQ A;  2X02 A;  3HRE A;  1PZO A;  4S2K A;  5A93 A;  2ZQ8 A;  3FWL A;  3N7W A;  2RL3 A;  2ZQ9 A;  3V39 A;  3ZG7 B;  1H8Y A;  3ITA A;  3BFF A;  4JBF A;  3WRZ A;  3A3F A;  3FKW A;  1XX2 A;  5HAR A;  3NY4 A;  2XLN A;  2HDS A;  1YT4 A;  1HTZ A;  2PU4 A;  4WEJ A;  4GB7 A;  1W5D A;  3UDX A;  1CI8 A;  1RGZ A;  1XKZ A;  5HFO A;  5A90 A;  5BOH A;  1BT5 A;  3QNB A;  3V3R A;  3PAE A;  2HP6 A;  2IWB A;  1NZO A;  5M18 A;  2B5R A;  2H0T A;  1BZA A;  1KVM A;  2WK0 A;  1JWZ A;  2VGK A;  4L0L A;  4Y7P A;  3ZG9 B;  3MKE A;  4OQG A;  2WGW A;  3ZGA B;  4CPK A;  1BLC A;  1NXY A;  2ZMA A;  4U0X A;  2ZM0 A;  3CJM A;  4JXV A;  4MBK A;  2OLU A;  2X01 A;  1GA0 A;  3CG5 A;  3RXX A;  2Y2G A;  3BYD A;  4IBR A;  2H5S A;  4OPQ A;  4JPM A;  3W4O A;  3N4I A;  4HBU A;  5EVI B;  5I94 A;  3Q1F A;  4E3N A;  3BEC A;  3PBO A;  5FA7 A;  2P9V B;  1DJC A;  3OPH A;  4OQH A;  3HLB A;  4KEN B;  4GD6 A;  4MBH A;  1CI9 A;  1MY8 A;  5AQ7 A;  5DF7 A;  4C3Q A;  2V20 A;  1FOF A;  2Q9M A;  2DCF A;  2Y55 A;  3ZG8 B;  5CHM A;  3IH8 A;  4ID4 A;  1H5X A;  3SH7 A;  4N92 A;  4PM8 A;  4ZTK A;  5KZH A;  2HDQ A;  4FSF A;  1ESI A;  3IWI A;  4R4S A;  1PWC A;  2ZJ9 A;  4WZ4 A;  5DF9 A;  1KVL A;  1IKG A;  1EI5 A;  2ZM2 A;  3IXB A;  4OQ0 A;  1MWT A;  4LCL A;  3IHA A;  4KG5 A;  3N8R A;  5FAT A;  1WYB A;  3ZNT A;  3ITB A;  3MKF A;  1GHM A;  1L0E A;  1YMX A;  4JXW A;  1TDG A;  4X56 A;  4JXG A;  3OCL A;  3TG9 A;  2WAF A;  3BRM A;  1K57 C;  5GLB A; 
#chains in the Genus database with same CATH topology
 4KZA A;  4R6L A;  2C5W B;  2W3D A;  3R7W A;  1M6K A;  2WAE A;  1W8Y A;  2K7S A;  2OOL A;  4E6W A;  4JGP A;  1PW1 A;  4K91 A;  5HD3 A;  3T4O A;  1UGU A;  3P7N A;  5E2E A;  3K3D A;  3LR4 A;  1H8M A;  3CUE A;  3UNW A;  4EWF A;  4OP8 A;  2WGV A;  1XJ6 A;  1G5U A;  3IH9 A;  4UA6 A;  2YKH A;  1VB6 A;  1Y28 A;  3E98 A;  4S0K A;  3S4X A;  1OPX A;  4EUV A;  3SS3 A;  4KQR A;  2D02 A;  4NK3 A;  2XR0 A;  3KO6 A;  4ZDX A;  2Y2M A;  4EQ1 A;  4GS9 A;  5CTN A;  1WA9 A;  5EM0 A;  1CEG A;  1A0K A;  1F9I A;  4DE3 A;  4DMZ A;  4RRB A;  1ERM A;  4FD8 A;  1H8Z A;  5FAO A;  1S4S A;  3A3I A;  4NXF A;  3ZG0 A;  4GNU A;  4PAU A;  2B18 A;  1SZV A;  3MBZ A;  4ZJ2 A;  2VA0 A;  5FQJ A;  3CLO A;  2K31 A;  1KDS A;  2Y8H A;  1E3U D;  2XFS A;  4RRI A;  1IYP A;  1DP9 A;  5HSQ A;  3BY8 A;  2HL2 A;  2ZL1 A;  1GCE A;  5FAQ A;  2LB5 A;  4OOM A;  4S0J A;  3KO3 A;  5EPH A;  4DJ3 A;  4OON A;  3MR0 A;  2Y2L A;  1KE3 A;  2PRF A;  3HLE A;  1GSW A;  2EFX A;  5DFX A;  3NCK A;  5HWT A;  1Y4O A;  5L07 A;  1YSP A;  2A24 B;  5FI2 A;  3LGO A;  1IEM A;  4EET B;  1GHI A;  3GRJ A;  4AFI A;  3VSL A;  5TGF A;  1S66 L;  4Y0O A;  1W63 Q;  1E3U A;  1K4E A;  1JWV A;  2IWC A;  3CZD A;  4B4Z A;  1LL8 A;  1LHY A;  1K6S A;  5M19 A;  2BAS A;  3IF6 A;  1ALQ A;  3ZNY A;  1LI9 A;  4FCF A;  4Y17 A;  5CX7 A;  4KZ3 A;  5A8B A;  4DE2 A;  4OLG A;  2INW A;  1ES3 A;  3GEC A;  3PBR A;  5HX9 A;  2J7V A;  2PYR A;  5EUA A;  4S2N C;  4NXB A;  2XA7 S;  4S03 A;  2XFT A;  5J61 A;  4K0W A;  5FEG A;  2V8F A;  3NC8 A;  3WS2 A;  3C38 A;  1KGG A;  4WEK A;  1OJG A;  3F1N B;  3W8K A;  2PD8 A;  2J3W A;  4GOG A;  5GLA A;  3IHB A;  5CER A;  4EW7 A;  3EWK A;  5GHZ A;  1IYS A;  3L9K A;  2HL1 A;  2GJ3 A;  4Q0H A;  2B02 A;  3SS5 A;  4UAA A;  1I5Q A;  4RX2 A;  4NG2 A;  2H0Y A;  3LI8 A;  3WS4 A;  3KOB A;  1XXM A;  2FH5 A;  3RJU A;  2ZQC A;  3DW0 A;  1N9B A;  3UB9 A;  2EFU A;  2OKV A;  4I3J A;  3JYI A;  3NOP C;  1VET B;  4GCZ A;  4S2I A;  2JKR M;  3TW8 A;  5E2H A;  3QP6 A;  2HF6 A;  5FAP A;  3MFD A;  5FI7 A;  3NI9 A;  1LL9 A;  3H7W B;  4EBP A;  3U2A A;  2I9V A;  1S1Y A;  4B4X A;  4OQI A;  2OWJ A;  2BLS A;  3QP5 A;  5HPF A;  3E4O A;  4JGR A;  4E3O A;  1YLW A;  1G6O A;  2Y79 A;  4PMA A;  1VEU A;  4Z1W A;  2WKR A;  3M2J A;  2PYP A;  4WMC D;  2JCH A;  2QKP A;  4KG2 A;  5G4Y A;  5J3W A;  2HGV A;  2Y2P A;  2QZ6 A;  5KSC A;  4OH0 A;  3GV9 A;  4Z9Q A;  2B95 A;  3LIB A;  2HDU A;  3E0Y A;  4E3M A;  1SKF A;  4R3J A;  4RRJ A;  2RCX A;  5GLD A;  3ZVW A;  5CED A;  2K2N A;  5CGS A;  2FFY A;  2OV5 A;  3Q07 A;  5KSH A;  4E04 A;  3KO4 A;  4LPZ A;  3OZH A;  4S2N A;  1Z6F A;  2L4R A;  1K54 C;  4O0P A;  1Z09 A;  5CXW A;  4DE0 A;  1CEF A;  1XP4 A;  3HUO A;  3PXP A;  3C8C A;  4RA7 A;  4H6J A;  4WZ5 C;  2OLV A;  2WKE A;  3VOZ A;  4OPY A;  4GKU A;  3TRC A;  1GSX A;  1SHV A;  3QP8 A;  4E3J A;  4NXE A;  2E8I A;  1J7G A;  3Q7Z A;  2EX6 A;  1BYW A;  3TSG A;  3G32 A;  4RRA A;  4K08 A;  2V0U A;  5I5L A;  4RRC A;  3FWL A;  3N7W A;  3OLO A;  2WKQ A;  3DAV A;  3SZT A;  3B47 A;  3WRZ A;  1DRM A;  1LT0 A;  2XLN A;  1YT4 A;  1HTZ A;  1NLZ A;  4WEJ A;  4GB7 A;  2D01 A;  1XKZ A;  1NZO A;  1KVM A;  3ZG9 B;  1MZU A;  4OQG A;  3ZGA B;  2HV1 A;  3QP2 A;  1BLC A;  1TS8 A;  4U0X A;  2ZM0 A;  1GA0 A;  4WL9 A;  4IBR A;  3MQO A;  4OPQ A;  4JPM A;  3W4O A;  4HBU A;  3MS6 A;  1DJC A;  4GD6 A;  2MJ6 A;  2V20 A;  1T18 A;  2DCF A;  4RQ9 A;  4G3W A;  4PM8 A;  5KZH A;  4NBJ A;  4FSF A;  1JKE A;  1PWC A;  5DF9 A;  1H0M A;  2ZM2 A;  4OQ0 A;  4ME4 A;  3ITB A;  1GHM A;  1L0E A;  3EOI A;  1TDG A;  4X56 A;  3OCL A;  2WAF A;  5HDS A;  1LSX A;  5GLB A;  4EUZ A;  3WRT A;  3EEA A;  4ZJ1 A;  3Q7V B;  4H8R A;  3D72 A;  1TD5 A;  4Y13 A;  5HAI A;  5GL9 A;  4EES A;  3KNF A;  1PIO A;  4E3L A;  1BLS A;  4X53 A;  5FQQ A;  4GJ4 A;  4KZ4 A;  3ICY A;  3FV7 A;  4GW9 A;  1N9N A;  3FC7 A;  1NLY A;  4L9E A;  3UE6 A;  3BM6 A;  2A24 A;  5FDS A;  3JPU A;  3GQZ A;  1K6R A;  4WZ5 A;  3UE1 A;  4R38 A;  3ZHH A;  4FTX A;  3T4Q A;  3EQU A;  2XD5 A;  4YIN A;  4E3K A;  4P87 A;  1ESU A;  1PRQ A;  3BEB A;  3UMD A;  3UB5 P;  2WGI A;  3NDG A;  4FUW A;  4X25 A;  5CEC A;  3PD3 A;  4JF4 A;  4DXC A;  3AGF A;  3O88 A;  5E43 A;  2QPN A;  2Z2L B;  4YWZ A;  4NBI A;  2WGW B;  4DDY A;  1VHM A;  2WAD A;  3VOY A;  2W1R A;  1PYY A;  3P98 A;  4KUK A;  3KX0 X;  3HVF A;  3T1S A;  4Y0U A;  3F1N A;  4RR7 A;  1ONG A;  1MWS A;  4CJN A;  4DKI A;  4X6T A;  4A5R A;  2EWW A;  3NOU C;  3AGD A;  3ZFZ A;  5L10 A;  1K55 A;  5DF8 A;  2OWH A;  3W4Q A;  3NHQ A;  2JBF A;  3KYQ A;  4YNR A;  3PTE A;  5DVA A;  2PT7 A;  3HBR A;  3LY4 A;  1PI4 A;  2NUT C;  5HPI A;  3KSH A;  2EX2 A;  4BMW A;  3LEZ A;  2H28 A;  3S7P A;  4BLM A;  1NWZ A;  1VET A;  2J9O A;  3WS1 A;  1YAX A;  1J3W A;  4GD8 A;  3GDI A;  4Y2F A;  4F3L B;  1PWG A;  1XGJ A;  3T50 A;  3H7W A;  5FSR A;  1T1C A;  4FOF A;  3WWX A;  1T1B A;  2WKP A;  3ZVT A;  4H6J B;  4RX3 A;  4E6X A;  1IYQ A;  3UN7 A;  3LEQ A;  3LYX A;  3CI6 A;  2PU2 A;  4R3B A;  5EVI A;  1TF1 A;  4DXB A;  4Y5F A;  3E2L A;  1H3Q A;  3IF6 C;  4D60 A;  1HD8 A;  3P09 A;  1FSW A;  4PM7 A;  2GX5 A;  1ES4 A;  1YQS A;  4OVD A;  2BTF P;  3H9W A;  1P0Z A;  3MSH A;  4BD1 A;  1CK3 A;  3LIE A;  2ZMF A;  3KSF A;  1YLY A;  1E25 A;  3A3J A;  4N9K A;  5DTK A;  1ZTU A;  3V3S A;  3V67 A;  2QJ5 A;  4LV3 A;  1VM1 A;  1NJ4 A;  1KGE A;  4HJ6 A;  3CIT A;  1YMS A;  4DE1 A;  1I2W A;  4UQI S;  3IX8 A;  3LIC A;  4S2M A;  2QJ7 A;  3K3C A;  1LI0 A;  5F1G A;  4JXS A;  1Q2Q A;  2Y2O A;  4OKP A;  1T19 A;  3EGX C;  4JGQ A;  4ETX A;  3ZYT A;  3S7N A;  4EBL A;  3JVU A;  3UY6 A;  2Q9N A;  1BUL A;  2QWS A;  4PHT A;  1O07 A;  3UO9 A;  2HKZ A;  2GDN A;  3VP2 A;  3KYE A;  4WN5 A;  3PYP A;  2OSU A;  3NBL A;  4KQQ A;  2PBY A;  2WZZ A;  2FFF B;  1YLZ A;  3S7O A;  1C3B A;  3LUQ A;  3VSK A;  1ES2 A;  1DP8 A;  5JYO A;  5G18 A;  4WM9 A;  4P6B A;  4RRH A;  3M6B A;  2QHK A;  4S0L A;  1XFQ A;  3E4P A;  5HDC A;  4EQI A;  5AQA A;  3CWF A;  2EXA A;  4WUJ A;  2WZX A;  3PBT A;  4LV1 A;  2A49 A;  4DN0 A;  3EQV A;  3KYZ A;  1PWD A;  4OPR A;  4WBG A;  3M6H A;  1L0F A;  2Z2M B;  3MXS A;  4EEP A;  2O9B A;  2Y2J A;  4R1G A;  3SH9 A;  3NOT C;  3QHY A;  1HZO A;  4FH4 A;  5L2F A;  1MWU A;  1TDL A;  2ZQD A;  2ZC6 B;  3KSG A;  3PD2 A;  2AVX A;  1JWP A;  3DTK A;  5TBM A;  3UB7 A;  2JC7 A;  2VX8 A;  5DFY A;  4GZB A;  1K38 A;  2I72 A;  1IEL A;  3HLD A;  3IF5 A;  3F1P B;  1HLU P;  3DTM A;  1XJ3 A;  3Q7V A;  5KMW A;  3T12 B;  3LO7 A;  2WUQ A;  3VP3 A;  5D3O A;  3V50 A;  1JTG A;  2J3T C;  4BWI A;  4GDB A;  3MXQ A;  1E4D A;  4RVA A;  5FQK A;  5J7E A;  1ACF A;  1PW8 A;  2JKT I;  2Q0O A;  3Q81 A;  2V2F F;  4KUO A;  4UQI M;  2ZC5 B;  4XT2 B;  3VP1 A;  1BLP A;  5FQI A;  3RXW A;  3VFH A;  2ZC3 B;  1PFL A;  4RRD A;  2G2U A;  4HJ4 A;  4PKY A;  4QD4 A;  1ZC2 A;  3KO5 A;  5FAS A;  3F1O A;  5FI6 A;  3V5M A;  3DTI A;  4S2K A;  5A93 A;  1P97 A;  2RL3 A;  3ZG7 B;  3ZQ5 A;  1H8Y A;  1YPR A;  3BFF A;  4JBF A;  1XX2 A;  2VKS A;  3NY4 A;  2HDS A;  4L9G A;  3S7Q A;  3T4J A;  4UEY A;  4II7 A;  1V9Y A;  5BOH A;  1BT5 A;  3QNB A;  3V3R A;  3PAE A;  2IWB A;  5M18 A;  4L0L A;  4Y7P A;  3HJK A;  2WGW A;  2EWV A;  4WF0 A;  4HNB A;  4B93 A;  1NXY A;  3CJM A;  4HIA A;  2X01 A;  3CG5 A;  2Y2G A;  3BWL A;  5DKK A;  4ESP A;  3N4I A;  5EVI B;  3Q1F A;  3BEC A;  5FA7 A;  2P9V B;  3LIF A;  2VZW A;  5DF7 A;  2J3T D;  5CHM A;  4ID4 A;  3LR0 A;  1JNU A;  4N92 A;  4ZTK A;  3H82 B;  2HDQ A;  1ESI A;  3IWI A;  4R4S A;  4WZ4 A;  4RRQ A;  3IXB A;  3ZNT A;  3IHA A;  3MKF A;  4EER A;  4LRZ E;  2JHE A;  4ZRR A;  3BRM A;  4MLL A;  3UE0 A;  3QNC A;  1IKI A;  2JKG A;  3PHY A;  2KLI A;  5HL6 A;  2R78 A;  3FYZ A;  3SH8 A;  4BD0 A;  1PNE A;  4QPR A;  5IU1 A;  4LGW A;  3EEH A;  1X0O A;  2JE5 A;  1ONH A;  2E8J A;  4QHC A;  4IVK A;  1K56 A;  4EBN A;  1HVB A;  4F3L A;  3BFD A;  2Y2H A;  4OP5 A;  1TC5 A;  5JYP A;  2M7U A;  1EW0 A;  1KGF A;  2XEP A;  4IBX A;  5F69 A;  3FKV A;  4BL3 A;  4JF5 A;  4OOY A;  1G68 A;  1NY0 A;  1KE4 A;  3BFE A;  5K5B A;  5HAP A;  5EEC A;  4P0M A;  2J8Y A;  2O9A A;  2WYX A;  1IFQ A;  3O3V A;  1TS7 A;  2DRW A;  4I3A A;  4HEF A;  4I38 A;  4CLC A;  3NIA A;  5AJG A;  4S2O A;  3G31 A;  4QY5 A;  4UA9 A;  2P7J A;  3G35 A;  1NZU A;  4BQM A;  2FZ0 A;  1ERO A;  4G3V A;  2GNX A;  3G6O A;  4BBV A;  1KDW A;  4MDZ A;  4EU0 A;  2Y2N A;  3T1R A;  1WE4 A;  1CJF A;  3BY9 A;  3A3E A;  5FEF A;  4QWO A;  4ZAM A;  1ERQ A;  2GZA A;  1MC0 A;  1NRJ A;  1N9O A;  1FR6 A;  1MKI A;  4MN7 A;  4LFU A;  1K55 C;  5CGX A;  2V0W A;  3C5A A;  1U60 A;  3WS0 A;  4PM9 A;  2WKI A;  4DJ2 A;  3HLW A;  3P01 A;  2IA2 A;  3E4Q A;  2Y4A A;  1KE0 A;  1DP6 A;  5E2F A;  3OPP A;  2UV0 E;  4UA7 A;  2ZD8 A;  5DKL A;  1WYC A;  2PDR A;  4P6Z M;  4HP4 A;  5TBM B;  3NJA A;  4KQO A;  1SKO B;  3LFV A;  4Q0J A;  4Q0I A;  3HCY A;  3DTE A;  2G2W A;  1SDN A;  2L1M A;  3C2W A;  4C75 A;  3UME A;  4JF6 A;  2QYB A;  1BTL A;  3CMZ A;  3CPT B;  2X71 A;  3U4L P;  1DY6 A;  1F5M A;  1S0W A;  1M40 A;  2W3F A;  1I2S A;  5DTS A;  1N4O A;  1FCO A;  4N1H A;  1FCM A;  4BBU A;  2VGL M;  5EVI C;  3DWK A;  4NXG A;  1YM1 A;  3W4P A;  3C30 A;  5HWV A;  1JVJ A;  3OOV A;  5HDD A;  1FIK A;  1W8Q A;  2Z6C A;  2EX8 A;  3OBF A;  1UWP X;  2VJW A;  4N9L A;  1CQA A;  1OTD A;  3F1O B;  3OCN A;  4DF6 A;  3MQQ A;  4CLC E;  5CRF A;  4D2O A;  1IYO A;  5AVF A;  4E3I A;  1TVF A;  1P9W A;  1ZG6 A;  4OOL A;  4R23 A;  2XGN A;  2Y91 A;  5CGW A;  2HZ5 A;  2JN7 A;  5U47 A;  2W3H A;  5EVE A;  4N1X A;  4M4X A;  1K4F A;  3C4P A;  2CMN A;  2Y2Q A;  5HWW A;  5TJJ A;  3F1P A;  2HP5 A;  3MQ0 A;  3HUN A;  2HP9 A;  4LV0 A;  2W1T B;  1RP5 A;  4ZJ3 A;  3TE8 A;  3N6I A;  3PBN A;  2OAQ 1;  4PM5 A;  3G34 A;  3HLC A;  4LV2 A;  4KZ8 A;  1K0K A;  1NYM A;  4LCM A;  4Y15 A;  1S4R A;  1XA7 A;  5EVI D;  4XT2 A;  2VV7 A;  2XK1 A;  4KZ7 A;  3IXG A;  2XDM A;  3PD5 A;  1Y2Q A;  4NKP A;  5A91 A;  4F94 A;  4IJG A;  4JLF A;  3PAG A;  2W0N A;  1YKD A;  2W3E A;  4HP9 A;  4PM6 A;  4DRT A;  1PI5 A;  4KZB A;  3M2K A;  3HLF A;  3IWO A;  3K2N A;  4MCW A;  4EV4 A;  3ZG5 A;  5GHX A;  3T4T A;  2HPB A;  1Q2P A;  5CHU A;  3MFX A;  3BFG A;  3VFF A;  3RH8 B;  4CLC B;  4JGO A;  3BJN A;  3IXH A;  2W27 A;  4PPR A;  2PBD P;  5LBR A;  4U3T A;  3ULF A;  4HOI A;  2EX9 A;  1XPB A;  3C7V A;  2P9V A;  5AQ9 A;  4LEN A;  3VP4 A;  1FR1 A;  4RRR A;  2XQZ A;  4MN6 A;  4S2J A;  2C6W B;  5E2G A;  3H82 A;  3OPR A;  2LB9 A;  3SOI A;  4R3A A;  3UB8 A;  2O0Y A;  3GMW A;  3NEC A;  3ZDJ A;  2A2L A;  3DWZ A;  1L2S A;  5EOE A;  4MMN A;  3O86 A;  3S1Y A;  1T1A A;  1D1J A;  1OTA A;  1G28 A;  3AGE A;  2ZBB A;  2V9A A;  3T4L A;  3O5Y A;  3IT9 A;  1W7F A;  5EVL A;  4B9O A;  2Z6D A;  3G2Z A;  4RYE A;  3LCE A;  1MBL A;  1NYY A;  2ZMV A;  3UPO A;  2EXB A;  3NUL A;  3HUM A;  4ETZ A;  1XJ2 A;  1MXO A;  1ZKJ A;  1S6R A;  3FG8 A;  2X02 A;  2ZQ8 A;  4I5S A;  2XRN A;  3V39 A;  3ITA A;  3A3F A;  3FKW A;  1LSW A;  2J80 A;  4GHI B;  5L8M A;  2PU4 A;  3L7H A;  1W5D A;  1CI8 A;  5A90 A;  5F68 A;  2M7V A;  2H0T A;  1ZHH B;  1JWZ A;  5AVE A;  3MKE A;  2PAV P;  5HD5 A;  4CPK A;  3KOC A;  3VOL A;  2H5S A;  5I94 A;  3PBO A;  3OPH A;  1STZ A;  4OQH A;  4KEN B;  4HJ3 A;  4HY8 A;  3ZG8 B;  4BBT A;  1H5X A;  5L09 A;  3SH7 A;  3RTY A;  4RRL A;  4Y3I A;  2DBO A;  1KVL A;  3D9Y A;  1EI5 A;  5FAT A;  1MWT A;  4LCL A;  4KG5 A;  2V8C A;  1MKM A;  3IBR A;  3IX4 A;  4JXG A;  1K57 C;  2JKT M;  3BFC A;  1MWR A;  1K25 A;  3KO9 A;  1L0G A;  3NDE A;  2VLG A;  4X1L A;  1O7E A;  1ZG4 A;  1RCJ A;  2KDK A;  1SCW A;  3BW6 A;  4XUZ A;  3KSI A;  5F82 A;  4RRM A;  1SKO A;  2G7U A;  3HL9 A;  4RRF A;  5F6A A;  3IWQ A;  4OLD A;  3CPT A;  4Y0T A;  1DJB A;  4NEE D;  4CLC C;  3D4F A;  4HBT A;  3T1Q B;  1D06 A;  4HH3 A;  3UPP A;  5DTT A;  3MZE A;  1IOU A;  2A3U A;  5HAQ A;  4GN2 A;  4U0T A;  5HL1 A;  1L0D A;  2KOI A;  4JKT A;  4RRK A;  2ZQ7 A;  1BUE A;  4LRY C;  3N8L A;  1RGY A;  4GDN A;  1TS0 A;  4L9F A;  4KZ9 A;  1OTB A;  4HH2 A;  4C6Y A;  3BLM A;  1UWN X;  3UPN A;  3A3D A;  3KNP A;  5CEB A;  4ARZ B;  5CHJ A;  5M1A A;  2CC1 A;  4PKY G;  1FIL A;  4B88 A;  4MNR A;  4P85 A;  3D3O A;  3WS5 A;  1KOU A;  2Y2K A;  3LR5 A;  2OAP 1;  2YKF A;  2ZC7 A;  2XF3 A;  3OC2 A;  1F2K A;  2M1C A;  2WKH A;  5TR7 A;  3G4P A;  3UDF A;  1K56 D;  3IS2 A;  4KQD A;  1LLB A;  1MPL A;  1BSG A;  2L0W A;  3B3X A;  2H10 A;  3B33 A;  1GA9 A;  2W1T A;  3FZC A;  4P6Z S;  2HDR A;  3HJI A;  4EXO A;  3OPL A;  3PBQ A;  4MBF A;  4CLC D;  3UE3 A;  3R7W B;  3SS4 A;  3O87 A;  3G30 A;  4O7D A;  4UHU A;  3VP0 A;  4BL2 A;  4RR9 A;  1J9M A;  2PD7 A;  2NUP C;  3VE3 A;  3MF0 A;  4QB8 A;  1CF0 A;  4KZ6 A;  4QY6 A;  4HQA A;  3W2Z A;  1OME A;  2JKR I;  4LLO B;  5IS1 A;  4IUH A;  4MN5 A;  2VGL S;  1K57 A;  2W3G A;  5MC7 A;  3HLG A;  1N9L A;  3IBJ A;  1FQG A;  1YSQ A;  3VV4 A;  3T1X A;  2XRO A;  4GLQ A;  2VEA A;  5IHV A;  5F1F A;  5J8X A;  1TS6 A;  4WLA A;  2VK3 A;  3CAX A;  4DDS A;  2XH9 A;  2QMI A;  2ZC4 B;  3UB6 A;  3EGD C;  4GS9 B;  5J4E A;  3CHW P;  1NRF A;  1S67 L;  3LIA A;  5KIZ A;  2P04 A;  5DJT A;  2XD1 A;  3ISG A;  4HES A;  4FH2 A;  4EEU A;  4MEZ A;  2J9P A;  4I39 A;  5A92 A;  2VV8 A;  5HW3 A;  4IVI A;  3QP1 A;  3S22 A;  2XSS A;  2VGJ A;  1YLT A;  2PHY A;  5EV0 A;  4WYY A;  4KG6 A;  5FQ9 A;  2V1Z A;  5CTM A;  3LY3 A;  3LID A;  4IHQ A;  1G6A A;  3GTC A;  4WMC A;  4IUK A;  2XA7 M;  5F83 A;  3VMA A;  3T4S A;  3TJZ C;  3QP4 A;  1Y54 A;  3PR6 A;  3MZD A;  4BEN A;  4Q8I A;  1QMF A;  3I7J A;  4XXR A;  5EE8 A;  3UDI A;  3GVB A;  4HHD A;  2O99 A;  2ZL1 B;  4R4R A;  3IQA A;  5EFW A;  1W63 M;  2PR6 A;  4RRG A;  3G2Y A;  1AXB A;  2DNS A;  4S2L A;  5TFQ A;  4X1M A;  2ZOI A;  1YLP A;  3A0R A;  4NET A;  4M3K A;  3R4K A;  3MJQ A;  5GLC A;  2HL0 A;  3BQ8 A;  3LMV A;  4YOF A;  2EA9 A;  4LRX C;  2R9W A;  4K0X A;  3KOD A;  3C7U A;  4CQH A;  1LL5 A;  2HJ9 C;  4X69 A;  5G4Z A;  3E2K A;  1XFN A;  1OTI A;  3N8S A;  4GHI A;  3RFB A;  4X55 A;  1EWZ A;  1OT9 A;  1PZP A;  1L3L A;  2UWX A;  1GHP A;  3IF6 B;  5GHY A;  4BJP A;  4QU3 A;  4O01 A;  2HJE A;  2JKF A;  1TEM A;  1ES5 A;  3PBS A;  1BLH A;  4G3K A;  3T4K A;  3A0V A;  5FL3 A;  3C4O A;  2Y2I A;  1FCN A;  1JTD A;  2BG1 A;  4R70 A;  1XA1 A;  4RR6 A;  1D7E A;  3LR3 A;  4WEL A;  1P9R A;  4ZBE A;  2KX6 A;  1FSY A;  3GSG A;  5FDH A;  2ZM8 A;  2Y59 A;  4X68 A;  2O9C A;  3BLS A;  1QME A;  1GSV A;  2VV6 A;  4XUX A;  3MXR A;  2IWD A;  3MZF A;  3PD4 A;  1V9Z A;  3BQA A;  3IXD A;  2ACG A;  3CUE C;  4YFM A;  4IED A;  1S1Z A;  1SDE A;  2ZQA A;  2ZLY A;  1W79 A;  3ZCZ A;  1K54 A;  3IX3 A;  1XJ4 A;  3KO7 A;  3LI9 A;  5AQB A;  2R9X A;  5EOO A;  3TOI A;  4HI4 A;  1OTE A;  3VE4 A;  3IS2 B;  4RR8 A;  2P08 A;  5EM1 A;  3Q82 A;  4KZ5 A;  1YLJ A;  5FQM A;  4S2P A;  1DJA A;  4QJG A;  4OPZ A;  3GR2 A;  5F5Y A;  4R0Q A;  2P74 A;  1XGI A;  5C5K A;  3JVV A;  1VQQ A;  3HRE A;  1PZO A;  5DJU A;  2ZQ9 A;  4O8G A;  1OT6 A;  1LSV A;  3SW1 A;  5HAR A;  2PR5 A;  1VEU B;  3UDX A;  3LMT A;  1RGZ A;  5HFO A;  2HP6 A;  2B5R A;  1BZA A;  2WK0 A;  2VGK A;  3A0S A;  3DBA A;  1AWI A;  4ARZ A;  3FPV A;  2ZMA A;  4JXV A;  2DMW A;  2OLU A;  4I3I A;  4MBK A;  1ODV A;  5HZH A;  3RXX A;  3BYD A;  5IT5 A;  4E3N A;  4S0I A;  2V1B A;  2ZOH A;  3HLB A;  4MBH A;  1CI9 A;  1MY8 A;  3FPW A;  5AQ7 A;  3MMH A;  4S02 A;  4C3Q A;  1FOF A;  2Q9M A;  2Y55 A;  3IH8 A;  2V1A A;  3B42 A;  3LMU A;  2ZJ9 A;  1IKG A;  1F98 A;  3N8R A;  1WYB A;  1OJ5 A;  1YMX A;  4JXW A;  3TG9 A; 
#chains in the Genus database with same CATH homology
 4EUZ A;  3WRT A;  4MLL A;  3UE0 A;  4ZJ1 A;  3Q7V B;  1IKI A;  3QNC A;  4H8R A;  4KZA A;  3BFC A;  1MWR A;  5HAI A;  5GL9 A;  2C5W B;  3FYZ A;  1K25 A;  3KO9 A;  1L0G A;  3SH8 A;  3NDE A;  4BD0 A;  3KNF A;  1PIO A;  1M6K A;  4E3L A;  1O7E A;  2WAE A;  1BLS A;  1ZG4 A;  2JE5 A;  4X53 A;  1ONH A;  1W8Y A;  5FQQ A;  4QHC A;  1RCJ A;  4XUZ A;  1SCW A;  1K56 A;  4IVK A;  5F82 A;  4E6W A;  4EBN A;  4RRM A;  1PW1 A;  4K91 A;  1HVB A;  4KZ4 A;  3BFD A;  2Y2H A;  3FV7 A;  4OP5 A;  1TC5 A;  5JYP A;  1KGF A;  2XEP A;  3BM6 A;  3HL9 A;  4IBX A;  3FKV A;  5E2E A;  4BL3 A;  4DE0 A;  4JF5 A;  4RRF A;  4OOY A;  1G68 A;  1NY0 A;  1KE4 A;  3UNW A;  4EWF A;  3GQZ A;  3IWQ A;  4OLD A;  4OP8 A;  3BFE A;  2WGV A;  5HAP A;  1K6R A;  5EEC A;  4Y0T A;  4P0M A;  2J8Y A;  1DJB A;  2WYX A;  3IH9 A;  4UA6 A;  3O3V A;  3D4F A;  2DRW A;  4HBT A;  4HEF A;  4S0K A;  3S4X A;  3UPP A;  5DTT A;  3MZE A;  3NIA A;  4WZ5 A;  3UE1 A;  2A3U A;  5HAQ A;  4GN2 A;  4S2O A;  4U0T A;  3G31 A;  4QY5 A;  4UA9 A;  3SS3 A;  3ZHH A;  1L0D A;  3G35 A;  5HL1 A;  1NZU A;  3EQU A;  4KQR A;  2XD5 A;  4YIN A;  4E3K A;  4NK3 A;  4P87 A;  1ESU A;  4JKT A;  4BQM A;  4RRK A;  2ZQ7 A;  1BUE A;  3BEB A;  2XR0 A;  1ERO A;  3N8L A;  1RGY A;  4GDN A;  4ZDX A;  2WGI A;  3NDG A;  2Y2M A;  5CEC A;  1KDW A;  5CTN A;  3PD3 A;  1CEG A;  2Y2N A;  4JF4 A;  4KZ9 A;  4DXC A;  1WE4 A;  3AGF A;  4C6Y A;  4RRB A;  3O88 A;  3BLM A;  4DE3 A;  5E43 A;  3UPN A;  2QPN A;  3A3D A;  3KNP A;  2Z2L B;  5CEB A;  1ERM A;  4NBI A;  2WGW B;  1H8Z A;  4FD8 A;  5FAO A;  3A3E A;  5CHJ A;  5M1A A;  2CC1 A;  4B88 A;  4DDY A;  3A3I A;  2WAD A;  3VOY A;  4MNR A;  4ZAM A;  1PYY A;  4P85 A;  3P98 A;  1ERQ A;  3HVF A;  3ZG0 A;  1FR6 A;  3WS5 A;  4Y0U A;  4RR7 A;  2Y2K A;  1ONG A;  1MWS A;  2ZC7 A;  4CJN A;  1MKI A;  4DKI A;  4X6T A;  2XF3 A;  4GNU A;  3OC2 A;  4A5R A;  2WKH A;  3AGD A;  3ZFZ A;  3MBZ A;  4ZJ2 A;  1K55 C;  5TR7 A;  3G4P A;  5CGX A;  1K55 A;  5FQJ A;  1K56 D;  3C5A A;  3UDF A;  1U60 A;  1LLB A;  5DF8 A;  3W4Q A;  3WS0 A;  1KDS A;  1MPL A;  4PM9 A;  1E3U D;  2JBF A;  2WKI A;  1BSG A;  3PTE A;  2XFS A;  3HLW A;  3B3X A;  5DVA A;  4RRI A;  2H10 A;  2Y4A A;  1IYP A;  3HBR A;  3LY4 A;  1GA9 A;  1PI4 A;  1KE0 A;  3FZC A;  2HDR A;  2EX2 A;  2HL2 A;  5E2F A;  3LEZ A;  3OPP A;  3OPL A;  1GCE A;  4UA7 A;  3PBQ A;  2ZD8 A;  4MBF A;  5FAQ A;  4BLM A;  3UE3 A;  4OOM A;  4S0J A;  3KO3 A;  5EPH A;  3SS4 A;  4OON A;  1WYC A;  2J9O A;  3O87 A;  3G30 A;  4O7D A;  3WS1 A;  4GD8 A;  2Y2L A;  1KE3 A;  4UHU A;  3HLE A;  3VP0 A;  4BL2 A;  2EFX A;  4KQO A;  4RR9 A;  1J9M A;  3NCK A;  1PWG A;  4QB8 A;  1XGJ A;  2G2W A;  1SDN A;  4C75 A;  4KZ6 A;  4QY6 A;  4JF6 A;  5FSR A;  1OME A;  5FI2 A;  1BTL A;  3CMZ A;  1K57 A;  2X71 A;  3WWX A;  1DY6 A;  1S0W A;  1IEM A;  3HLG A;  1M40 A;  1I2S A;  1FQG A;  1GHI A;  3GRJ A;  3ZVT A;  4RX3 A;  4E6X A;  3VSL A;  5TGF A;  1IYQ A;  5DTS A;  3UN7 A;  1N4O A;  4Y0O A;  1FCO A;  4N1H A;  5IHV A;  1FCM A;  2PU2 A;  5EVI C;  3DWK A;  1E3U A;  1YM1 A;  1K4E A;  4R3B A;  3W4P A;  1JWV A;  2IWC A;  3CZD A;  5EVI A;  4B4Z A;  1JVJ A;  5F1F A;  5J8X A;  4DXB A;  1LHY A;  1W8Q A;  3E2L A;  2EX8 A;  3IF6 C;  1K6S A;  5M19 A;  4DDS A;  1HD8 A;  1FSW A;  2QMI A;  2XH9 A;  3IF6 A;  1ALQ A;  3P09 A;  1ES4 A;  2ZC4 B;  4PM7 A;  1YQS A;  4OVD A;  3ZNY A;  1LI9 A;  4FCF A;  4KZ3 A;  1NRF A;  4DE2 A;  4N9L A;  4OLG A;  4BD1 A;  1CK3 A;  1ES3 A;  3OCN A;  3PBR A;  2XD1 A;  3ISG A;  4HES A;  5HX9 A;  4DF6 A;  1YLY A;  2J7V A;  4FH2 A;  5EUA A;  4MEZ A;  2J9P A;  1E25 A;  3A3J A;  4N9K A;  5DTK A;  5CRF A;  4S2N C;  5A92 A;  5HW3 A;  4D2O A;  1IYO A;  4S03 A;  2XFT A;  4IVI A;  3S22 A;  5J61 A;  3V3S A;  4K0W A;  4E3I A;  1TVF A;  2VGJ A;  4LV3 A;  1YLT A;  3NC8 A;  3WS2 A;  1VM1 A;  1ZG6 A;  4WYY A;  4KG6 A;  5FQ9 A;  1KGG A;  1NJ4 A;  1KGE A;  2V1Z A;  4OOL A;  4WEK A;  4R23 A;  5CTM A;  2XGN A;  3LY3 A;  2Y91 A;  3W8K A;  5CGW A;  5U47 A;  1G6A A;  3GTC A;  4WMC A;  1YMS A;  5F83 A;  1I2W A;  3VMA A;  4DE1 A;  4GOG A;  4N1X A;  5GLA A;  3IHB A;  5CER A;  1K4F A;  3C4P A;  4S2M A;  5GHZ A;  1IYS A;  2Y2Q A;  1LI0 A;  2HL1 A;  1Y54 A;  5F1G A;  4JXS A;  1Q2Q A;  3MZD A;  2Y2O A;  4OKP A;  3SS5 A;  4UAA A;  1I5Q A;  4BEN A;  4Q8I A;  2HP5 A;  4RX2 A;  2H0Y A;  3WS4 A;  1QMF A;  3I7J A;  4XXR A;  5EE8 A;  3KOB A;  1XXM A;  3HUN A;  3UDI A;  2HP9 A;  4LV0 A;  4EBL A;  3UY6 A;  2Q9N A;  3GVB A;  1BUL A;  3RJU A;  1RP5 A;  2ZQC A;  3DW0 A;  1N9B A;  4ZJ3 A;  2EFU A;  4R4R A;  3IQA A;  3N6I A;  2OKV A;  3PBN A;  4RRJ A;  4PM5 A;  3JYI A;  4S2I A;  4RRG A;  1O07 A;  3G2Y A;  3G34 A;  3HLC A;  4LV2 A;  3UO9 A;  1AXB A;  2DNS A;  4S2L A;  5E2H A;  5TFQ A;  2HKZ A;  4KZ8 A;  2GDN A;  1YLP A;  1NYM A;  3VP2 A;  4LCM A;  1XA7 A;  4NET A;  5EVI D;  5FAP A;  3MFD A;  4M3K A;  5FI7 A;  2XK1 A;  3NI9 A;  5GLC A;  2OSU A;  1LL9 A;  3NBL A;  2PBY A;  3IXG A;  2WZZ A;  2FFF B;  1YLZ A;  2XDM A;  1C3B A;  4KQQ A;  4KZ7 A;  3VSK A;  2HL0 A;  3LMV A;  3PD5 A;  1Y2Q A;  4B4X A;  1ES2 A;  2R9W A;  4K0X A;  5JYO A;  5A91 A;  5G18 A;  4F94 A;  4WM9 A;  4P6B A;  4RRH A;  3M6B A;  4JLF A;  3PAG A;  4S0L A;  4OQI A;  3C7U A;  3KOD A;  4PM6 A;  2BLS A;  4DRT A;  1LL5 A;  4X69 A;  1PI5 A;  4KZB A;  4E3O A;  1YLW A;  3M2K A;  3E2K A;  3HLF A;  3IWO A;  4EQI A;  5AQA A;  2EXA A;  3N8S A;  4EV4 A;  4X55 A;  4PMA A;  2WZX A;  3PBT A;  1EWZ A;  3ZG5 A;  1PZP A;  5GHX A;  3M2J A;  4LV1 A;  2UWX A;  1GHP A;  2A49 A;  3IF6 B;  5GHY A;  2HPB A;  1Q2P A;  5CHU A;  4WMC D;  2JCH A;  4KG2 A;  3BFG A;  3EQV A;  3VFF A;  4BJP A;  4QU3 A;  1PWD A;  4OPR A;  4WBG A;  3M6H A;  1TEM A;  1L0F A;  1ES5 A;  3PBS A;  2Z2M B;  1BLH A;  2Y2P A;  3IXH A;  3MXS A;  2QZ6 A;  4PPR A;  3C4O A;  2Y2J A;  5KSC A;  2Y2I A;  1FCN A;  4OH0 A;  4U3T A;  3GV9 A;  4Z9Q A;  1JTD A;  2BG1 A;  1XA1 A;  2HDU A;  4RR6 A;  2EX9 A;  4R1G A;  1XPB A;  3C7V A;  3SH9 A;  2P9V A;  5AQ9 A;  4LEN A;  4E3M A;  4WEL A;  3VP4 A;  1FR1 A;  3QHY A;  4ZBE A;  1SKF A;  1HZO A;  4RRR A;  2XQZ A;  4FH4 A;  1FSY A;  4R3J A;  5L2F A;  1MWU A;  2RCX A;  3GSG A;  4S2J A;  1TDL A;  2ZQD A;  2ZC6 B;  5FDH A;  5GLD A;  2ZM8 A;  3ZVW A;  5CGS A;  5CED A;  3PD2 A;  2Y59 A;  4X68 A;  1JWP A;  2FFY A;  3BLS A;  2C6W B;  5E2G A;  1QME A;  2OV5 A;  2JC7 A;  3Q07 A;  3OPR A;  5KSH A;  4GZB A;  1K38 A;  2I72 A;  3MXR A;  4XUX A;  2IWD A;  1IEL A;  3MZF A;  3SOI A;  3KO4 A;  3PD4 A;  3HLD A;  3IF5 A;  3OZH A;  3IXD A;  3DTM A;  4S2N A;  4YFM A;  4IED A;  1Z6F A;  3GMW A;  3ZDJ A;  3Q7V A;  5KMW A;  1SDE A;  1K54 C;  2ZLY A;  2ZQA A;  1W79 A;  3LO7 A;  2WUQ A;  1K54 A;  5CXW A;  3VP3 A;  3DWZ A;  1CEF A;  1L2S A;  3ZCZ A;  5EOE A;  3S1Y A;  3O86 A;  1XP4 A;  3HUO A;  5D3O A;  3V50 A;  3KO7 A;  5AQB A;  4RA7 A;  4WZ5 C;  3AGE A;  1JTG A;  2OLV A;  2WKE A;  2R9X A;  3IT9 A;  4OPY A;  3VOZ A;  1W7F A;  4GDB A;  4GKU A;  5EOO A;  1E4D A;  4RVA A;  5EVL A;  3TOI A;  5FQK A;  1SHV A;  4RR8 A;  4E3J A;  1PW8 A;  3G2Z A;  4RYE A;  3LCE A;  1MBL A;  2E8I A;  3Q82 A;  3Q81 A;  4KZ5 A;  1NYY A;  2V2F F;  1YLJ A;  2ZC5 B;  5FQM A;  4S2P A;  1J7G A;  3UPO A;  3Q7Z A;  3VP1 A;  1DJA A;  2EXB A;  1BLP A;  4QJG A;  5FQI A;  3RXW A;  3HUM A;  3VFH A;  2EX6 A;  2ZC3 B;  4RRD A;  4EBP A;  4OPZ A;  2G2U A;  3GR2 A;  3TSG A;  3G32 A;  4QD4 A;  1ZC2 A;  4R0Q A;  5FAS A;  2P74 A;  1MXO A;  3KO5 A;  1ZKJ A;  4RRA A;  1S6R A;  1XGI A;  5FI6 A;  3V5M A;  1VQQ A;  2X02 A;  3HRE A;  1PZO A;  4S2K A;  5A93 A;  4RRC A;  2ZQ8 A;  3FWL A;  3N7W A;  2RL3 A;  2ZQ9 A;  3V39 A;  3ZG7 B;  1H8Y A;  3ITA A;  3BFF A;  4JBF A;  3WRZ A;  3A3F A;  3FKW A;  1XX2 A;  5HAR A;  3NY4 A;  2XLN A;  2HDS A;  1YT4 A;  1HTZ A;  2PU4 A;  4WEJ A;  4GB7 A;  1W5D A;  3UDX A;  3LMT A;  1CI8 A;  1RGZ A;  1XKZ A;  5HFO A;  5A90 A;  5BOH A;  1BT5 A;  3QNB A;  3V3R A;  3PAE A;  2HP6 A;  2IWB A;  1NZO A;  5M18 A;  2B5R A;  2H0T A;  1BZA A;  1KVM A;  2WK0 A;  1JWZ A;  2VGK A;  4L0L A;  4Y7P A;  3ZG9 B;  3MKE A;  4OQG A;  2WGW A;  3ZGA B;  4CPK A;  1BLC A;  1NXY A;  2ZMA A;  4U0X A;  2ZM0 A;  3CJM A;  4JXV A;  4MBK A;  2OLU A;  2X01 A;  3KOC A;  1GA0 A;  3CG5 A;  3RXX A;  2Y2G A;  3BYD A;  4IBR A;  2H5S A;  4OPQ A;  4JPM A;  3W4O A;  3N4I A;  4HBU A;  5EVI B;  5I94 A;  3Q1F A;  4E3N A;  3BEC A;  3PBO A;  5FA7 A;  4S0I A;  2P9V B;  1DJC A;  3OPH A;  4OQH A;  3HLB A;  4KEN B;  4GD6 A;  4MBH A;  1CI9 A;  1MY8 A;  5AQ7 A;  4S02 A;  5DF7 A;  4C3Q A;  2V20 A;  1FOF A;  2Q9M A;  2DCF A;  2Y55 A;  3ZG8 B;  5CHM A;  3IH8 A;  4ID4 A;  1H5X A;  3SH7 A;  4N92 A;  4PM8 A;  4ZTK A;  5KZH A;  3LMU A;  4NBJ A;  2HDQ A;  4FSF A;  1ESI A;  3IWI A;  4R4S A;  1PWC A;  2ZJ9 A;  4WZ4 A;  5DF9 A;  1JKE A;  2DBO A;  1KVL A;  4RRL A;  1IKG A;  4RRQ A;  1EI5 A;  2ZM2 A;  3IXB A;  4OQ0 A;  1MWT A;  4LCL A;  3IHA A;  4KG5 A;  3N8R A;  5FAT A;  1WYB A;  3ZNT A;  3ITB A;  3MKF A;  1GHM A;  1L0E A;  1YMX A;  4JXW A;  1TDG A;  4X56 A;  4JXG A;  3OCL A;  3TG9 A;  2WAF A;  3BRM A;  1K57 C;  5GLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...