2EXBA

Crystal structure of penicillin binding protein 4 (dacb) from escherichia coli, complexed with flomox
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
454
structure length
446
Chain Sequence
DEYITQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKYELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYAVRIPLVRFESRLYKDIYQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 4
publication title Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, both in the native form and covalently linked to various antibiotics
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 137
structure length 446
sequence length 454
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2005-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2exbA01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 2exbA02
2ZQCA 2Y55A 1MY8A 4KZAA 1XKZA 4KZ8A 5GHYA 2GDNA 5AQAA 3V3RA 1BLCA 1GCEA 3G2YA 4GNUA 4PM6A 3SS3A 5JYOA 4K0XA 2XK1A 4FD8A 2HDUA 4GOGA 5G18A 4E3IA 2XEPA 1BZAA 5KZHA 3ZNYA 1IKIA 3QHYA 4OOMA 3GMWA 2WADA 3GTCA 4NETA 1FSYA 1ERMA 2WZXA 2Y91A 3RXWA 1WE4A 3Q81A 3VP0A 1PIOA 3OPLA 5E2FA 4N1XA 3C5AA 1ALQA 2PBYA 3SOIA 2C5WB 1ZC2A 5CTMA 5FAPA 3FKVA 1G68A 3C4PA 1IYOA 3Q82A 4IEDA 3ZHHA 4DDYA 2BG1A 4R4RA 4XXRA 1OMEA 3G35A 4DF6A 5FQMA 1E4DA 4QU3A 1FSWA 4DE3A 5DTSA 1YLYA 2Q9NA 4GZBA 1J9MA 3C7VA 5IHVA 4YINA 3Q07A 4FSFA 2ZC7A 1E3UA 1KE4A 4ID4A 3GVBA 4H8RA 3V50A 4R4SA 4F94A 1JTGA 2OLUA 3DW0A 3PBNA 2XD1A 5EVIA 1XPBA 4OPRA 2J9PA 2DRWA 5M1AA 3VFHA 3Q7VA 4EBNA 2A3UA 3ZFZA 1N4OA 2EFXA 1DJAA 1K6RA 1KGFA 2B5RA 4KG5A 3HLDA 4IBXA 4GD6A 2DCFA 4LV3A 3SH8A 2X02A 1ES2A 4CPKA 1PWCA 4OOYA 4K91A 2ZQ9A 4P6BA 4DE0A 3MZFA 5EVIC 3OPHA 2ZQ8A 1O7EA 2E8IA 5TGFA 3N7WA 3ZVWA 4MBFA 2XGNA 2PU4A 5HAQA 4RX3A 1BUEA 2FFFB 4X69A 1BSGA 4DXCA 4PM7A 1DJCA 2G2UA 1Z6FA 1NZOA 3G4PA 5TR7A 4E3KA 2IWBA 1K38A 3MFDA 1Y54A 4WM9A 1MWRA 2ZM8A 3BFDA 4BD0A 3UE0A 3HUMA 1HZOA 3IF6B 4R3JA 2Y2GA 4S2IA 2A49A 4Q8IA 3BFEA 3M6HA 1PI4A 2Y2KA 3O86A 3ZG7B 1GHPA 3OPRA 4HBTA 5CXWA 4C6YA 3FZCA 4KQQA 1ESIA 2Y2HA 2RCXA 3MKFA 4KZ6A 4XUXA 2CC1A 3P98A 3HUNA 1LHYA 3M2KA 4N9LA 3C7UA 2H0TA 3CG5A 3GQZA 1MWSA 5M18A 1W7FA 2XF3A 3QNCA 2J7VA 1EROA 3HLCA 4UA7A 1BULA 2R9WA 4N9KA 4MNRA 2WAEA 3V3SA 4LCLA 4X55A 3ZG8B 5BOHA 3PBSA 5E2HA 4UHUA 5HX9A 5GLDA 1TEMA 1KDWA 4U0TA 1K25A 2ZM0A 3N4IA 3PBQA 4IVKA 4JPMA 2ZC4B 4EV4A 5CEDA 4ZDXA 3BLSA 1FR6A 2JC7A 2WGWA 3NY4A 5DTKA 3HUOA 3W8KA 3A3EA 1K56D 5FQ9A 1KVLA 4QHCA 5CTNA 2EX2A 2ZC6B 3WWXA 4C75A 4OOLA 1EI5A 1CI9A 2HP9A 5FA7A 3WS5A 4RA7A 1NZUA 3G2ZA 4DRTA 4XUZA 4ZAMA 5HAPA 4C3QA 2P74A 4OPYA 5EECA 1M6KA 4BD1A 1DJBA 3G32A 3OCNA 5FASA 1SHVA 4U3TA 3ZG0A 4PM5A 4YFMA 2PU2A 1M40A 1HTZA 3JYIA 4B4ZA 4QY6A 3HLFA 5E43A 4FCFA 4K0WA 1PWGA 3IHBA 3LEZA 1XA1A 4EWFA 5A92A 3W4PA 3EQVA 5AQ9A 5CERA 2V20A 2FFYA 5DF9A 1GHMA 1PWDA 1BLPA 4MEZA 1LL9A 1K57A 4LV0A 1SKFA 4M3KA 3G31A 1JVJA 2X01A 2HDSA 4R3BA 3ZDJA 3LCEA 1NRFA 3IWQA 1DY6A 1FCOA 4D2OA 3HBRA 2XFSA 4DE1A 4BLMA 2Y2JA 3QNBA 4HESA 4OP8A 1EWZA 3VMAA 2WUQA 3IWOA 1TVFA 3MZEA 1K57C 1QMFA 1NYYA 2HDRA 2EXAA 4KZBA 1IEMA 1LLBA 3VOZA 3VP4A 5FQIA 1W8QA 5FQKA 1KE3A 4CJNA 1PI5A 4GDBA 3PBTA 4WZ5A 3WS1A 1YQSA 3AGFA 4B4XA 1IYPA 2IWCA 1ZG6A 3FWLA 3AGDA 3UPPA 1MPLA 3I7JA 3OCLA 1SDEA 5FI6A 4RYEA 4ZJ2A 3ITBA 5DF8A 4BL2A 3LO7A 2XDMA 4WBGA 1MWTA 2R9XA 4JKTA 5EPHA 5TFQA 4JXVA 4EQIA 1GHIA 3HLEA 3HREA 3DWKA 3IH8A 2JE5A 3A3FA 4KZ3A 4WZ5C 2HDQA 4OONA 1FQGA 4WEJA 1YLWA 3ZCZA 3IF6A 4WEKA 3FKWA 2Y2NA 5KMWA 2UWXA 5D3OA 1BLHA 2QMIA 2ZMAA 5HFOA 4KZ9A 5F83A 2WKHA 5GL9A 3IXGA 4RX2A 5EE8A 3MXSA 4QD4A 1G6AA 2ZLYA 1FR1A 2EX6A 3P09A 4OH0A 3G30A 4X56A 4Z9QA 2XR0A 4OQ0A 1C3BA 2WYXA 3A3IA 2WKIA 3IF6C 3W4QA 3UY6A 3ZGAB 2HPBA 2XFTA 4WMCD 1JWVA 1ONGA 3UPNA 2EXBA 3IXDA 1MWUA 5DVAA 3PAEA 1ES5A 1K6SA 4UA9A 4ZTKA 5GLBA 4OQGA 3BRMA 3N6IA 3S4XA 3VP2A 3MKEA 4N1HA 2V1ZA 5FQQA 2Z2LB 4IVIA 1JWZA 1K56A 1KE0A 1WYCA 5A91A 1AXBA 2QPNA 1GA0A 3NI9A 4OP5A 4Y7PA 3S22A 4BL3A 5EOEA 5CHUA 2Y59A 1I2WA 3G34A 1KVMA 1FCNA 2ZJ9A 4S2PA 4BQMA 1E3UD 3Q1FA 1O07A 2EX9A 4DE2A 3GR2A 3HL9A 3HLGA 3ZG9B 1Q2PA 2H5SA 3O88A 5EVID 3RXXA 3UN7A 4DXBA 2ZM2A 3CJMA 5GHXA 1N9BA 4EBLA 3W4OA 5E2EA 2Y2LA 3N8RA 2X71A 4O7DA 1PZPA 1YLTA 3FV7A 3UNWA 2EX8A 4R23A 1YLPA 4LV1A 3NDGA 1LI0A 1IELA 3LY3A 4NK3A 3PTEA 4ZJ1A 1QMEA 3ZVTA 2WK0A 3TG9A 1RGYA 2V2FF 1W79A 4A5RA 1GA9A 3HLWA 1H5XA 3SH9A 5FQJA 1K4EA 1JTDA 2P9VB 3V5MA 1W5DA 3A3JA 2QZ6A 1ESUA 3GSGA 3NIAA 1MKIA 3OPPA 2RL3A 3BYDA 1L0FA 4U0XA 5AQBA 1XXMA 5EOOA 3WRZA 1IYQA 1YM1A 2Z2MB 4Y0TA 2Q9MA 4FH4A 5F1GA 4KQOA 5FATA 5J8XA 1ONHA 3NBLA 3TSGA 3LY4A 1YLJA 4KZ7A 3EQUA 1KGEA 3BEBA 4OKPA 3VSKA 3OZHA 5AQ7A 4GN2A 4S2KA 1LI9A 3M6BA 2VGKA 4GD8A 4RVAA 1ES4A 5DTTA 1FCMA 3DWZA 3GV9A 4MLLA 3ITAA 5FI7A 4JXSA 3Q7ZA 3M2JA 4R0QA 1XX2A 4EBPA 5FAQA 1I2SA 3PBOA 2BLSA 4OPQA 3UDFA 3C4OA 4DKIA 1KGGA 1YLZA 1YT4A 2H0YA 4S2OA 5JYPA 4OPZA 4E3MA 4E3JA 2Y2MA 1E25A 5HL1A 2WZZA 2Y2OA 4E3OA 1XP4A 2XQZA 1IKGA 5FAOA 4GDNA 3VOYA 4QY5A 5KSCA 3ZG5A 3V39A 4S2MA 2VGJA 4PM9A 4BENA 3D4FA 3ISGA 3UDXA 1U60A 4IBRA 3A3DA 4WYYA 4E6WA 2OSUA 1H8ZA 3BFFA 4JF6A 2I72A 5GHZA 4JLFA 4OQIA 1ES3A 2XH9A 4WELA 5I94A 5M19A 1HD8A 5CRFA 1PW1A 1VM1A 1CI8A 5HARA 5FI2A 2XD5A 4WMCA 3UE1A 3BLMA 5CECA 3IWIA 4L0LA 2ZC3B 3NDEA 1JWPA 4KG2A 4DDSA 4X6TA 1CK3A 4E3LA 3RJUA 3VP3A 1PZOA 4OQHA 4KQRA 4S2LA 2WGVA 3IXHA 1PYYA 3BFGA 4Y0OA 5E2GA 2HP6A 1CEFA 4MBKA 5KSHA 3MBZA 3MXRA 3PAGA 1FOFA 3IHAA 2C6WB 5HAIA 4UAAA 4PMAA 1RGZA 3S1YA 3HVFA 1RP5A 1IYSA 1SCWA 4MBHA 1LL5A 4QB8A 5U47A 2JCHA 1XA7A 4KENB 4B88A 4P87A 4BJPA 4OLDA 4UA6A 1L0GA 5EVLA 5EVIB 5F82A 4P85A 3BECA 3NCKA 1YMSA 3Q7VB 5CEBA 4Y0UA 3IF5A 4PPRA 1MXOA 3UPOA 1K54A 5FDHA 3IXBA 3MZDA 4ZBEA 5GLAA 5A93A 1H8YA 1BLSA 3N8LA 5DF7A 3HLBA 5A90A 4P0MA 1XGIA 2Y2PA 2DNSA 2OV5A 2HP5A 3O3VA 4LCMA 2ZQDA 5CGXA 1L0DA 3FYZA 3CZDA 4GKUA 4JBFA 1BT5A 1K54C 2IWDA 3E2LA 3PBRA 2P9VA 1ZKJA 4X53A 3OC2A 2OLVA 4JF4A 3E2KA 3GRJA 2WKEA 5CHJA 2EFUA 1NJ4A 3BFCA 3WRTA 1MBLA 1L0EA 3O87A 1VQQA 2G2WA 4KZ4A 1TDGA 3B3XA 4JXWA 4X68A 3TOIA 1YMXA 1L2SA 1S6RA 5CHMA 4GB7A 1CEGA 2J8YA 4OLGA 2ZD8A 2Y2QA 3AGEA 3IT9A 4HBUA 5FSRA 3VFFA 4E6XA 4QJGA 1WYBA 5EUAA 2ZC5B 3UDIA 4JF5A 5F1FA 1XGJA 4OVDA 2WGIA 4R1GA 4PM8A 3IH9A 4S2NA 1TDLA 4E3NA 1NY0A 2ZQAA 3UE3A 3WS0A 1ERQA 1ZG4A 4S2JA 4WZ4A 2H10A 3UO9A 3VP1A 3WS4A 5CGSA 3IQAA 4N92A 4LENA 5HW3A 3SS5A 1HVBA 5GLCA 3VSLA 4ZJ3A 1K55A 1K4FA 4KZ5A 1S0WA 3CMZA 4JXGA 4S2NC 2J9OA 1KDSA 1BTLA 1NYMA 3SS4A 1Q2QA 1NXYA 3BM6A 3WS2A 5L2FA 4HEFA 4KG6A 1W8YA 2WGWB 1SDNA 3DTMA 5CGWA 2JBFA 2Y2IA 3SH7A 4FH2A 1RCJA 2XLNA 1I5QA 2ZQ7A 3N8SA 3ZNTA 4EUZA 1K55C 1PW8A 2WAFA 3NC8A 2Y4AA 4LV2A
chains in the Genus database with same CATH superfamily
1XKZA 4KZ8A 2XA7M 2GDNA 5AQAA 3G2YA 4RQ9A 2W1RA 1BYWA 4E3IA 1Z09A 1IKIA 4JGQA 5TBMA 4NETA 1LSXA 1ERMA 3Q81A 3S7NA 1MC0A 4N1XA 4NEED 3SOIA 2C5WB 1G68A 3PR6A 2BG1A 3H9WA 1OMEA 3G35A 1G5UA 2Q9NA 2L0WA 2PR5A 1KE4A 1JTGA 5HL6A 2J9PA 4GCZA 5M1AA 3VFHA 1DP8A 1VETA 1KGFA 4LV3A 4GD6A 2X02A 3RFBA 4P6BA 5EVIC 2LB5A 4RX3A 1BUEA 2G2UA 1NZOA 5TR7A 5FDSA 3S7QA 4WM9A 1MWRA 2ZM8A 3BFDA 3IF6B 2FZ0A 1ACFA 1TS0A 1W63M 4Q8IA 3MJQA 4EETB 2Y2KA 4C6YA 2CC1A 3HUNA 3GDIA 1W7FA 3QNCA 3EOIA 3HLCA 3EEAA 2V1AA 4MNRA 4H6JB 5HX9A 1TEMA 2HJEA 3N4IA 2ZC4B 4EV4A 2VEAA 4CLCD 1H3QA 2EX2A 2ZMVA 4OOLA 2JN7A 3WS5A 4RA7A 5A8BA 4G3KA 4ZAMA 2VKSA 3OBFA 4OPYA 4BD1A 2HL0A 2EA9A 4RR9A 5FASA 4U3TA 4QPRA 1GSWA 4WL9A 4Z1WA 3JYIA 4B4ZA 2Z6DA 1XA1A 3DBAA 5A92A 4L9EA 3W4PA 4WN5A 4IUKA 2V20A 5IS1A 2FFYA 5DF9A 4F3LA 4LV0A 2X01A 1NRFA 3HBRA 3MF0A 1NRJA 2HGVA 2Y2JA 4BLMA 3LR4A 3IWOA 1TVFA 2EXAA 4KZBA 1IEMA 3VP4A 3WS1A 1YQSA 3AGFA 3CUEC 3AGDA 3OCLA 4RYEA 2CMNA 2ZMFA 4WBGA 2R9XA 3KX0X 3A3FA 3KYQA 3MR0A 4WEKA 5D3OA 4DMZA 2QMIA 5F83A 3T4LA 5EE8A 1S67L 5LBRA 4RRRA 3P09A 4LRZE 3G30A 2VA0A 3QP1A 5HWTA 3W4QA 3IF6C 3UY6A 2HPBA 4RR7A 5EM0A 3PAEA 4ZTKA 5DJTA 3BRMA 1S4RA 3S4XA 3S7PA 4WF0A 1UWNX 4OP5A 5EOEA 5CHUA 2Y59A 2PYPA 1H8MA 3HL9A 3HLGA 1Q2PA 1XJ4A 5EVID 4DXBA 5GHXA 4WUJA 3W4OA 5E2EA 2Y2LA 3UNWA 4LV1A 2L1MA 4R70A 3PTEA 1QMEA 3ZVTA 2JKRM 2QKPA 5FQJA 1K4EA 1W5DA 1ESUA 3CITA 3OPPA 3BYDA 3NOPC 4U0XA 1XXMA 1IYQA 4DJ3A 3NBLA 2O9CA 4OKPA 3VSKA 2DBOA 2VGKA 4GD8A 2BTFP 3FG8A 5FI7A 5F6AA 2VZWA 4EBPA 1I2SA 3PBOA 4MN5A 4OPQA 1YT4A 3PYPA 4S2OA 4JGPA 4OPZA 3E4PA 4E3JA 1E25A 3T1QB 3UE6A 5G4YA 4E3OA 1XP4A 3LI9A 1SKOA 5KSCA 4PKYA 3SW1A 3D4FA 3ISGA 3UDXA 3A3DA 3HCYA 2OSUA 1H8ZA 2I72A 1HD8A 2XD5A 2V1BA 1ZHHB 2OWHA 4PKYG 4EW7A 4DDSA 5FEGA 4X6TA 1XJ3A 1CK3A 2XRNA 1PZOA 3MBZA 1FIKA 3F1OB 3UMDA 1GSVA 1F5MA 4Q0HA 3KOCA 4MBHA 4EUVA 2VX8A 4B88A 4OLDA 3U2AA 4O8GA 4CLCA 3BECA 3NCKA 1W63Q 3Q7VB 4Y0UA 3NOUC 4PPRA 1K54A 3MQ0A 5F69A 3MZDA 5HPFA 2J3TC 3FC7A 3HLBA 5DF7A 1YAXA 1KOUA 3CZDA 4JBFA 3E2LA 1ZKJA 4X53A 3RTYA 3BFCA 2V9AA 3O87A 1VQQA 2OAQ1 1L2SA 5EM1A 2ZL1A 3LIDA 3W2ZA 3IT9A 4RRHA 4QJGA 3KO3A 2A24B 1WYBA 1XGJA 4XT2A 4E3NA 1NY0A 4WZ4A 2H10A 1ZTUA 1TD5A 3KYEA 3VSLA 4ZJ3A 1K55A 4KZ5A 2Y79A 3FPWA 2J80A 4JXGA 1KDSA 3A0SA 1NXYA 5L2FA 4KG6A 1SDNA 2JBFA 4EXOA 4FH2A 1RCJA 3N8SA 3R7WB 5TJJA 2Y4AA 5HAQA 4PHTA 2AVXA 3FPVA 1S4SA 5GHYA 3VOLA 4GNUA 4PM6A 5G18A 3KO6A 1BZAA 5KZHA 1OTIA 4OOMA 4JGOA 2WADA 4II7A 2WZXA 2Y91A 3C5AA 1ALQA 5FAPA 3R4KA 4XXRA 2W3FA 1E4DA 4I39A 3KO5A 4DE3A 5DTSA 5IHVA 4YINA 3Q07A 4FSFA 3LMVA 4O0PA 3GVBA 4H8RA 4ARZA 2XA7S 3T4JA 4F94A 2OLUA 2XD1A 5EVIA 3TRCA 3V67A 4EBNA 1K6RA 4IBXA 3SH8A 2DCFA 3UB8A 2W1TB 5TGFA 2D02A 3ZVWA 3CI6A 2XGNA 2PU4A 1PNEA 4DXCA 1UWPX 3LICA 1YSQA 1HZOA 3PXPA 5IU1A 3UB6A 2W3DA 3KSIA 1GHPA 3O5YA 2HL1A 5CXWA 5HSQA 3FZCA 4KQQA 1ESIA 2RCXA 1F98A 4KZ6A 2W27A 4HIAA 2PDRA 3C7UA 2QJ5A 2H0TA 4I3IA 4X1LA 3GQZA 1MWSA 5M18A 2XF3A 4UA7A 4LGWA 4Y2FA 4LCLA 4NXEA 5BOHA 4RR6A 5GLDA 1KDWA 4Y13A 1T1AA 4ZDXA 2J3TD 1FR6A 2JC7A 2WGWA 3NY4A 4RRLA 3HJKA 5DTKA 3HUOA 3UB5P 5FQ9A 1F9IA 5CTNA 3F1PA 3WWXA 4C75A 1EI5A 4NXGA 3T4QA 3KSFA 3G2ZA 4C3QA 4GS9B 1DJBA 3A0RA 3OCNA 4PM5A 1M40A 4FCFA 4K0WA 3C38A 4EWFA 1JKEA 1P9RA 2WKQA 5MC7A 4ESPA 2QWSA 2O0YA 2O9BA 3SZTA 3CUEA 4D2OA 1TS7A 2XFSA 1CF0A 3QNBA 4HESA 1TF1A 2PRFA 1P9WA 5FQIA 1KE3A 4CJNA 1PI5A 4GDBA 1IYPA 3BQAA 3E0YA 4ETZA 1SDEA 5FI6A 4ZJ2A 5DF8A 4EQIA 1MWTA 5TFQA 1GHIA 5I5LA 5TBMB 3QP4A 3IH8A 4WZ5C 4WEJA 1YLWA 3IF6A 5KMWA 3FKWA 2Y2NA 2UWXA 4FOFA 4NXBA 4KZ9A 2WKHA 4Y5FA 2DMWA 3IXGA 4RX2A 1DP9A 2ZLYA 4OH0A 2A2LA 2Q0OA 2XFTA 2PT7A 1JWVA 1ONGA 3UPNA 3IXDA 1MWUA 1K6SA 3N6IA 3VP2A 2V1ZA 2Z2LB 4H6JA 4Y7PA 3H82B 3EGXC 1HLUP 2ZJ9A 4BQMA 1O07A 3LYXA 2XSSA 2ZM2A 2P7JA 3N8RA 2X71A 1YLTA 4LRYC 4UQIM 3FV7A 4R23A 3NDGA 1LI0A 4MDZA 3K2NA 2V2FF 5AJGA 1H5XA 4FTXA 2P9VB 3A3JA 2HF6A 5J7EA 1L0FA 2KDKA 4LRXC 3WRZA 3P01A 4X1MA 3IS2B 3LY4A 2HL2A 4KZ7A 3MQOA 4HNBA 1KGEA 3OZHA 5AQ7A 3JVUA 1LSVA 4RVAA 1ES4A 2B18A 5DTTA 3DWZA 3ITAA 3KNPA 4S0IA 3M2JA 1XFNA 1XX2A 4BWIA 1D06A 2H0YA 4E3MA 2Y2MA 2WZZA 5HPIA 1J3WA 2W3GA 3C30A 2XQZA 1IKGA 3K3CA 4QY5A 3T4SA 1LSWA 4MN7A 4S2MA 2VGJA 3IX4A 3BFFA 2VV6A 5GHZA 4JLFA 3DTKA 2JKFA 2XH9A 2HJ9C 5L09A 1PW1A 1VM1A 5HARA 2OOLA 4RRKA 4RRMA 3BLMA 2ZC3B 3KO9A 4E3LA 4S2LA 2WGVA 3PHYA 2HP6A 1CEFA 4MBKA 5KSHA 3CPTA 4UEYA 5FEFA 5EFWA 1J7GA 2VLGA 2L4RA 2Y8HA 4KUKA 1SCWA 1LL5A 4QB8A 5U47A 5IT5A 1SZVA 4P87A 4UA6A 3LUQA 5F82A 3CHWP 3OOVA 1YMSA 1P97A 1MXOA 1D7EA 2KOIA 4HY8A 5A90A 4P0MA 2OV5A 3LFVA 3FYZA 1F2KA 5HZHA 3LIAA 3H7WB 3E2KA 3GRJA 2EFUA 2ACGA 4GLQA 3B3XA 5HWVA 3TOIA 1YKDA 2WKRA 4GB7A 2J8YA 2GZAA 2Y2QA 4EEUA 2HKZA 3UDIA 4JF5A 2WGIA 2YKFA 2VGLM 3IH9A 2PAVP 1ERQA 3WS0A 4S2JA 4QWOA 2M7UA 1ODVA 3IQAA 5HW3A 3QP2A 1EW0A 1BTLA 3SS4A 5EV0A 1FILA 5CGWA 2XLNA 2ZQ7A 3ZNTA 1VEUB 2PD7A 4BD0A 4HP9A 1Y4OA 4KZAA 2QHKA 3V3RA 1BLCA 4BMWA 4MN6A 5DKKA 5JYOA 4K0XA 4LPZA 2XEPA 3T4OA 2VK3A 3KOBA 4HI4A 3B33A 3VE4A 5KIZA 3GMWA 3PD2A 1FSYA 1YPRA 2J3WA 1WE4A 3OPLA 5E2FA 3PD4A 3F1OA 3FKVA 3L9KA 4RRQA 3Q82A 4IEDA 3ZHHA 4R4RA 4DF6A 3PD3A 2Z6CA 4QU3A 1FSWA 4GZBA 1J9MA 2P04A 3CLOA 4ID4A 4WLAA 3PBNA 1XPBA 1G28A 4OPRA 2DRWA 3Q7VA 2A3UA 1DRMA 3JVVA 2EFXA 2B5RA 2JKRI 3ZQ5A 3LI8A 4AFIA 4CPKA 3S7OA 4K91A 3T1RA 4RRCA 3MZFA 3OPHA 1O7EA 2E8IA 1WA9A 3LMUA 4X69A 1BSGA 4E3KA 3HJIA 1K38A 3OLOA 1Y54A 2JHEA 3C8CA 4KQDA 1OJGA 3UE0A 3HUMA 4EEPA 2A49A 3M6HA 1PI4A 1NLYA 3MKFA 4XUXA 2A24A 2P08A 3P98A 1DP6A 4N9LA 4CLCB 2UV0E 4PAUA 1BULA 3MSHA 2WAEA 4X55A 3ZG8B 3PBSA 5E2HA 4UHUA 4U0TA 1K25A 3PBQA 4JPMA 3DTEA 2PBDP 3A3EA 1KVLA 2ZC6B 2OKVA 4Q0JA 3R7WA 4HQAA 1CI9A 4DRTA 3LR0A 5HAPA 2QYBA 3ICYA 4P6ZM 4CLCE 3T50A 1M6KA 3G32A 1NLZA 3ZG0A 2INWA 4YFMA 2PU2A 2JKTM 1HTZA 4QY6A 3HLFA 5E43A 4HH3A 4S0LA 1VB6A 3EQVA 5CERA 3LIBA 1GHMA 1PWDA 4MEZA 3PD5A 1N9LA 3TE8A 5AVFA 1SKFA 3G31A 5HDDA 3MFXA 2HDSA 3F1NB 4R3BA 4ZRRA 2I9VA 1DY6A 4DE1A 4Q0IA 3VMAA 4GHIB 3P7NA 3MZEA 1K57C 2PHYA 1NYYA 3NULA 3VOZA 1LLBA 2W1TA 5FQKA 4WZ5A 4RRJA 2IWCA 1ZG6A 3UPPA 1MPLA 4K08A 4HHDA 3ITBA 3LIFA 4ME4A 5HWWA 3LO7A 1K0KA 3HREA 3DWKA 2JE5A 2HDQA 4OONA 1FQGA 2B95A 3D3OA 3ZCZA 1T1CA 4RRAA 1Y2QA 1BLHA 2ZMAA 5HFOA 4NBJA 3MXQA 4QD4A 5J3WA 1FR1A 2EX6A 4X56A 2XR0A 4YNRA 3TJZC 3ZGAB 2EXBA 5DVAA 4OQGA 3BW6A 3MKEA 4N1HA 1WYCA 1K56A 3DTIA 1GA0A 4HH2A 3S22A 4BL3A 1I2WA 2YKHA 1KVMA 4S2PA 1PRQA 1E3UD 3Q1FA 4DE2A 3GR2A 2GNXA 4CLCC 3O88A 3RXXA 3UN7A 2EX8A 1YLPA 4R6LA 1IELA 3LY3A 4NK3A 3TG9A 1RGYA 1GA9A 3HLWA 3SH9A 5L07A 2B02A 2QZ6A 3GSGA 3NIAA 1MKIA 4GS9A 1YM1A 2Z2MB 4Y0TA 2V8CA 4FH4A 4KQOA 5FATA 4B9OA 1YLJA 2JKGA 3EQUA 4EESA 3BEBA 4G3VA 5DKLA 1LI9A 3M6BA 2ZOIA 4UQIS 3IBRA 1FCMA 3JPUA 3IX3A 3GV9A 4MLLA 5K5BA 3Q7ZA 1KGGA 1YLZA 3UB7A 5JYPA 3LR5A 1XFQA 5HL1A 3B42A 4GDNA 3VOYA 2GJ3A 3V39A 2XROA 1OTDA 1YSPA 4PM9A 4BENA 1U60A 4IBRA 4WYYA 3KO7A 4JF6A 3MS6A 5M19A 1NWZA 1CI8A 5EVEA 5FI2A 4WMCA 3T4KA 1XJ2A 3UE1A 3IWIA 1JNUA 2MJ6A 4BBUA 3VP3A 4KQRA 3LEQA 3BFGA 5E2GA 3MXRA 3PAGA 2IA2A 4RRGA 5CX7A 1OTAA 5HAIA 4UAAA 4I5SA 1V9ZA 1RGZA 3S1YA 3ZYTA 3HVFA 1IYSA 3H82A 3GECA 2JCHA 5C5KA 2EWVA 2G7UA 5EVLA 3T4TA 5DFXA 3IF5A 5FDHA 1VETB 3IXBA 4ZBEA 4IHQA 4E04A 3BQ8A 3N8LA 3CAXA 1S1YA 2Y2PA 3O3VA 5CGXA 1L0DA 1OJ5A 3NOTC 1BT5A 2IWDA 2P9VA 4ETXA 3OC2A 2OLVA 4JF4A 4NG2A 2WKEA 5CHJA 1NJ4A 2H28A 4I3AA 2GX5A 4X68A 1YMXA 3IS2A 1S6RA 1CEGA 4OLGA 1OPXA 2PYRA 3AGEA 3VFFA 4E6XA 1S1ZA 5F1FA 4R1GA 3UE3A 3BY9A 1ZG4A 4Y17A 3WS4A 3LR3A 3SS5A 2VV7A 5GLCA 4S2NC 2WKPA 1T18A 3VE3A 1NYMA 3BM6A 4R38A 4S02A 4LFUA 4HEFA 4X25A 1W8YA 3B47A 1I5QA 1PFLA 4EUZA 1PW8A 4Y3IA 5F68A 4LV2A 1OTBA 2ZQCA 2Y55A 1MY8A 2VGLS 3RH8B 1GCEA 3SS3A 2XK1A 4FD8A 2HDUA 4GOGA 4MCWA 1Y28A 3ZNYA 3QHYA 1STZA 3GTCA 3RXWA 3VP0A 1PIOA 1G6OA 4IJGA 2PBYA 3QP8A 1ZC2A 2FH5A 5CTMA 3C4PA 1IYOA 4DDYA 5FQMA 1MKMA 3KSGA 1YLYA 3C7VA 4F3LB 2ZC7A 4S0JA 1E3UA 3V50A 4R4SA 2ZOHA 3DW0A 2M1CA 3ZFZA 1N4OA 1DJAA 4KG5A 3HLDA 3IX8A 3LIEA 3QP5A 4BBVA 1ES2A 1PWCA 4OOYA 2ZQ9A 4DE0A 1OT6A 2ZQ8A 4KUOA 1LL8A 3N7WA 4MBFA 1CJFA 2V8FA 4HJ3A 2FFFB 2NUTC 4PM7A 1DJCA 1Z6FA 3G4PA 4RRDA 2IWBA 3H7WA 3MFDA 3CWFA 4R3JA 2Y2GA 3CPTB 4S2IA 3BFEA 3VV4A 4R3AA 5J61A 3O86A 3ZG7B 3OPRA 4HBTA 3NHQA 4YWZA 2Y2HA 3KYZA 3BWLA 3C2WA 1LHYA 3M2KA 3ULFA 3K3DA 2OAP1 3NJAA 3CG5A 1H0MA 2J7VA 1EROA 1AWIA 2R9WA 4N9KA 1VHMA 3V3SA 4S0KA 3MQQA 2BASA 4L9GA 2ZM0A 4IVKA 1IOUA 5CEDA 1UGUA 3BLSA 5L10A 3T1XA 3KNFA 3W8KA 1K56D 2R78A 4QHCA 4CQHA 2NUPC 2O9AA 1VEUA 4JGRA 5DJUA 2HP9A 5FA7A 1LT0A 1NZUA 1GSXA 4XUZA 5G4ZA 2O99A 4RRBA 2P74A 5EECA 5HDCA 1X0OA 4NXFA 1SHVA 4IUHA 1PWGA 3IHBA 3LEZA 2EWWA 5AQ9A 4RRIA 1BLPA 1IFQA 1LL9A 1K57A 2W3HA 4M3KA 1JVJA 3ZDJA 3LCEA 4MMNA 4NKPA 4Y15A 3IWQA 1FCOA 3EEHA 5DFYA 4P6ZS 2KLIA 4OP8A 1EWZA 2WUQA 2E8JA 1QMFA 4LLOB 2HDRA 1A0KA 1W8QA 4B4XA 3PBTA 1SKOB 2V0UA 5HDSA 3FWLA 3I7JA 1XJ6A 4BL2A 5EPHA 2XDMA 4JKTA 4EQ1A 4JXVA 4RRFA 3HLEA 5AVEA 1N9OA 4KZ3A 5GL9A 3MXSA 1G6AA 1T19A 4Z9QA 4OQ0A 1C3BA 2WYXA 3A3IA 2WKIA 4WMCD 1ES5A 4UA9A 5GLBA 1TC5A 3UB9A 5FQQA 4IVIA 1JWZA 2PD8A 1KE0A 5A91A 1AXBA 2QPNA 3NI9A 2VJWA 3G34A 3E98A 1FCNA 2QJ7A 4GW9A 4HJ4A 2EX9A 4BBTA 3ZG9B 2H5SA 1TS8A 3CJMA 1N9BA 4EBLA 4EERA 4O7DA 1PZPA 4NBIA 1CQAA 2V0WA 4ZJ1A 3DAVA 2WK0A 1W79A 4A5RA 3MMHA 4FUWA 3IBJA 1JTDA 3V5MA 2RL3A 4HOIA 3QP6A 4D60A 5AQBA 5EOOA 4G3WA 2Q9MA 5F1GA 5J8XA 1ONHA 1P0ZA 3TSGA 3E4QA 2ZL1B 2M7VA 1L3LA 5HD5A 3KO4A 4GN2A 4S2KA 4RR8A 4I3JA 4XT2B 1OTEA 2K2NA 4JXSA 3F1NA 1V9YA 4R0QA 5FAQA 2BLSA 3UDFA 4DKIA 3C4OA 4I38A 2W0NA 2PR6A 4GHIA 2Y2OA 5FAOA 3ZG5A 5HD3A 1MZUA 4L9FA 2K7SA 3NECA 4E6WA 4OQIA 1ES3A 4WELA 5I94A 5CRFA 3D9YA 4DJ2A 2K31A 5CECA 4L0LA 2HZ5A 3NDEA 1JWPA 2HV1A 4O01A 3UMEA 4KG2A 4S03A 3RJUA 4OQHA 3KSHA 3IXHA 3G6OA 1PYYA 1N9NA 4Y0OA 1TS6A 3KODA 1FOFA 3IHAA 2C6WB 2OWJA 3U4LP 4PMAA 3T12B 3EWKA 3D72A 1RP5A 5L8MA 2D01A 4GJ4A 4HJ6A 1XA7A 4KENB 4YOFA 4BJPA 4ARZB 1L0GA 5EVIB 2W3EA 4P85A 3EGDC 5CEBA 3E4OA 3UPOA 4M4XA 2ZBBA 3BY8A 5GLAA 2VV8A 5A93A 1T1BA 1H8YA 1BLSA 4B93A 5F5YA 1XGIA 2DNSA 2HP5A 4LCMA 2ZQDA 4GKUA 1K54C 3PBRA 2JKTI 3TW8A 3WRTA 1MBLA 1L0EA 4DN0A 2G2WA 4KZ4A 1TDGA 1S66L 4JXWA 1OT9A 4EU0A 2KX6A 5CHMA 1D1JA 2ZD8A 4HBUA 5FSRA 5FL3A 5EUAA 2ZC5B 2LB9A 4OVDA 4PM8A 4S2NA 1TDLA 2ZQAA 3LMTA 5J4EA 3UO9A 3BJNA 3VP1A 3A0VA 5CGSA 4N92A 4LENA 1HVBA 1K4FA 1S0WA 3CMZA 2J9OA 3T1SA 1Q2QA 3WS2A 4HP4A 2WGWB 3DTMA 3LGOA 2Y2IA 3SH7A 3F1PB 1K55C 2WAFA 3NC8A 3L7HA
chains in the Genus database with same CATH topology
2ZQCA 2Y55A 1MY8A 4KZAA 1XKZA 4KZ8A 5GHYA 2GDNA 5AQAA 3V3RA 1BLCA 1GCEA 3G2YA 4GNUA 4PM6A 3SS3A 5JYOA 4K0XA 2XK1A 4FD8A 2HDUA 4GOGA 5G18A 4E3IA 2XEPA 1BZAA 5KZHA 3KOBA 3ZNYA 1IKIA 3QHYA 4OOMA 3GMWA 3PD2A 2WADA 3GTCA 4NETA 1FSYA 1ERMA 2WZXA 2Y91A 3RXWA 1WE4A 3Q81A 3VP0A 1PIOA 3OPLA 5E2FA 4N1XA 3C5AA 1ALQA 2PBYA 3SOIA 2C5WB 1ZC2A 5CTMA 5FAPA 3FKVA 1G68A 3C4PA 1IYOA 3PD4A 4RRQA 3Q82A 4IEDA 3ZHHA 4DDYA 2BG1A 4R4RA 4XXRA 1OMEA 3G35A 4DF6A 5FQMA 1E4DA 3PD3A 4QU3A 3KO5A 1FSWA 4DE3A 5DTSA 1YLYA 2Q9NA 4GZBA 1J9MA 3C7VA 5IHVA 4YINA 3Q07A 4FSFA 2ZC7A 4S0JA 3LMVA 1E3UA 1KE4A 4ID4A 3GVBA 4H8RA 3V50A 4R4SA 4F94A 1JTGA 2OLUA 3DW0A 3PBNA 2XD1A 5EVIA 1XPBA 4OPRA 2J9PA 2DRWA 5M1AA 3VFHA 3Q7VA 4EBNA 2A3UA 3ZFZA 1N4OA 2EFXA 1DJAA 1K6RA 1KGFA 2B5RA 4KG5A 3HLDA 4IBXA 4GD6A 2DCFA 4LV3A 3SH8A 2X02A 1ES2A 4CPKA 1PWCA 4OOYA 4K91A 4RRCA 2ZQ9A 4P6BA 4DE0A 3MZFA 5EVIC 3OPHA 2ZQ8A 1O7EA 2E8IA 5TGFA 3N7WA 3ZVWA 4MBFA 2XGNA 2PU4A 5HAQA 4RX3A 3LMUA 1BUEA 2FFFB 4X69A 1BSGA 4DXCA 4PM7A 1DJCA 2G2UA 1Z6FA 1NZOA 3G4PA 5TR7A 4E3KA 4RRDA 2IWBA 1K38A 3MFDA 1Y54A 4WM9A 1MWRA 2ZM8A 3BFDA 4BD0A 3UE0A 3HUMA 1HZOA 3IF6B 4R3JA 2Y2GA 4S2IA 2A49A 4Q8IA 3BFEA 3M6HA 1PI4A 2Y2KA 5J61A 3O86A 3ZG7B 1GHPA 3OPRA 4HBTA 2HL1A 5CXWA 4C6YA 3FZCA 4KQQA 1ESIA 2Y2HA 2RCXA 3MKFA 4KZ6A 4XUXA 2CC1A 3P98A 3HUNA 1LHYA 3M2KA 4N9LA 3C7UA 2H0TA 3CG5A 3GQZA 1MWSA 5M18A 1W7FA 2XF3A 3QNCA 2J7VA 1EROA 3HLCA 4UA7A 1BULA 2R9WA 4N9KA 4MNRA 2WAEA 3V3SA 4LCLA 4X55A 3ZG8B 4S0KA 5BOHA 4RR6A 3PBSA 5E2HA 4UHUA 5HX9A 5GLDA 1TEMA 1KDWA 4U0TA 1K25A 2ZM0A 3N4IA 3PBQA 4IVKA 4JPMA 2ZC4B 4EV4A 5CEDA 4ZDXA 3BLSA 1FR6A 2JC7A 2WGWA 3NY4A 4RRLA 5DTKA 3KNFA 3HUOA 3W8KA 3A3EA 1K56D 5FQ9A 1KVLA 4QHCA 5CTNA 2EX2A 2ZC6B 3WWXA 2OKVA 4C75A 4OOLA 1EI5A 1CI9A 2HP9A 5FA7A 3WS5A 4RA7A 1NZUA 3G2ZA 4DRTA 4XUZA 4ZAMA 5HAPA 4C3QA 4RRBA 2P74A 4OPYA 5EECA 1M6KA 4BD1A 2HL0A 1DJBA 3G32A 4RR9A 3OCNA 5FASA 1SHVA 4U3TA 3ZG0A 4PM5A 4YFMA 2PU2A 1M40A 1HTZA 3JYIA 4B4ZA 4QY6A 3HLFA 5E43A 4FCFA 4K0WA 1PWGA 3IHBA 3LEZA 4S0LA 1XA1A 4EWFA 5A92A 1JKEA 3W4PA 3EQVA 5AQ9A 5CERA 2V20A 4RRIA 2FFYA 5DF9A 1GHMA 1PWDA 1BLPA 4MEZA 3PD5A 1LL9A 1K57A 4LV0A 1SKFA 4M3KA 3G31A 1JVJA 2X01A 2HDSA 4R3BA 3ZDJA 3LCEA 1NRFA 3IWQA 1DY6A 1FCOA 4D2OA 3HBRA 2XFSA 4DE1A 4BLMA 2Y2JA 3QNBA 4HESA 4OP8A 1EWZA 3VMAA 2WUQA 3IWOA 1TVFA 3MZEA 1K57C 1QMFA 1NYYA 2HDRA 2EXAA 4KZBA 1IEMA 1LLBA 3VOZA 3VP4A 5FQIA 1W8QA 5FQKA 1KE3A 4CJNA 1PI5A 4GDBA 3PBTA 4WZ5A 3WS1A 1YQSA 3AGFA 4B4XA 1IYPA 2IWCA 4RRJA 1ZG6A 3FWLA 3AGDA 3UPPA 1MPLA 3I7JA 3OCLA 1SDEA 5FI6A 4RYEA 4ZJ2A 3ITBA 5DF8A 4BL2A 3LO7A 2XDMA 4WBGA 1MWTA 2R9XA 4JKTA 5EPHA 5TFQA 4JXVA 4EQIA 4RRFA 1GHIA 3HLEA 3HREA 3DWKA 3IH8A 2JE5A 3A3FA 4KZ3A 4WZ5C 2HDQA 4OONA 1FQGA 4WEJA 1YLWA 3ZCZA 3IF6A 4WEKA 3FKWA 2Y2NA 5KMWA 2UWXA 4RRAA 5D3OA 1Y2QA 1BLHA 2QMIA 2ZMAA 5HFOA 4KZ9A 5F83A 2WKHA 5GL9A 4NBJA 3IXGA 4RX2A 5EE8A 3MXSA 4QD4A 1G6AA 4RRRA 2ZLYA 1FR1A 2EX6A 3P09A 4OH0A 3G30A 4X56A 4Z9QA 2XR0A 4OQ0A 1C3BA 2WYXA 3A3IA 2WKIA 3IF6C 3W4QA 3UY6A 3ZGAB 2HPBA 2XFTA 4WMCD 1JWVA 1ONGA 3UPNA 4RR7A 2EXBA 3IXDA 1MWUA 5DVAA 3PAEA 1ES5A 1K6SA 4UA9A 4ZTKA 5GLBA 4OQGA 3BRMA 1TC5A 3N6IA 3S4XA 3VP2A 3MKEA 4N1HA 2V1ZA 5FQQA 2Z2LB 4IVIA 1JWZA 1K56A 1KE0A 1WYCA 5A91A 1AXBA 2QPNA 1GA0A 3NI9A 4OP5A 4Y7PA 3S22A 4BL3A 5EOEA 5CHUA 2Y59A 1I2WA 3G34A 1KVMA 1FCNA 2ZJ9A 4S2PA 4BQMA 1E3UD 3Q1FA 1O07A 2EX9A 4DE2A 3GR2A 3HL9A 3HLGA 3ZG9B 1Q2PA 2H5SA 3O88A 5EVID 3RXXA 3UN7A 4DXBA 2ZM2A 3CJMA 5GHXA 1N9BA 4EBLA 3W4OA 5E2EA 2Y2LA 3N8RA 2X71A 4O7DA 1PZPA 1YLTA 3FV7A 3UNWA 4NBIA 2EX8A 4R23A 1YLPA 4LV1A 3NDGA 1LI0A 1IELA 3LY3A 4NK3A 3PTEA 4ZJ1A 1QMEA 3ZVTA 2WK0A 3TG9A 1RGYA 2V2FF 1W79A 4A5RA 1GA9A 3HLWA 1H5XA 3SH9A 5FQJA 1K4EA 1JTDA 2P9VB 3V5MA 1W5DA 3A3JA 2QZ6A 1ESUA 3GSGA 3NIAA 1MKIA 3OPPA 2RL3A 3BYDA 1L0FA 4U0XA 5AQBA 1XXMA 5EOOA 3WRZA 1IYQA 1YM1A 2Z2MB 4Y0TA 2Q9MA 4FH4A 5F1GA 4KQOA 5FATA 5J8XA 1ONHA 3NBLA 3TSGA 3LY4A 1YLJA 2HL2A 4KZ7A 3EQUA 1KGEA 3BEBA 4OKPA 3VSKA 2DBOA 3OZHA 3KO4A 5AQ7A 4GN2A 4S2KA 1LI9A 4RR8A 3M6BA 2VGKA 4GD8A 4RVAA 1ES4A 5DTTA 1FCMA 3DWZA 3GV9A 4MLLA 3ITAA 5FI7A 4JXSA 3KNPA 3Q7ZA 4S0IA 3M2JA 4R0QA 1XX2A 4EBPA 5FAQA 1I2SA 3PBOA 2BLSA 4OPQA 3UDFA 3C4OA 4DKIA 1KGGA 1YLZA 1YT4A 2H0YA 4S2OA 5JYPA 4OPZA 4E3MA 4E3JA 2Y2MA 1E25A 5HL1A 2WZZA 2Y2OA 4E3OA 1XP4A 2XQZA 1IKGA 5FAOA 4GDNA 3VOYA 4QY5A 5KSCA 3ZG5A 3V39A 4S2MA 2VGJA 4PM9A 4BENA 3D4FA 3ISGA 3UDXA 1U60A 4IBRA 3A3DA 4WYYA 4E6WA 2OSUA 1H8ZA 3BFFA 4JF6A 2I72A 5GHZA 4JLFA 3KO7A 4OQIA 1ES3A 2XH9A 4WELA 5I94A 5M19A 1HD8A 5CRFA 1PW1A 1VM1A 1CI8A 5HARA 5FI2A 2XD5A 4RRKA 4WMCA 4RRMA 3UE1A 3BLMA 5CECA 3IWIA 4L0LA 2ZC3B 3NDEA 1JWPA 4KG2A 4DDSA 4X6TA 3KO9A 1CK3A 4E3LA 4S03A 3RJUA 3VP3A 1PZOA 4OQHA 4KQRA 4S2LA 2WGVA 3IXHA 1PYYA 3BFGA 4Y0OA 5E2GA 2HP6A 3KODA 1CEFA 4MBKA 5KSHA 3MBZA 3MXRA 3PAGA 1FOFA 3IHAA 4RRGA 2C6WB 1J7GA 5HAIA 4UAAA 4PMAA 1RGZA 3S1YA 3HVFA 1RP5A 1IYSA 1SCWA 3KOCA 4MBHA 1LL5A 4QB8A 5U47A 2JCHA 1XA7A 4KENB 4B88A 4P87A 4BJPA 4OLDA 4UA6A 1L0GA 5EVLA 5EVIB 5F82A 4P85A 3BECA 3NCKA 1YMSA 3Q7VB 5CEBA 4Y0UA 3IF5A 4PPRA 1MXOA 3UPOA 1K54A 5FDHA 3IXBA 3MZDA 4ZBEA 5GLAA 5A93A 1H8YA 1BLSA 3N8LA 5DF7A 3HLBA 5A90A 4P0MA 1XGIA 2Y2PA 2DNSA 2OV5A 2HP5A 3O3VA 4LCMA 2ZQDA 5CGXA 1L0DA 3FYZA 3CZDA 4GKUA 4JBFA 1BT5A 1K54C 2IWDA 3E2LA 3PBRA 2P9VA 1ZKJA 4X53A 3OC2A 2OLVA 4JF4A 3E2KA 3GRJA 2WKEA 5CHJA 2EFUA 1NJ4A 3BFCA 3WRTA 1MBLA 1L0EA 3O87A 1VQQA 2G2WA 4KZ4A 1TDGA 3B3XA 4JXWA 4X68A 3TOIA 1YMXA 1L2SA 1S6RA 5CHMA 4GB7A 1CEGA 2J8YA 4OLGA 2ZD8A 2Y2QA 4RRHA 3AGEA 3IT9A 4HBUA 5FSRA 3VFFA 4E6XA 4QJGA 3KO3A 1WYBA 5EUAA 2ZC5B 3UDIA 2HKZA 4JF5A 5F1FA 1XGJA 4OVDA 2WGIA 4R1GA 4PM8A 3IH9A 4S2NA 1TDLA 4E3NA 1NY0A 2ZQAA 3UE3A 3WS0A 1ERQA 1ZG4A 4S2JA 4WZ4A 3LMTA 2H10A 3UO9A 3VP1A 3WS4A 5CGSA 3IQAA 4N92A 4LENA 5HW3A 3SS5A 1HVBA 5GLCA 3VSLA 4ZJ3A 1K55A 1K4FA 4KZ5A 1S0WA 3CMZA 4JXGA 4S2NC 2J9OA 1KDSA 1BTLA 1NYMA 3SS4A 1Q2QA 1NXYA 3BM6A 3WS2A 4S02A 5L2FA 4HEFA 4KG6A 1W8YA 2WGWB 1SDNA 3DTMA 5CGWA 2JBFA 2Y2IA 3SH7A 4FH2A 1RCJA 2XLNA 1I5QA 2ZQ7A 3N8SA 3ZNTA 4EUZA 1K55C 1PW8A 2WAFA 3NC8A 2Y4AA 4LV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQC A;  2Y55 A;  1MY8 A;  4KZA A;  1XKZ A;  4KZ8 A;  5GHY A;  2GDN A;  5AQA A;  3V3R A;  1BLC A;  1GCE A;  3G2Y A;  4GNU A;  4PM6 A;  3SS3 A;  5JYO A;  4K0X A;  2XK1 A;  4FD8 A;  2HDU A;  4GOG A;  5G18 A;  4E3I A;  2XEP A;  1BZA A;  5KZH A;  3ZNY A;  1IKI A;  3QHY A;  4OOM A;  3GMW A;  2WAD A;  3GTC A;  4NET A;  1FSY A;  1ERM A;  2WZX A;  2Y91 A;  3RXW A;  1WE4 A;  3Q81 A;  3VP0 A;  1PIO A;  3OPL A;  5E2F A;  4N1X A;  3C5A A;  1ALQ A;  2PBY A;  3SOI A;  2C5W B;  1ZC2 A;  5CTM A;  5FAP A;  3FKV A;  1G68 A;  3C4P A;  1IYO A;  3Q82 A;  4IED A;  3ZHH A;  4DDY A;  2BG1 A;  4R4R A;  4XXR A;  1OME A;  3G35 A;  4DF6 A;  5FQM A;  1E4D A;  4QU3 A;  1FSW A;  4DE3 A;  5DTS A;  1YLY A;  2Q9N A;  4GZB A;  1J9M A;  3C7V A;  5IHV A;  4YIN A;  3Q07 A;  4FSF A;  2ZC7 A;  1E3U A;  1KE4 A;  4ID4 A;  3GVB A;  4H8R A;  3V50 A;  4R4S A;  4F94 A;  1JTG A;  2OLU A;  3DW0 A;  3PBN A;  2XD1 A;  5EVI A;  1XPB A;  4OPR A;  2J9P A;  2DRW A;  5M1A A;  3VFH A;  3Q7V A;  4EBN A;  2A3U A;  3ZFZ A;  1N4O A;  2EFX A;  1DJA A;  1K6R A;  1KGF A;  2B5R A;  4KG5 A;  3HLD A;  4IBX A;  4GD6 A;  2DCF A;  4LV3 A;  3SH8 A;  2X02 A;  1ES2 A;  4CPK A;  1PWC A;  4OOY A;  4K91 A;  2ZQ9 A;  4P6B A;  4DE0 A;  3MZF A;  5EVI C;  3OPH A;  2ZQ8 A;  1O7E A;  2E8I A;  5TGF A;  3N7W A;  3ZVW A;  4MBF A;  2XGN A;  2PU4 A;  5HAQ A;  4RX3 A;  1BUE A;  2FFF B;  4X69 A;  1BSG A;  4DXC A;  4PM7 A;  1DJC A;  2G2U A;  1Z6F A;  1NZO A;  3G4P A;  5TR7 A;  4E3K A;  2IWB A;  1K38 A;  3MFD A;  1Y54 A;  4WM9 A;  1MWR A;  2ZM8 A;  3BFD A;  4BD0 A;  3UE0 A;  3HUM A;  1HZO A;  3IF6 B;  4R3J A;  2Y2G A;  4S2I A;  2A49 A;  4Q8I A;  3BFE A;  3M6H A;  1PI4 A;  2Y2K A;  3O86 A;  3ZG7 B;  1GHP A;  3OPR A;  4HBT A;  5CXW A;  4C6Y A;  3FZC A;  4KQQ A;  1ESI A;  2Y2H A;  2RCX A;  3MKF A;  4KZ6 A;  4XUX A;  2CC1 A;  3P98 A;  3HUN A;  1LHY A;  3M2K A;  4N9L A;  3C7U A;  2H0T A;  3CG5 A;  3GQZ A;  1MWS A;  5M18 A;  1W7F A;  2XF3 A;  3QNC A;  2J7V A;  1ERO A;  3HLC A;  4UA7 A;  1BUL A;  2R9W A;  4N9K A;  4MNR A;  2WAE A;  3V3S A;  4LCL A;  4X55 A;  3ZG8 B;  5BOH A;  3PBS A;  5E2H A;  4UHU A;  5HX9 A;  5GLD A;  1TEM A;  1KDW A;  4U0T A;  1K25 A;  2ZM0 A;  3N4I A;  3PBQ A;  4IVK A;  4JPM A;  2ZC4 B;  4EV4 A;  5CED A;  4ZDX A;  3BLS A;  1FR6 A;  2JC7 A;  2WGW A;  3NY4 A;  5DTK A;  3HUO A;  3W8K A;  3A3E A;  1K56 D;  5FQ9 A;  1KVL A;  4QHC A;  5CTN A;  2EX2 A;  2ZC6 B;  3WWX A;  4C75 A;  4OOL A;  1EI5 A;  1CI9 A;  2HP9 A;  5FA7 A;  3WS5 A;  4RA7 A;  1NZU A;  3G2Z A;  4DRT A;  4XUZ A;  4ZAM A;  5HAP A;  4C3Q A;  2P74 A;  4OPY A;  5EEC A;  1M6K A;  4BD1 A;  1DJB A;  3G32 A;  3OCN A;  5FAS A;  1SHV A;  4U3T A;  3ZG0 A;  4PM5 A;  4YFM A;  2PU2 A;  1M40 A;  1HTZ A;  3JYI A;  4B4Z A;  4QY6 A;  3HLF A;  5E43 A;  4FCF A;  4K0W A;  1PWG A;  3IHB A;  3LEZ A;  1XA1 A;  4EWF A;  5A92 A;  3W4P A;  3EQV A;  5AQ9 A;  5CER A;  2V20 A;  2FFY A;  5DF9 A;  1GHM A;  1PWD A;  1BLP A;  4MEZ A;  1LL9 A;  1K57 A;  4LV0 A;  1SKF A;  4M3K A;  3G31 A;  1JVJ A;  2X01 A;  2HDS A;  4R3B A;  3ZDJ A;  3LCE A;  1NRF A;  3IWQ A;  1DY6 A;  1FCO A;  4D2O A;  3HBR A;  2XFS A;  4DE1 A;  4BLM A;  2Y2J A;  3QNB A;  4HES A;  4OP8 A;  1EWZ A;  3VMA A;  2WUQ A;  3IWO A;  1TVF A;  3MZE A;  1K57 C;  1QMF A;  1NYY A;  2HDR A;  2EXA A;  4KZB A;  1IEM A;  1LLB A;  3VOZ A;  3VP4 A;  5FQI A;  1W8Q A;  5FQK A;  1KE3 A;  4CJN A;  1PI5 A;  4GDB A;  3PBT A;  4WZ5 A;  3WS1 A;  1YQS A;  3AGF A;  4B4X A;  1IYP A;  2IWC A;  1ZG6 A;  3FWL A;  3AGD A;  3UPP A;  1MPL A;  3I7J A;  3OCL A;  1SDE A;  5FI6 A;  4RYE A;  4ZJ2 A;  3ITB A;  5DF8 A;  4BL2 A;  3LO7 A;  2XDM A;  4WBG A;  1MWT A;  2R9X A;  4JKT A;  5EPH A;  5TFQ A;  4JXV A;  4EQI A;  1GHI A;  3HLE A;  3HRE A;  3DWK A;  3IH8 A;  2JE5 A;  3A3F A;  4KZ3 A;  4WZ5 C;  2HDQ A;  4OON A;  1FQG A;  4WEJ A;  1YLW A;  3ZCZ A;  3IF6 A;  4WEK A;  3FKW A;  2Y2N A;  5KMW A;  2UWX A;  5D3O A;  1BLH A;  2QMI A;  2ZMA A;  5HFO A;  4KZ9 A;  5F83 A;  2WKH A;  5GL9 A;  3IXG A;  4RX2 A;  5EE8 A;  3MXS A;  4QD4 A;  1G6A A;  2ZLY A;  1FR1 A;  2EX6 A;  3P09 A;  4OH0 A;  3G30 A;  4X56 A;  4Z9Q A;  2XR0 A;  4OQ0 A;  1C3B A;  2WYX A;  3A3I A;  2WKI A;  3IF6 C;  3W4Q A;  3UY6 A;  3ZGA B;  2HPB A;  2XFT A;  4WMC D;  1JWV A;  1ONG A;  3UPN A;  2EXB A;  3IXD A;  1MWU A;  5DVA A;  3PAE A;  1ES5 A;  1K6S A;  4UA9 A;  4ZTK A;  5GLB A;  4OQG A;  3BRM A;  3N6I A;  3S4X A;  3VP2 A;  3MKE A;  4N1H A;  2V1Z A;  5FQQ A;  2Z2L B;  4IVI A;  1JWZ A;  1K56 A;  1KE0 A;  1WYC A;  5A91 A;  1AXB A;  2QPN A;  1GA0 A;  3NI9 A;  4OP5 A;  4Y7P A;  3S22 A;  4BL3 A;  5EOE A;  5CHU A;  2Y59 A;  1I2W A;  3G34 A;  1KVM A;  1FCN A;  2ZJ9 A;  4S2P A;  4BQM A;  1E3U D;  3Q1F A;  1O07 A;  2EX9 A;  4DE2 A;  3GR2 A;  3HL9 A;  3HLG A;  3ZG9 B;  1Q2P A;  2H5S A;  3O88 A;  5EVI D;  3RXX A;  3UN7 A;  4DXB A;  2ZM2 A;  3CJM A;  5GHX A;  1N9B A;  4EBL A;  3W4O A;  5E2E A;  2Y2L A;  3N8R A;  2X71 A;  4O7D A;  1PZP A;  1YLT A;  3FV7 A;  3UNW A;  2EX8 A;  4R23 A;  1YLP A;  4LV1 A;  3NDG A;  1LI0 A;  1IEL A;  3LY3 A;  4NK3 A;  3PTE A;  4ZJ1 A;  1QME A;  3ZVT A;  2WK0 A;  3TG9 A;  1RGY A;  2V2F F;  1W79 A;  4A5R A;  1GA9 A;  3HLW A;  1H5X A;  3SH9 A;  5FQJ A;  1K4E A;  1JTD A;  2P9V B;  3V5M A;  1W5D A;  3A3J A;  2QZ6 A;  1ESU A;  3GSG A;  3NIA A;  1MKI A;  3OPP A;  2RL3 A;  3BYD A;  1L0F A;  4U0X A;  5AQB A;  1XXM A;  5EOO A;  3WRZ A;  1IYQ A;  1YM1 A;  2Z2M B;  4Y0T A;  2Q9M A;  4FH4 A;  5F1G A;  4KQO A;  5FAT A;  5J8X A;  1ONH A;  3NBL A;  3TSG A;  3LY4 A;  1YLJ A;  4KZ7 A;  3EQU A;  1KGE A;  3BEB A;  4OKP A;  3VSK A;  3OZH A;  5AQ7 A;  4GN2 A;  4S2K A;  1LI9 A;  3M6B A;  2VGK A;  4GD8 A;  4RVA A;  1ES4 A;  5DTT A;  1FCM A;  3DWZ A;  3GV9 A;  4MLL A;  3ITA A;  5FI7 A;  4JXS A;  3Q7Z A;  3M2J A;  4R0Q A;  1XX2 A;  4EBP A;  5FAQ A;  1I2S A;  3PBO A;  2BLS A;  4OPQ A;  3UDF A;  3C4O A;  4DKI A;  1KGG A;  1YLZ A;  1YT4 A;  2H0Y A;  4S2O A;  5JYP A;  4OPZ A;  4E3M A;  4E3J A;  2Y2M A;  1E25 A;  5HL1 A;  2WZZ A;  2Y2O A;  4E3O A;  1XP4 A;  2XQZ A;  1IKG A;  5FAO A;  4GDN A;  3VOY A;  4QY5 A;  5KSC A;  3ZG5 A;  3V39 A;  4S2M A;  2VGJ A;  4PM9 A;  4BEN A;  3D4F A;  3ISG A;  3UDX A;  1U60 A;  4IBR A;  3A3D A;  4WYY A;  4E6W A;  2OSU A;  1H8Z A;  3BFF A;  4JF6 A;  2I72 A;  5GHZ A;  4JLF A;  4OQI A;  1ES3 A;  2XH9 A;  4WEL A;  5I94 A;  5M19 A;  1HD8 A;  5CRF A;  1PW1 A;  1VM1 A;  1CI8 A;  5HAR A;  5FI2 A;  2XD5 A;  4WMC A;  3UE1 A;  3BLM A;  5CEC A;  3IWI A;  4L0L A;  2ZC3 B;  3NDE A;  1JWP A;  4KG2 A;  4DDS A;  4X6T A;  1CK3 A;  4E3L A;  3RJU A;  3VP3 A;  1PZO A;  4OQH A;  4KQR A;  4S2L A;  2WGV A;  3IXH A;  1PYY A;  3BFG A;  4Y0O A;  5E2G A;  2HP6 A;  1CEF A;  4MBK A;  5KSH A;  3MBZ A;  3MXR A;  3PAG A;  1FOF A;  3IHA A;  2C6W B;  5HAI A;  4UAA A;  4PMA A;  1RGZ A;  3S1Y A;  3HVF A;  1RP5 A;  1IYS A;  1SCW A;  4MBH A;  1LL5 A;  4QB8 A;  5U47 A;  2JCH A;  1XA7 A;  4KEN B;  4B88 A;  4P87 A;  4BJP A;  4OLD A;  4UA6 A;  1L0G A;  5EVL A;  5EVI B;  5F82 A;  4P85 A;  3BEC A;  3NCK A;  1YMS A;  3Q7V B;  5CEB A;  4Y0U A;  3IF5 A;  4PPR A;  1MXO A;  3UPO A;  1K54 A;  5FDH A;  3IXB A;  3MZD A;  4ZBE A;  5GLA A;  5A93 A;  1H8Y A;  1BLS A;  3N8L A;  5DF7 A;  3HLB A;  5A90 A;  4P0M A;  1XGI A;  2Y2P A;  2DNS A;  2OV5 A;  2HP5 A;  3O3V A;  4LCM A;  2ZQD A;  5CGX A;  1L0D A;  3FYZ A;  3CZD A;  4GKU A;  4JBF A;  1BT5 A;  1K54 C;  2IWD A;  3E2L A;  3PBR A;  2P9V A;  1ZKJ A;  4X53 A;  3OC2 A;  2OLV A;  4JF4 A;  3E2K A;  3GRJ A;  2WKE A;  5CHJ A;  2EFU A;  1NJ4 A;  3BFC A;  3WRT A;  1MBL A;  1L0E A;  3O87 A;  1VQQ A;  2G2W A;  4KZ4 A;  1TDG A;  3B3X A;  4JXW A;  4X68 A;  3TOI A;  1YMX A;  1L2S A;  1S6R A;  5CHM A;  4GB7 A;  1CEG A;  2J8Y A;  4OLG A;  2ZD8 A;  2Y2Q A;  3AGE A;  3IT9 A;  4HBU A;  5FSR A;  3VFF A;  4E6X A;  4QJG A;  1WYB A;  5EUA A;  2ZC5 B;  3UDI A;  4JF5 A;  5F1F A;  1XGJ A;  4OVD A;  2WGI A;  4R1G A;  4PM8 A;  3IH9 A;  4S2N A;  1TDL A;  4E3N A;  1NY0 A;  2ZQA A;  3UE3 A;  3WS0 A;  1ERQ A;  1ZG4 A;  4S2J A;  4WZ4 A;  2H10 A;  3UO9 A;  3VP1 A;  3WS4 A;  5CGS A;  3IQA A;  4N92 A;  4LEN A;  5HW3 A;  3SS5 A;  1HVB A;  5GLC A;  3VSL A;  4ZJ3 A;  1K55 A;  1K4F A;  4KZ5 A;  1S0W A;  3CMZ A;  4JXG A;  4S2N C;  2J9O A;  1KDS A;  1BTL A;  1NYM A;  3SS4 A;  1Q2Q A;  1NXY A;  3BM6 A;  3WS2 A;  5L2F A;  4HEF A;  4KG6 A;  1W8Y A;  2WGW B;  1SDN A;  3DTM A;  5CGW A;  2JBF A;  2Y2I A;  3SH7 A;  4FH2 A;  1RCJ A;  2XLN A;  1I5Q A;  2ZQ7 A;  3N8S A;  3ZNT A;  4EUZ A;  1K55 C;  1PW8 A;  2WAF A;  3NC8 A;  2Y4A A;  4LV2 A; 
#chains in the Genus database with same CATH topology
 1XKZ A;  4KZ8 A;  2XA7 M;  2GDN A;  5AQA A;  3G2Y A;  4RQ9 A;  2W1R A;  1BYW A;  4E3I A;  1Z09 A;  1IKI A;  4JGQ A;  5TBM A;  4NET A;  1LSX A;  1ERM A;  3Q81 A;  3S7N A;  1MC0 A;  4N1X A;  4NEE D;  3SOI A;  2C5W B;  1G68 A;  3PR6 A;  2BG1 A;  3H9W A;  1OME A;  3G35 A;  1G5U A;  2Q9N A;  2L0W A;  2PR5 A;  1KE4 A;  1JTG A;  5HL6 A;  2J9P A;  4GCZ A;  5M1A A;  3VFH A;  1DP8 A;  1VET A;  1KGF A;  4LV3 A;  4GD6 A;  2X02 A;  3RFB A;  4P6B A;  5EVI C;  2LB5 A;  4RX3 A;  1BUE A;  2G2U A;  1NZO A;  5TR7 A;  5FDS A;  3S7Q A;  4WM9 A;  1MWR A;  2ZM8 A;  3BFD A;  3IF6 B;  2FZ0 A;  1ACF A;  1TS0 A;  1W63 M;  4Q8I A;  3MJQ A;  4EET B;  2Y2K A;  4C6Y A;  2CC1 A;  3HUN A;  3GDI A;  1W7F A;  3QNC A;  3EOI A;  3HLC A;  3EEA A;  2V1A A;  4MNR A;  4H6J B;  5HX9 A;  1TEM A;  2HJE A;  3N4I A;  2ZC4 B;  4EV4 A;  2VEA A;  4CLC D;  1H3Q A;  2EX2 A;  2ZMV A;  4OOL A;  2JN7 A;  3WS5 A;  4RA7 A;  5A8B A;  4G3K A;  4ZAM A;  2VKS A;  3OBF A;  4OPY A;  4BD1 A;  2HL0 A;  2EA9 A;  4RR9 A;  5FAS A;  4U3T A;  4QPR A;  1GSW A;  4WL9 A;  4Z1W A;  3JYI A;  4B4Z A;  2Z6D A;  1XA1 A;  3DBA A;  5A92 A;  4L9E A;  3W4P A;  4WN5 A;  4IUK A;  2V20 A;  5IS1 A;  2FFY A;  5DF9 A;  4F3L A;  4LV0 A;  2X01 A;  1NRF A;  3HBR A;  3MF0 A;  1NRJ A;  2HGV A;  2Y2J A;  4BLM A;  3LR4 A;  3IWO A;  1TVF A;  2EXA A;  4KZB A;  1IEM A;  3VP4 A;  3WS1 A;  1YQS A;  3AGF A;  3CUE C;  3AGD A;  3OCL A;  4RYE A;  2CMN A;  2ZMF A;  4WBG A;  2R9X A;  3KX0 X;  3A3F A;  3KYQ A;  3MR0 A;  4WEK A;  5D3O A;  4DMZ A;  2QMI A;  5F83 A;  3T4L A;  5EE8 A;  1S67 L;  5LBR A;  4RRR A;  3P09 A;  4LRZ E;  3G30 A;  2VA0 A;  3QP1 A;  5HWT A;  3W4Q A;  3IF6 C;  3UY6 A;  2HPB A;  4RR7 A;  5EM0 A;  3PAE A;  4ZTK A;  5DJT A;  3BRM A;  1S4R A;  3S4X A;  3S7P A;  4WF0 A;  1UWN X;  4OP5 A;  5EOE A;  5CHU A;  2Y59 A;  2PYP A;  1H8M A;  3HL9 A;  3HLG A;  1Q2P A;  1XJ4 A;  5EVI D;  4DXB A;  5GHX A;  4WUJ A;  3W4O A;  5E2E A;  2Y2L A;  3UNW A;  4LV1 A;  2L1M A;  4R70 A;  3PTE A;  1QME A;  3ZVT A;  2JKR M;  2QKP A;  5FQJ A;  1K4E A;  1W5D A;  1ESU A;  3CIT A;  3OPP A;  3BYD A;  3NOP C;  4U0X A;  1XXM A;  1IYQ A;  4DJ3 A;  3NBL A;  2O9C A;  4OKP A;  3VSK A;  2DBO A;  2VGK A;  4GD8 A;  2BTF P;  3FG8 A;  5FI7 A;  5F6A A;  2VZW A;  4EBP A;  1I2S A;  3PBO A;  4MN5 A;  4OPQ A;  1YT4 A;  3PYP A;  4S2O A;  4JGP A;  4OPZ A;  3E4P A;  4E3J A;  1E25 A;  3T1Q B;  3UE6 A;  5G4Y A;  4E3O A;  1XP4 A;  3LI9 A;  1SKO A;  5KSC A;  4PKY A;  3SW1 A;  3D4F A;  3ISG A;  3UDX A;  3A3D A;  3HCY A;  2OSU A;  1H8Z A;  2I72 A;  1HD8 A;  2XD5 A;  2V1B A;  1ZHH B;  2OWH A;  4PKY G;  4EW7 A;  4DDS A;  5FEG A;  4X6T A;  1XJ3 A;  1CK3 A;  2XRN A;  1PZO A;  3MBZ A;  1FIK A;  3F1O B;  3UMD A;  1GSV A;  1F5M A;  4Q0H A;  3KOC A;  4MBH A;  4EUV A;  2VX8 A;  4B88 A;  4OLD A;  3U2A A;  4O8G A;  4CLC A;  3BEC A;  3NCK A;  1W63 Q;  3Q7V B;  4Y0U A;  3NOU C;  4PPR A;  1K54 A;  3MQ0 A;  5F69 A;  3MZD A;  5HPF A;  2J3T C;  3FC7 A;  3HLB A;  5DF7 A;  1YAX A;  1KOU A;  3CZD A;  4JBF A;  3E2L A;  1ZKJ A;  4X53 A;  3RTY A;  3BFC A;  2V9A A;  3O87 A;  1VQQ A;  2OAQ 1;  1L2S A;  5EM1 A;  2ZL1 A;  3LID A;  3W2Z A;  3IT9 A;  4RRH A;  4QJG A;  3KO3 A;  2A24 B;  1WYB A;  1XGJ A;  4XT2 A;  4E3N A;  1NY0 A;  4WZ4 A;  2H10 A;  1ZTU A;  1TD5 A;  3KYE A;  3VSL A;  4ZJ3 A;  1K55 A;  4KZ5 A;  2Y79 A;  3FPW A;  2J80 A;  4JXG A;  1KDS A;  3A0S A;  1NXY A;  5L2F A;  4KG6 A;  1SDN A;  2JBF A;  4EXO A;  4FH2 A;  1RCJ A;  3N8S A;  3R7W B;  5TJJ A;  2Y4A A;  5HAQ A;  4PHT A;  2AVX A;  3FPV A;  1S4S A;  5GHY A;  3VOL A;  4GNU A;  4PM6 A;  5G18 A;  3KO6 A;  1BZA A;  5KZH A;  1OTI A;  4OOM A;  4JGO A;  2WAD A;  4II7 A;  2WZX A;  2Y91 A;  3C5A A;  1ALQ A;  5FAP A;  3R4K A;  4XXR A;  2W3F A;  1E4D A;  4I39 A;  3KO5 A;  4DE3 A;  5DTS A;  5IHV A;  4YIN A;  3Q07 A;  4FSF A;  3LMV A;  4O0P A;  3GVB A;  4H8R A;  4ARZ A;  2XA7 S;  3T4J A;  4F94 A;  2OLU A;  2XD1 A;  5EVI A;  3TRC A;  3V67 A;  4EBN A;  1K6R A;  4IBX A;  3SH8 A;  2DCF A;  3UB8 A;  2W1T B;  5TGF A;  2D02 A;  3ZVW A;  3CI6 A;  2XGN A;  2PU4 A;  1PNE A;  4DXC A;  1UWP X;  3LIC A;  1YSQ A;  1HZO A;  3PXP A;  5IU1 A;  3UB6 A;  2W3D A;  3KSI A;  1GHP A;  3O5Y A;  2HL1 A;  5CXW A;  5HSQ A;  3FZC A;  4KQQ A;  1ESI A;  2RCX A;  1F98 A;  4KZ6 A;  2W27 A;  4HIA A;  2PDR A;  3C7U A;  2QJ5 A;  2H0T A;  4I3I A;  4X1L A;  3GQZ A;  1MWS A;  5M18 A;  2XF3 A;  4UA7 A;  4LGW A;  4Y2F A;  4LCL A;  4NXE A;  5BOH A;  4RR6 A;  5GLD A;  1KDW A;  4Y13 A;  1T1A A;  4ZDX A;  2J3T D;  1FR6 A;  2JC7 A;  2WGW A;  3NY4 A;  4RRL A;  3HJK A;  5DTK A;  3HUO A;  3UB5 P;  5FQ9 A;  1F9I A;  5CTN A;  3F1P A;  3WWX A;  4C75 A;  1EI5 A;  4NXG A;  3T4Q A;  3KSF A;  3G2Z A;  4C3Q A;  4GS9 B;  1DJB A;  3A0R A;  3OCN A;  4PM5 A;  1M40 A;  4FCF A;  4K0W A;  3C38 A;  4EWF A;  1JKE A;  1P9R A;  2WKQ A;  5MC7 A;  4ESP A;  2QWS A;  2O0Y A;  2O9B A;  3SZT A;  3CUE A;  4D2O A;  1TS7 A;  2XFS A;  1CF0 A;  3QNB A;  4HES A;  1TF1 A;  2PRF A;  1P9W A;  5FQI A;  1KE3 A;  4CJN A;  1PI5 A;  4GDB A;  1IYP A;  3BQA A;  3E0Y A;  4ETZ A;  1SDE A;  5FI6 A;  4ZJ2 A;  5DF8 A;  4EQI A;  1MWT A;  5TFQ A;  1GHI A;  5I5L A;  5TBM B;  3QP4 A;  3IH8 A;  4WZ5 C;  4WEJ A;  1YLW A;  3IF6 A;  5KMW A;  3FKW A;  2Y2N A;  2UWX A;  4FOF A;  4NXB A;  4KZ9 A;  2WKH A;  4Y5F A;  2DMW A;  3IXG A;  4RX2 A;  1DP9 A;  2ZLY A;  4OH0 A;  2A2L A;  2Q0O A;  2XFT A;  2PT7 A;  1JWV A;  1ONG A;  3UPN A;  3IXD A;  1MWU A;  1K6S A;  3N6I A;  3VP2 A;  2V1Z A;  2Z2L B;  4H6J A;  4Y7P A;  3H82 B;  3EGX C;  1HLU P;  2ZJ9 A;  4BQM A;  1O07 A;  3LYX A;  2XSS A;  2ZM2 A;  2P7J A;  3N8R A;  2X71 A;  1YLT A;  4LRY C;  4UQI M;  3FV7 A;  4R23 A;  3NDG A;  1LI0 A;  4MDZ A;  3K2N A;  2V2F F;  5AJG A;  1H5X A;  4FTX A;  2P9V B;  3A3J A;  2HF6 A;  5J7E A;  1L0F A;  2KDK A;  4LRX C;  3WRZ A;  3P01 A;  4X1M A;  3IS2 B;  3LY4 A;  2HL2 A;  4KZ7 A;  3MQO A;  4HNB A;  1KGE A;  3OZH A;  5AQ7 A;  3JVU A;  1LSV A;  4RVA A;  1ES4 A;  2B18 A;  5DTT A;  3DWZ A;  3ITA A;  3KNP A;  4S0I A;  3M2J A;  1XFN A;  1XX2 A;  4BWI A;  1D06 A;  2H0Y A;  4E3M A;  2Y2M A;  2WZZ A;  5HPI A;  1J3W A;  2W3G A;  3C30 A;  2XQZ A;  1IKG A;  3K3C A;  4QY5 A;  3T4S A;  1LSW A;  4MN7 A;  4S2M A;  2VGJ A;  3IX4 A;  3BFF A;  2VV6 A;  5GHZ A;  4JLF A;  3DTK A;  2JKF A;  2XH9 A;  2HJ9 C;  5L09 A;  1PW1 A;  1VM1 A;  5HAR A;  2OOL A;  4RRK A;  4RRM A;  3BLM A;  2ZC3 B;  3KO9 A;  4E3L A;  4S2L A;  2WGV A;  3PHY A;  2HP6 A;  1CEF A;  4MBK A;  5KSH A;  3CPT A;  4UEY A;  5FEF A;  5EFW A;  1J7G A;  2VLG A;  2L4R A;  2Y8H A;  4KUK A;  1SCW A;  1LL5 A;  4QB8 A;  5U47 A;  5IT5 A;  1SZV A;  4P87 A;  4UA6 A;  3LUQ A;  5F82 A;  3CHW P;  3OOV A;  1YMS A;  1P97 A;  1MXO A;  1D7E A;  2KOI A;  4HY8 A;  5A90 A;  4P0M A;  2OV5 A;  3LFV A;  3FYZ A;  1F2K A;  5HZH A;  3LIA A;  3H7W B;  3E2K A;  3GRJ A;  2EFU A;  2ACG A;  4GLQ A;  3B3X A;  5HWV A;  3TOI A;  1YKD A;  2WKR A;  4GB7 A;  2J8Y A;  2GZA A;  2Y2Q A;  4EEU A;  2HKZ A;  3UDI A;  4JF5 A;  2WGI A;  2YKF A;  2VGL M;  3IH9 A;  2PAV P;  1ERQ A;  3WS0 A;  4S2J A;  4QWO A;  2M7U A;  1ODV A;  3IQA A;  5HW3 A;  3QP2 A;  1EW0 A;  1BTL A;  3SS4 A;  5EV0 A;  1FIL A;  5CGW A;  2XLN A;  2ZQ7 A;  3ZNT A;  1VEU B;  2PD7 A;  4BD0 A;  4HP9 A;  1Y4O A;  4KZA A;  2QHK A;  3V3R A;  1BLC A;  4BMW A;  4MN6 A;  5DKK A;  5JYO A;  4K0X A;  4LPZ A;  2XEP A;  3T4O A;  2VK3 A;  3KOB A;  4HI4 A;  3B33 A;  3VE4 A;  5KIZ A;  3GMW A;  3PD2 A;  1FSY A;  1YPR A;  2J3W A;  1WE4 A;  3OPL A;  5E2F A;  3PD4 A;  3F1O A;  3FKV A;  3L9K A;  4RRQ A;  3Q82 A;  4IED A;  3ZHH A;  4R4R A;  4DF6 A;  3PD3 A;  2Z6C A;  4QU3 A;  1FSW A;  4GZB A;  1J9M A;  2P04 A;  3CLO A;  4ID4 A;  4WLA A;  3PBN A;  1XPB A;  1G28 A;  4OPR A;  2DRW A;  3Q7V A;  2A3U A;  1DRM A;  3JVV A;  2EFX A;  2B5R A;  2JKR I;  3ZQ5 A;  3LI8 A;  4AFI A;  4CPK A;  3S7O A;  4K91 A;  3T1R A;  4RRC A;  3MZF A;  3OPH A;  1O7E A;  2E8I A;  1WA9 A;  3LMU A;  4X69 A;  1BSG A;  4E3K A;  3HJI A;  1K38 A;  3OLO A;  1Y54 A;  2JHE A;  3C8C A;  4KQD A;  1OJG A;  3UE0 A;  3HUM A;  4EEP A;  2A49 A;  3M6H A;  1PI4 A;  1NLY A;  3MKF A;  4XUX A;  2A24 A;  2P08 A;  3P98 A;  1DP6 A;  4N9L A;  4CLC B;  2UV0 E;  4PAU A;  1BUL A;  3MSH A;  2WAE A;  4X55 A;  3ZG8 B;  3PBS A;  5E2H A;  4UHU A;  4U0T A;  1K25 A;  3PBQ A;  4JPM A;  3DTE A;  2PBD P;  3A3E A;  1KVL A;  2ZC6 B;  2OKV A;  4Q0J A;  3R7W A;  4HQA A;  1CI9 A;  4DRT A;  3LR0 A;  5HAP A;  2QYB A;  3ICY A;  4P6Z M;  4CLC E;  3T50 A;  1M6K A;  3G32 A;  1NLZ A;  3ZG0 A;  2INW A;  4YFM A;  2PU2 A;  2JKT M;  1HTZ A;  4QY6 A;  3HLF A;  5E43 A;  4HH3 A;  4S0L A;  1VB6 A;  3EQV A;  5CER A;  3LIB A;  1GHM A;  1PWD A;  4MEZ A;  3PD5 A;  1N9L A;  3TE8 A;  5AVF A;  1SKF A;  3G31 A;  5HDD A;  3MFX A;  2HDS A;  3F1N B;  4R3B A;  4ZRR A;  2I9V A;  1DY6 A;  4DE1 A;  4Q0I A;  3VMA A;  4GHI B;  3P7N A;  3MZE A;  1K57 C;  2PHY A;  1NYY A;  3NUL A;  3VOZ A;  1LLB A;  2W1T A;  5FQK A;  4WZ5 A;  4RRJ A;  2IWC A;  1ZG6 A;  3UPP A;  1MPL A;  4K08 A;  4HHD A;  3ITB A;  3LIF A;  4ME4 A;  5HWW A;  3LO7 A;  1K0K A;  3HRE A;  3DWK A;  2JE5 A;  2HDQ A;  4OON A;  1FQG A;  2B95 A;  3D3O A;  3ZCZ A;  1T1C A;  4RRA A;  1Y2Q A;  1BLH A;  2ZMA A;  5HFO A;  4NBJ A;  3MXQ A;  4QD4 A;  5J3W A;  1FR1 A;  2EX6 A;  4X56 A;  2XR0 A;  4YNR A;  3TJZ C;  3ZGA B;  2EXB A;  5DVA A;  4OQG A;  3BW6 A;  3MKE A;  4N1H A;  1WYC A;  1K56 A;  3DTI A;  1GA0 A;  4HH2 A;  3S22 A;  4BL3 A;  1I2W A;  2YKH A;  1KVM A;  4S2P A;  1PRQ A;  1E3U D;  3Q1F A;  4DE2 A;  3GR2 A;  2GNX A;  4CLC C;  3O88 A;  3RXX A;  3UN7 A;  2EX8 A;  1YLP A;  4R6L A;  1IEL A;  3LY3 A;  4NK3 A;  3TG9 A;  1RGY A;  1GA9 A;  3HLW A;  3SH9 A;  5L07 A;  2B02 A;  2QZ6 A;  3GSG A;  3NIA A;  1MKI A;  4GS9 A;  1YM1 A;  2Z2M B;  4Y0T A;  2V8C A;  4FH4 A;  4KQO A;  5FAT A;  4B9O A;  1YLJ A;  2JKG A;  3EQU A;  4EES A;  3BEB A;  4G3V A;  5DKL A;  1LI9 A;  3M6B A;  2ZOI A;  4UQI S;  3IBR A;  1FCM A;  3JPU A;  3IX3 A;  3GV9 A;  4MLL A;  5K5B A;  3Q7Z A;  1KGG A;  1YLZ A;  3UB7 A;  5JYP A;  3LR5 A;  1XFQ A;  5HL1 A;  3B42 A;  4GDN A;  3VOY A;  2GJ3 A;  3V39 A;  2XRO A;  1OTD A;  1YSP A;  4PM9 A;  4BEN A;  1U60 A;  4IBR A;  4WYY A;  3KO7 A;  4JF6 A;  3MS6 A;  5M19 A;  1NWZ A;  1CI8 A;  5EVE A;  5FI2 A;  4WMC A;  3T4K A;  1XJ2 A;  3UE1 A;  3IWI A;  1JNU A;  2MJ6 A;  4BBU A;  3VP3 A;  4KQR A;  3LEQ A;  3BFG A;  5E2G A;  3MXR A;  3PAG A;  2IA2 A;  4RRG A;  5CX7 A;  1OTA A;  5HAI A;  4UAA A;  4I5S A;  1V9Z A;  1RGZ A;  3S1Y A;  3ZYT A;  3HVF A;  1IYS A;  3H82 A;  3GEC A;  2JCH A;  5C5K A;  2EWV A;  2G7U A;  5EVL A;  3T4T A;  5DFX A;  3IF5 A;  5FDH A;  1VET B;  3IXB A;  4ZBE A;  4IHQ A;  4E04 A;  3BQ8 A;  3N8L A;  3CAX A;  1S1Y A;  2Y2P A;  3O3V A;  5CGX A;  1L0D A;  1OJ5 A;  3NOT C;  1BT5 A;  2IWD A;  2P9V A;  4ETX A;  3OC2 A;  2OLV A;  4JF4 A;  4NG2 A;  2WKE A;  5CHJ A;  1NJ4 A;  2H28 A;  4I3A A;  2GX5 A;  4X68 A;  1YMX A;  3IS2 A;  1S6R A;  1CEG A;  4OLG A;  1OPX A;  2PYR A;  3AGE A;  3VFF A;  4E6X A;  1S1Z A;  5F1F A;  4R1G A;  3UE3 A;  3BY9 A;  1ZG4 A;  4Y17 A;  3WS4 A;  3LR3 A;  3SS5 A;  2VV7 A;  5GLC A;  4S2N C;  2WKP A;  1T18 A;  3VE3 A;  1NYM A;  3BM6 A;  4R38 A;  4S02 A;  4LFU A;  4HEF A;  4X25 A;  1W8Y A;  3B47 A;  1I5Q A;  1PFL A;  4EUZ A;  1PW8 A;  4Y3I A;  5F68 A;  4LV2 A;  1OTB A;  2ZQC A;  2Y55 A;  1MY8 A;  2VGL S;  3RH8 B;  1GCE A;  3SS3 A;  2XK1 A;  4FD8 A;  2HDU A;  4GOG A;  4MCW A;  1Y28 A;  3ZNY A;  3QHY A;  1STZ A;  3GTC A;  3RXW A;  3VP0 A;  1PIO A;  1G6O A;  4IJG A;  2PBY A;  3QP8 A;  1ZC2 A;  2FH5 A;  5CTM A;  3C4P A;  1IYO A;  4DDY A;  5FQM A;  1MKM A;  3KSG A;  1YLY A;  3C7V A;  4F3L B;  2ZC7 A;  4S0J A;  1E3U A;  3V50 A;  4R4S A;  2ZOH A;  3DW0 A;  2M1C A;  3ZFZ A;  1N4O A;  1DJA A;  4KG5 A;  3HLD A;  3IX8 A;  3LIE A;  3QP5 A;  4BBV A;  1ES2 A;  1PWC A;  4OOY A;  2ZQ9 A;  4DE0 A;  1OT6 A;  2ZQ8 A;  4KUO A;  1LL8 A;  3N7W A;  4MBF A;  1CJF A;  2V8F A;  4HJ3 A;  2FFF B;  2NUT C;  4PM7 A;  1DJC A;  1Z6F A;  3G4P A;  4RRD A;  2IWB A;  3H7W A;  3MFD A;  3CWF A;  4R3J A;  2Y2G A;  3CPT B;  4S2I A;  3BFE A;  3VV4 A;  4R3A A;  5J61 A;  3O86 A;  3ZG7 B;  3OPR A;  4HBT A;  3NHQ A;  4YWZ A;  2Y2H A;  3KYZ A;  3BWL A;  3C2W A;  1LHY A;  3M2K A;  3ULF A;  3K3D A;  2OAP 1;  3NJA A;  3CG5 A;  1H0M A;  2J7V A;  1ERO A;  1AWI A;  2R9W A;  4N9K A;  1VHM A;  3V3S A;  4S0K A;  3MQQ A;  2BAS A;  4L9G A;  2ZM0 A;  4IVK A;  1IOU A;  5CED A;  1UGU A;  3BLS A;  5L10 A;  3T1X A;  3KNF A;  3W8K A;  1K56 D;  2R78 A;  4QHC A;  4CQH A;  2NUP C;  2O9A A;  1VEU A;  4JGR A;  5DJU A;  2HP9 A;  5FA7 A;  1LT0 A;  1NZU A;  1GSX A;  4XUZ A;  5G4Z A;  2O99 A;  4RRB A;  2P74 A;  5EEC A;  5HDC A;  1X0O A;  4NXF A;  1SHV A;  4IUH A;  1PWG A;  3IHB A;  3LEZ A;  2EWW A;  5AQ9 A;  4RRI A;  1BLP A;  1IFQ A;  1LL9 A;  1K57 A;  2W3H A;  4M3K A;  1JVJ A;  3ZDJ A;  3LCE A;  4MMN A;  4NKP A;  4Y15 A;  3IWQ A;  1FCO A;  3EEH A;  5DFY A;  4P6Z S;  2KLI A;  4OP8 A;  1EWZ A;  2WUQ A;  2E8J A;  1QMF A;  4LLO B;  2HDR A;  1A0K A;  1W8Q A;  4B4X A;  3PBT A;  1SKO B;  2V0U A;  5HDS A;  3FWL A;  3I7J A;  1XJ6 A;  4BL2 A;  5EPH A;  2XDM A;  4JKT A;  4EQ1 A;  4JXV A;  4RRF A;  3HLE A;  5AVE A;  1N9O A;  4KZ3 A;  5GL9 A;  3MXS A;  1G6A A;  1T19 A;  4Z9Q A;  4OQ0 A;  1C3B A;  2WYX A;  3A3I A;  2WKI A;  4WMC D;  1ES5 A;  4UA9 A;  5GLB A;  1TC5 A;  3UB9 A;  5FQQ A;  4IVI A;  1JWZ A;  2PD8 A;  1KE0 A;  5A91 A;  1AXB A;  2QPN A;  3NI9 A;  2VJW A;  3G34 A;  3E98 A;  1FCN A;  2QJ7 A;  4GW9 A;  4HJ4 A;  2EX9 A;  4BBT A;  3ZG9 B;  2H5S A;  1TS8 A;  3CJM A;  1N9B A;  4EBL A;  4EER A;  4O7D A;  1PZP A;  4NBI A;  1CQA A;  2V0W A;  4ZJ1 A;  3DAV A;  2WK0 A;  1W79 A;  4A5R A;  3MMH A;  4FUW A;  3IBJ A;  1JTD A;  3V5M A;  2RL3 A;  4HOI A;  3QP6 A;  4D60 A;  5AQB A;  5EOO A;  4G3W A;  2Q9M A;  5F1G A;  5J8X A;  1ONH A;  1P0Z A;  3TSG A;  3E4Q A;  2ZL1 B;  2M7V A;  1L3L A;  5HD5 A;  3KO4 A;  4GN2 A;  4S2K A;  4RR8 A;  4I3J A;  4XT2 B;  1OTE A;  2K2N A;  4JXS A;  3F1N A;  1V9Y A;  4R0Q A;  5FAQ A;  2BLS A;  3UDF A;  4DKI A;  3C4O A;  4I38 A;  2W0N A;  2PR6 A;  4GHI A;  2Y2O A;  5FAO A;  3ZG5 A;  5HD3 A;  1MZU A;  4L9F A;  2K7S A;  3NEC A;  4E6W A;  4OQI A;  1ES3 A;  4WEL A;  5I94 A;  5CRF A;  3D9Y A;  4DJ2 A;  2K31 A;  5CEC A;  4L0L A;  2HZ5 A;  3NDE A;  1JWP A;  2HV1 A;  4O01 A;  3UME A;  4KG2 A;  4S03 A;  3RJU A;  4OQH A;  3KSH A;  3IXH A;  3G6O A;  1PYY A;  1N9N A;  4Y0O A;  1TS6 A;  3KOD A;  1FOF A;  3IHA A;  2C6W B;  2OWJ A;  3U4L P;  4PMA A;  3T12 B;  3EWK A;  3D72 A;  1RP5 A;  5L8M A;  2D01 A;  4GJ4 A;  4HJ6 A;  1XA7 A;  4KEN B;  4YOF A;  4BJP A;  4ARZ B;  1L0G A;  5EVI B;  2W3E A;  4P85 A;  3EGD C;  5CEB A;  3E4O A;  3UPO A;  4M4X A;  2ZBB A;  3BY8 A;  5GLA A;  2VV8 A;  5A93 A;  1T1B A;  1H8Y A;  1BLS A;  4B93 A;  5F5Y A;  1XGI A;  2DNS A;  2HP5 A;  4LCM A;  2ZQD A;  4GKU A;  1K54 C;  3PBR A;  2JKT I;  3TW8 A;  3WRT A;  1MBL A;  1L0E A;  4DN0 A;  2G2W A;  4KZ4 A;  1TDG A;  1S66 L;  4JXW A;  1OT9 A;  4EU0 A;  2KX6 A;  5CHM A;  1D1J A;  2ZD8 A;  4HBU A;  5FSR A;  5FL3 A;  5EUA A;  2ZC5 B;  2LB9 A;  4OVD A;  4PM8 A;  4S2N A;  1TDL A;  2ZQA A;  3LMT A;  5J4E A;  3UO9 A;  3BJN A;  3VP1 A;  3A0V A;  5CGS A;  4N92 A;  4LEN A;  1HVB A;  1K4F A;  1S0W A;  3CMZ A;  2J9O A;  3T1S A;  1Q2Q A;  3WS2 A;  4HP4 A;  2WGW B;  3DTM A;  3LGO A;  2Y2I A;  3SH7 A;  3F1P B;  1K55 C;  2WAF A;  3NC8 A;  3L7H A; 
#chains in the Genus database with same CATH homology
 2ZQC A;  2Y55 A;  1MY8 A;  4KZA A;  1XKZ A;  4KZ8 A;  5GHY A;  2GDN A;  5AQA A;  3V3R A;  1BLC A;  1GCE A;  3G2Y A;  4GNU A;  4PM6 A;  3SS3 A;  5JYO A;  4K0X A;  2XK1 A;  4FD8 A;  2HDU A;  4GOG A;  5G18 A;  4E3I A;  2XEP A;  1BZA A;  5KZH A;  3KOB A;  3ZNY A;  1IKI A;  3QHY A;  4OOM A;  3GMW A;  3PD2 A;  2WAD A;  3GTC A;  4NET A;  1FSY A;  1ERM A;  2WZX A;  2Y91 A;  3RXW A;  1WE4 A;  3Q81 A;  3VP0 A;  1PIO A;  3OPL A;  5E2F A;  4N1X A;  3C5A A;  1ALQ A;  2PBY A;  3SOI A;  2C5W B;  1ZC2 A;  5CTM A;  5FAP A;  3FKV A;  1G68 A;  3C4P A;  1IYO A;  3PD4 A;  4RRQ A;  3Q82 A;  4IED A;  3ZHH A;  4DDY A;  2BG1 A;  4R4R A;  4XXR A;  1OME A;  3G35 A;  4DF6 A;  5FQM A;  1E4D A;  3PD3 A;  4QU3 A;  3KO5 A;  1FSW A;  4DE3 A;  5DTS A;  1YLY A;  2Q9N A;  4GZB A;  1J9M A;  3C7V A;  5IHV A;  4YIN A;  3Q07 A;  4FSF A;  2ZC7 A;  4S0J A;  3LMV A;  1E3U A;  1KE4 A;  4ID4 A;  3GVB A;  4H8R A;  3V50 A;  4R4S A;  4F94 A;  1JTG A;  2OLU A;  3DW0 A;  3PBN A;  2XD1 A;  5EVI A;  1XPB A;  4OPR A;  2J9P A;  2DRW A;  5M1A A;  3VFH A;  3Q7V A;  4EBN A;  2A3U A;  3ZFZ A;  1N4O A;  2EFX A;  1DJA A;  1K6R A;  1KGF A;  2B5R A;  4KG5 A;  3HLD A;  4IBX A;  4GD6 A;  2DCF A;  4LV3 A;  3SH8 A;  2X02 A;  1ES2 A;  4CPK A;  1PWC A;  4OOY A;  4K91 A;  4RRC A;  2ZQ9 A;  4P6B A;  4DE0 A;  3MZF A;  5EVI C;  3OPH A;  2ZQ8 A;  1O7E A;  2E8I A;  5TGF A;  3N7W A;  3ZVW A;  4MBF A;  2XGN A;  2PU4 A;  5HAQ A;  4RX3 A;  3LMU A;  1BUE A;  2FFF B;  4X69 A;  1BSG A;  4DXC A;  4PM7 A;  1DJC A;  2G2U A;  1Z6F A;  1NZO A;  3G4P A;  5TR7 A;  4E3K A;  4RRD A;  2IWB A;  1K38 A;  3MFD A;  1Y54 A;  4WM9 A;  1MWR A;  2ZM8 A;  3BFD A;  4BD0 A;  3UE0 A;  3HUM A;  1HZO A;  3IF6 B;  4R3J A;  2Y2G A;  4S2I A;  2A49 A;  4Q8I A;  3BFE A;  3M6H A;  1PI4 A;  2Y2K A;  5J61 A;  3O86 A;  3ZG7 B;  1GHP A;  3OPR A;  4HBT A;  2HL1 A;  5CXW A;  4C6Y A;  3FZC A;  4KQQ A;  1ESI A;  2Y2H A;  2RCX A;  3MKF A;  4KZ6 A;  4XUX A;  2CC1 A;  3P98 A;  3HUN A;  1LHY A;  3M2K A;  4N9L A;  3C7U A;  2H0T A;  3CG5 A;  3GQZ A;  1MWS A;  5M18 A;  1W7F A;  2XF3 A;  3QNC A;  2J7V A;  1ERO A;  3HLC A;  4UA7 A;  1BUL A;  2R9W A;  4N9K A;  4MNR A;  2WAE A;  3V3S A;  4LCL A;  4X55 A;  3ZG8 B;  4S0K A;  5BOH A;  4RR6 A;  3PBS A;  5E2H A;  4UHU A;  5HX9 A;  5GLD A;  1TEM A;  1KDW A;  4U0T A;  1K25 A;  2ZM0 A;  3N4I A;  3PBQ A;  4IVK A;  4JPM A;  2ZC4 B;  4EV4 A;  5CED A;  4ZDX A;  3BLS A;  1FR6 A;  2JC7 A;  2WGW A;  3NY4 A;  4RRL A;  5DTK A;  3KNF A;  3HUO A;  3W8K A;  3A3E A;  1K56 D;  5FQ9 A;  1KVL A;  4QHC A;  5CTN A;  2EX2 A;  2ZC6 B;  3WWX A;  2OKV A;  4C75 A;  4OOL A;  1EI5 A;  1CI9 A;  2HP9 A;  5FA7 A;  3WS5 A;  4RA7 A;  1NZU A;  3G2Z A;  4DRT A;  4XUZ A;  4ZAM A;  5HAP A;  4C3Q A;  4RRB A;  2P74 A;  4OPY A;  5EEC A;  1M6K A;  4BD1 A;  2HL0 A;  1DJB A;  3G32 A;  4RR9 A;  3OCN A;  5FAS A;  1SHV A;  4U3T A;  3ZG0 A;  4PM5 A;  4YFM A;  2PU2 A;  1M40 A;  1HTZ A;  3JYI A;  4B4Z A;  4QY6 A;  3HLF A;  5E43 A;  4FCF A;  4K0W A;  1PWG A;  3IHB A;  3LEZ A;  4S0L A;  1XA1 A;  4EWF A;  5A92 A;  1JKE A;  3W4P A;  3EQV A;  5AQ9 A;  5CER A;  2V20 A;  4RRI A;  2FFY A;  5DF9 A;  1GHM A;  1PWD A;  1BLP A;  4MEZ A;  3PD5 A;  1LL9 A;  1K57 A;  4LV0 A;  1SKF A;  4M3K A;  3G31 A;  1JVJ A;  2X01 A;  2HDS A;  4R3B A;  3ZDJ A;  3LCE A;  1NRF A;  3IWQ A;  1DY6 A;  1FCO A;  4D2O A;  3HBR A;  2XFS A;  4DE1 A;  4BLM A;  2Y2J A;  3QNB A;  4HES A;  4OP8 A;  1EWZ A;  3VMA A;  2WUQ A;  3IWO A;  1TVF A;  3MZE A;  1K57 C;  1QMF A;  1NYY A;  2HDR A;  2EXA A;  4KZB A;  1IEM A;  1LLB A;  3VOZ A;  3VP4 A;  5FQI A;  1W8Q A;  5FQK A;  1KE3 A;  4CJN A;  1PI5 A;  4GDB A;  3PBT A;  4WZ5 A;  3WS1 A;  1YQS A;  3AGF A;  4B4X A;  1IYP A;  2IWC A;  4RRJ A;  1ZG6 A;  3FWL A;  3AGD A;  3UPP A;  1MPL A;  3I7J A;  3OCL A;  1SDE A;  5FI6 A;  4RYE A;  4ZJ2 A;  3ITB A;  5DF8 A;  4BL2 A;  3LO7 A;  2XDM A;  4WBG A;  1MWT A;  2R9X A;  4JKT A;  5EPH A;  5TFQ A;  4JXV A;  4EQI A;  4RRF A;  1GHI A;  3HLE A;  3HRE A;  3DWK A;  3IH8 A;  2JE5 A;  3A3F A;  4KZ3 A;  4WZ5 C;  2HDQ A;  4OON A;  1FQG A;  4WEJ A;  1YLW A;  3ZCZ A;  3IF6 A;  4WEK A;  3FKW A;  2Y2N A;  5KMW A;  2UWX A;  4RRA A;  5D3O A;  1Y2Q A;  1BLH A;  2QMI A;  2ZMA A;  5HFO A;  4KZ9 A;  5F83 A;  2WKH A;  5GL9 A;  4NBJ A;  3IXG A;  4RX2 A;  5EE8 A;  3MXS A;  4QD4 A;  1G6A A;  4RRR A;  2ZLY A;  1FR1 A;  2EX6 A;  3P09 A;  4OH0 A;  3G30 A;  4X56 A;  4Z9Q A;  2XR0 A;  4OQ0 A;  1C3B A;  2WYX A;  3A3I A;  2WKI A;  3IF6 C;  3W4Q A;  3UY6 A;  3ZGA B;  2HPB A;  2XFT A;  4WMC D;  1JWV A;  1ONG A;  3UPN A;  4RR7 A;  2EXB A;  3IXD A;  1MWU A;  5DVA A;  3PAE A;  1ES5 A;  1K6S A;  4UA9 A;  4ZTK A;  5GLB A;  4OQG A;  3BRM A;  1TC5 A;  3N6I A;  3S4X A;  3VP2 A;  3MKE A;  4N1H A;  2V1Z A;  5FQQ A;  2Z2L B;  4IVI A;  1JWZ A;  1K56 A;  1KE0 A;  1WYC A;  5A91 A;  1AXB A;  2QPN A;  1GA0 A;  3NI9 A;  4OP5 A;  4Y7P A;  3S22 A;  4BL3 A;  5EOE A;  5CHU A;  2Y59 A;  1I2W A;  3G34 A;  1KVM A;  1FCN A;  2ZJ9 A;  4S2P A;  4BQM A;  1E3U D;  3Q1F A;  1O07 A;  2EX9 A;  4DE2 A;  3GR2 A;  3HL9 A;  3HLG A;  3ZG9 B;  1Q2P A;  2H5S A;  3O88 A;  5EVI D;  3RXX A;  3UN7 A;  4DXB A;  2ZM2 A;  3CJM A;  5GHX A;  1N9B A;  4EBL A;  3W4O A;  5E2E A;  2Y2L A;  3N8R A;  2X71 A;  4O7D A;  1PZP A;  1YLT A;  3FV7 A;  3UNW A;  4NBI A;  2EX8 A;  4R23 A;  1YLP A;  4LV1 A;  3NDG A;  1LI0 A;  1IEL A;  3LY3 A;  4NK3 A;  3PTE A;  4ZJ1 A;  1QME A;  3ZVT A;  2WK0 A;  3TG9 A;  1RGY A;  2V2F F;  1W79 A;  4A5R A;  1GA9 A;  3HLW A;  1H5X A;  3SH9 A;  5FQJ A;  1K4E A;  1JTD A;  2P9V B;  3V5M A;  1W5D A;  3A3J A;  2QZ6 A;  1ESU A;  3GSG A;  3NIA A;  1MKI A;  3OPP A;  2RL3 A;  3BYD A;  1L0F A;  4U0X A;  5AQB A;  1XXM A;  5EOO A;  3WRZ A;  1IYQ A;  1YM1 A;  2Z2M B;  4Y0T A;  2Q9M A;  4FH4 A;  5F1G A;  4KQO A;  5FAT A;  5J8X A;  1ONH A;  3NBL A;  3TSG A;  3LY4 A;  1YLJ A;  2HL2 A;  4KZ7 A;  3EQU A;  1KGE A;  3BEB A;  4OKP A;  3VSK A;  2DBO A;  3OZH A;  3KO4 A;  5AQ7 A;  4GN2 A;  4S2K A;  1LI9 A;  4RR8 A;  3M6B A;  2VGK A;  4GD8 A;  4RVA A;  1ES4 A;  5DTT A;  1FCM A;  3DWZ A;  3GV9 A;  4MLL A;  3ITA A;  5FI7 A;  4JXS A;  3KNP A;  3Q7Z A;  4S0I A;  3M2J A;  4R0Q A;  1XX2 A;  4EBP A;  5FAQ A;  1I2S A;  3PBO A;  2BLS A;  4OPQ A;  3UDF A;  3C4O A;  4DKI A;  1KGG A;  1YLZ A;  1YT4 A;  2H0Y A;  4S2O A;  5JYP A;  4OPZ A;  4E3M A;  4E3J A;  2Y2M A;  1E25 A;  5HL1 A;  2WZZ A;  2Y2O A;  4E3O A;  1XP4 A;  2XQZ A;  1IKG A;  5FAO A;  4GDN A;  3VOY A;  4QY5 A;  5KSC A;  3ZG5 A;  3V39 A;  4S2M A;  2VGJ A;  4PM9 A;  4BEN A;  3D4F A;  3ISG A;  3UDX A;  1U60 A;  4IBR A;  3A3D A;  4WYY A;  4E6W A;  2OSU A;  1H8Z A;  3BFF A;  4JF6 A;  2I72 A;  5GHZ A;  4JLF A;  3KO7 A;  4OQI A;  1ES3 A;  2XH9 A;  4WEL A;  5I94 A;  5M19 A;  1HD8 A;  5CRF A;  1PW1 A;  1VM1 A;  1CI8 A;  5HAR A;  5FI2 A;  2XD5 A;  4RRK A;  4WMC A;  4RRM A;  3UE1 A;  3BLM A;  5CEC A;  3IWI A;  4L0L A;  2ZC3 B;  3NDE A;  1JWP A;  4KG2 A;  4DDS A;  4X6T A;  3KO9 A;  1CK3 A;  4E3L A;  4S03 A;  3RJU A;  3VP3 A;  1PZO A;  4OQH A;  4KQR A;  4S2L A;  2WGV A;  3IXH A;  1PYY A;  3BFG A;  4Y0O A;  5E2G A;  2HP6 A;  3KOD A;  1CEF A;  4MBK A;  5KSH A;  3MBZ A;  3MXR A;  3PAG A;  1FOF A;  3IHA A;  4RRG A;  2C6W B;  1J7G A;  5HAI A;  4UAA A;  4PMA A;  1RGZ A;  3S1Y A;  3HVF A;  1RP5 A;  1IYS A;  1SCW A;  3KOC A;  4MBH A;  1LL5 A;  4QB8 A;  5U47 A;  2JCH A;  1XA7 A;  4KEN B;  4B88 A;  4P87 A;  4BJP A;  4OLD A;  4UA6 A;  1L0G A;  5EVL A;  5EVI B;  5F82 A;  4P85 A;  3BEC A;  3NCK A;  1YMS A;  3Q7V B;  5CEB A;  4Y0U A;  3IF5 A;  4PPR A;  1MXO A;  3UPO A;  1K54 A;  5FDH A;  3IXB A;  3MZD A;  4ZBE A;  5GLA A;  5A93 A;  1H8Y A;  1BLS A;  3N8L A;  5DF7 A;  3HLB A;  5A90 A;  4P0M A;  1XGI A;  2Y2P A;  2DNS A;  2OV5 A;  2HP5 A;  3O3V A;  4LCM A;  2ZQD A;  5CGX A;  1L0D A;  3FYZ A;  3CZD A;  4GKU A;  4JBF A;  1BT5 A;  1K54 C;  2IWD A;  3E2L A;  3PBR A;  2P9V A;  1ZKJ A;  4X53 A;  3OC2 A;  2OLV A;  4JF4 A;  3E2K A;  3GRJ A;  2WKE A;  5CHJ A;  2EFU A;  1NJ4 A;  3BFC A;  3WRT A;  1MBL A;  1L0E A;  3O87 A;  1VQQ A;  2G2W A;  4KZ4 A;  1TDG A;  3B3X A;  4JXW A;  4X68 A;  3TOI A;  1YMX A;  1L2S A;  1S6R A;  5CHM A;  4GB7 A;  1CEG A;  2J8Y A;  4OLG A;  2ZD8 A;  2Y2Q A;  4RRH A;  3AGE A;  3IT9 A;  4HBU A;  5FSR A;  3VFF A;  4E6X A;  4QJG A;  3KO3 A;  1WYB A;  5EUA A;  2ZC5 B;  3UDI A;  2HKZ A;  4JF5 A;  5F1F A;  1XGJ A;  4OVD A;  2WGI A;  4R1G A;  4PM8 A;  3IH9 A;  4S2N A;  1TDL A;  4E3N A;  1NY0 A;  2ZQA A;  3UE3 A;  3WS0 A;  1ERQ A;  1ZG4 A;  4S2J A;  4WZ4 A;  3LMT A;  2H10 A;  3UO9 A;  3VP1 A;  3WS4 A;  5CGS A;  3IQA A;  4N92 A;  4LEN A;  5HW3 A;  3SS5 A;  1HVB A;  5GLC A;  3VSL A;  4ZJ3 A;  1K55 A;  1K4F A;  4KZ5 A;  1S0W A;  3CMZ A;  4JXG A;  4S2N C;  2J9O A;  1KDS A;  1BTL A;  1NYM A;  3SS4 A;  1Q2Q A;  1NXY A;  3BM6 A;  3WS2 A;  4S02 A;  5L2F A;  4HEF A;  4KG6 A;  1W8Y A;  2WGW B;  1SDN A;  3DTM A;  5CGW A;  2JBF A;  2Y2I A;  3SH7 A;  4FH2 A;  1RCJ A;  2XLN A;  1I5Q A;  2ZQ7 A;  3N8S A;  3ZNT A;  4EUZ A;  1K55 C;  1PW8 A;  2WAF A;  3NC8 A;  2Y4A A;  4LV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...