2EXBA

Crystal structure of penicillin binding protein 4 (dacb) from escherichia coli, complexed with flomox
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
454
structure length
446
Chain Sequence
DEYITQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKYELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYAVRIPLVRFESRLYKDIYQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Penicillin-binding protein 4
publication title Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, both in the native form and covalently linked to various antibiotics
pubmed doi rcsb
source organism Escherichia coli
total genus 137
structure length 446
sequence length 454
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2005-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2exbA01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 2exbA02
4X53A 1SKFA 1FSWA 1LLBA 1XX2A 3OPHA 4GN2A 4HEFA 4OKPA 5DF7A 3GTCA 3HLFA 2WKIA 1CI8A 3TOIA 1K55C 4E3MA 1BTLA 1K25A 4JXWA 2WZZA 4RA7A 4KZBA 1KGFA 5FQJA 3BFDA 1XP4A 2ZQ7A 3VSLA 4H8RA 5FSRA 3DTMA 2Y2MA 3HLEA 5CXWA 4C3QA 3QHYA 1YLYA 2Z2MB 2FFYA 3C7VA 4OQIA 4R3JA 3ZCZA 3UDFA 3ZG0A 5JYPA 1K4EA 4QJGA 1GHPA 1S6RA 3FWLA 3UPPA 1K56A 2ZMAA 5EVIB 5TFQA 3Q7ZA 3RXWA 2WYXA 2ZQCA 1KDWA 1G6AA 2V2FF 5DTSA 5M1AA 4JBFA 1IEMA 1L0GA 1I2SA 4HESA 2H0YA 4R23A 3EQUA 3G2YA 4KZ9A 3BECA 2Y55A 4OQ0A 4U3TA 3G32A 4S2NA 2BG1A 1AXBA 3NC8A 1BULA 3HLCA 4S2MA 5FI6A 2JCHA 4UA6A 3HUNA 1NXYA 2OSUA 1PW1A 5M19A 2PU4A 4KZ6A 1CEGA 3IT9A 1O07A 1YLZA 2WAFA 5DF8A 3WS5A 5EOEA 3O88A 4RYEA 5GLBA 3IXBA 4QY5A 3VSKA 3UDXA 1XKZA 3CG5A 2WGVA 3A3IA 3IF6B 3OPLA 1SDNA 1XGIA 3N7WA 3HLDA 4QY6A 3BLSA 3P98A 4GOGA 3W8KA 3DW0A 3M2KA 3WS0A 1K54C 3O86A 4DE1A 5FQ9A 1XA7A 4JF4A 4LV2A 1MWUA 1K6RA 3UE3A 3M6BA 4ID4A 3JYIA 3EQVA 2XEPA 3GQZA 1J9MA 1ONGA 4KZ4A 1RP5A 2RCXA 5CEDA 4R4RA 4ZBEA 1K57C 1NYMA 5EPHA 3NDGA 3V5MA 5DTTA 3FZCA 4E3JA 4PPRA 1H8ZA 3IF5A 3C4OA 4L0LA 4WBGA 1NZOA 1WYCA 3VP3A 4CJNA 3VFFA 4BD1A 5FQMA 4WELA 3GV9A 2DRWA 4KQOA 4LCLA 4JF6A 1QMFA 1KE3A 4WZ5A 3UPNA 3SH9A 3ZG9B 1ZG6A 3PBTA 3ZHHA 4MLLA 3BM6A 3G2ZA 1NZUA 4S2IA 5E43A 1HVBA 1MWSA 1JWZA 5EVIA 4OPQA 5BOHA 3HUMA 5DF9A 1MXOA 3Q82A 2G2WA 2XH9A 3NI9A 1PI5A 3PBQA 4YINA 4A5RA 1KGGA 2QMIA 1MWTA 4U0TA 3FYZA 5G18A 5GL9A 3HREA 4KG2A 4P0MA 4OLGA 1FCNA 1PW8A 5F82A 1JWPA 1RCJA 2Y2GA 5GHZA 3W4QA 2Y2LA 4KZAA 2X71A 4K0WA 1IYQA 2EXBA 3CJMA 4FSFA 4GKUA 4EBPA 3SOIA 5CHMA 4X68A 4IVIA 4WZ4A 5AQAA 3MKEA 3LCEA 5F1FA 3A3EA 1DJAA 5CTMA 4P87A 1K6SA 3V3RA 3BFCA 1IKGA 3V50A 3PBNA 4KZ3A 2WGWB 3LO7A 4KZ5A 5L2FA 3W4PA 1MKIA 1Z6FA 2WUQA 4DF6A 3CMZA 5AQ9A 5FQIA 4EQIA 1H5XA 3ISGA 5EECA 3LY3A 2XR0A 5A90A 1W8YA 1NJ4A 2I72A 5KZHA 2DNSA 3VOZA 2EX2A 4OVDA 1FOFA 2OLVA 1JVJA 4F94A 2ZC5B 3O3VA 3Q7VA 4HBTA 4OLDA 1GA9A 3SH8A 3M2JA 4Y0TA 3WS4A 1ERMA 3OCNA 4XUZA 2V20A 2DCFA 3GMWA 4BQMA 4M3KA 4E6WA 1W8QA 5JYOA 4MBFA 1ES4A 5CHUA 4LCMA 3Q81A 3G4PA 4NETA 4OQHA 1FSYA 3GR2A 2C5WB 3WS1A 1L0DA 1NY0A 3ZDJA 4LV1A 2ZC7A 1Q2QA 2Y4AA 3I7JA 1ES5A 4RVAA 4PMAA 1K55A 4QU3A 1HZOA 3NY4A 4FH2A 1XA1A 3GRJA 4GD8A 5FI2A 4X6TA 1K38A 3G34A 4KZ7A 4X55A 1ESUA 3BEBA 2XGNA 1YMSA 4E3NA 3NDEA 5E2GA 1EWZA 3IH8A 2Q9MA 4R4SA 4KG6A 3MBZA 3ZVTA 2XFSA 4PM7A 3MZEA 5CGXA 2P74A 4OQGA 3ZNYA 3ZNTA 3ZG8B 1DY6A 1EROA 4QHCA 2QZ6A 3AGDA 3IH9A 1C3BA 2EX6A 4N9KA 3S1YA 3TSGA 3S22A 1BSGA 1M6KA 2J9OA 4P85A 4O7DA 5KMWA 5F1GA 1YLPA 2Y2JA 5GLCA 3PBRA 4WMCA 5GLDA 4B4ZA 2PU2A 2Y2HA 1E3UA 1ALQA 3BLMA 5IHVA 4DRTA 3MXSA 1OMEA 2FFFB 2WGWA 5FQKA 3Q7VB 4CPKA 2OV5A 1W5DA 3VFHA 2C6WB 4FD8A 1KDSA 4C75A 2A49A 3SS4A 3MKFA 1TDLA 4GD6A 5HAPA 5GLAA 2HPBA 1ESIA 2JBFA 2ZJ9A 5FA7A 5E2FA 4ZJ2A 1QMEA 3N4IA 4KZ8A 1GHIA 2WKHA 1XXMA 4GDNA 3IXHA 2ZC3B 5AQBA 2E8IA 5CHJA 3VP0A 1K56D 4DXCA 4MBHA 3OC2A 1ZC2A 2XQZA 2ZQDA 4R1GA 4RX2A 4EUZA 5TR7A 5EVIC 2XLNA 3V3SA 4OH0A 2HDUA 5A91A 1E25A 4IBXA 5EOOA 1SHVA 3SS5A 3E2LA 1LI9A 1MY8A 2XD1A 4JXVA 4Q8IA 1HTZA 4LENA 3RXXA 5FDHA 5GHYA 4BJPA 4YFMA 4EBNA 3UO9A 2Y2KA 2G2UA 1FR1A 3QNCA 5E2HA 3VP1A 2IWBA 1K57A 4X69A 5EUAA 1L0FA 4BL2A 2Y59A 3B3XA 3WRZA 3WRTA 1WE4A 5DVAA 5FAOA 1JWVA 4E6XA 3HBRA 4GZBA 1I2WA 4DDSA 1LI0A 1PWCA 2OLUA 5HARA 4Y7PA 3N8LA 4DE0A 1ES2A 1G68A 3IF6C 5FASA 5CEBA 1GCEA 1VQQA 4MNRA 2EXAA 4JLFA 4S2JA 2R9XA 4JXSA 1FR6A 4Z9QA 2HP6A 5HAQA 5A92A 1ZG4A 1BZAA 1FQGA 4KQRA 1YM1A 2VGKA 4OOMA 4D2OA 3OCLA 2Y2IA 1KVLA 2HP5A 1KE4A 1L0EA 3A3FA 3C7UA 3IHBA 3IQAA 4MBKA 1IYPA 2ZM2A 4R3BA 5E2EA 3W4OA 4PM9A 3ITBA 2IWCA 3P09A 5KSHA 1YLJA 3N8RA 4WEJA 2GDNA 4KENB 5HAIA 3C5AA 5DTKA 4EV4A 2HDSA 4E3OA 4OOYA 4E3IA 2EX8A 3IXGA 3A3DA 1WYBA 1Q2PA 4EBLA 4ZDXA 2X02A 3FKVA 2XK1A 3M6HA 1LHYA 1TEMA 4OOLA 3ZG7B 1FCMA 4ZAMA 1L2SA 4DE2A 1MPLA 1RGZA 3GVBA 4Y0OA 2Y2OA 3E2KA 4N1XA 1YT4A 4X56A 5FI7A 2ZM8A 4UHUA 1BLSA 4XXRA 4U0XA 5FAPA 4Y0UA 4N92A 2JE5A 3DWKA 3G35A 3ZVWA 2CC1A 3UE0A 4S2NC 1IELA 1PI4A 1YMXA 1XGJA 4IVKA 4BD0A 5EVID 4GB7A 4R0QA 3N6IA 5CRFA 4JF5A 1BUEA 4WYYA 3UNWA 1W7FA 2X01A 1ERQA 2EFUA 3FV7A 3V39A 3MZFA 1MBLA 4FCFA 1PYYA 3IWOA 2Y2PA 1YQSA 1IYOA 3Q07A 2H10A 5KSCA 2HDQA 2P9VB 2IWDA 2UWXA 3FKWA 1PZOA 4DE3A 2WK0A 4WM9A 1ONHA 3HLGA 1Y54A 4JPMA 3O87A 1ZKJA 3VP4A 4S2PA 2Y2QA 4ZJ3A 3NCKA 3VOYA 4BLMA 1RGYA 3PAGA 3UY6A 5CGWA 1BLHA 3OZHA 2XF3A 1EI5A 2J9PA 5J8XA 4KG5A 5CERA 3ITAA 3ZG5A 3BFGA 3Q1FA 4S2KA 3S4XA 1BLPA 1N9BA 1PZPA 1E4DA 3PBOA 2ZC4B 1IYSA 3LEZA 5FATA 3IWQA 5CGSA 2RL3A 3QNBA 3SH7A 1KVMA 5I94A 4NK3A 4RX3A 1W79A 5FQQA 3N8SA 1GA0A 2H5SA 4K91A 4E3LA 1U60A 3PBSA 3LY4A 4HBUA 4PM5A 3BFFA 4S2OA 1TVFA 3WS2A 4PM8A 3UE1A 1O7EA 5HW3A 1N4OA 4WZ5C 2J7VA 3G30A 3MZDA 5EVLA 1SCWA 3ZGAB 1PWDA 4LV0A 5A93A 1SDEA 2Z2LB 4IBRA 3NBLA 2Q9NA 1K54A 3GSGA 2WKEA 4K0XA 1YLWA 3BYDA 4JKTA 4UA9A 4EWFA 1CK3A 2XD5A 5FAQA 3HUOA 3A3JA 1PIOA 2ZM0A 3AGEA 1TDGA 4P6BA 4DKIA 3MFDA 5U47A 1LL9A 2Y2NA 2Y91A 4E3KA 4DXBA 3TG9A 4B4XA 2ZLYA 5EE8A 3UPOA 3PTEA 3WWXA 2ZQ8A 4DDYA 4IEDA 1LL5A 4OPRA 5TGFA 4QB8A 1K4FA 3C4PA 5HX9A 1FCOA 2EFXA 3IHAA 4WEKA 5D3OA 4B88A 1H8YA 2BLSA 4OONA 1PWGA 4XUXA 3UDIA 4N1HA 4PM6A 2ZC6B 3HLWA 4BENA 2HP9A 3NIAA 2XDMA 4OP5A 4UAAA 1YLTA 3DWZA 1I5QA 2XFTA 3AGFA 1NYYA 2P9VA 2QPNA 3D4FA 4GDBA 4UA7A 3HLBA 1DJCA 5GHXA 2WADA 3BFEA 3IWIA 1JTGA 2WZXA 4QD4A 4N9LA 3HVFA 3IXDA 2VGJA 3PAEA 2PBYA 1IKIA 4JXGA 4GNUA 4WMCD 1DJBA 5F83A 3RJUA 1VM1A 1E3UD 4OP8A 4OPZA 1GHMA 3ZFZA 3SS3A 5M18A 1MWRA 1CEFA 2JC7A 2WAEA 1CI9A 3OPPA 4LV3A 2ZQAA 2J8YA 5HFOA 3VP2A 1BLCA 2ZQ9A 3HL9A 2WGIA 4MEZA 4C6YA 4ZTKA 3VMAA 1KE0A 2B5RA 2H0TA 5CECA 3G31A 1ES3A 4BL3A 1HD8A 5HL1A 1NRFA 1BT5A 4OPYA 3UN7A 5CTNA 4KQQA 3MXRA 5AQ7A 4ZJ1A 1JTDA 3IF6A 2R9WA 2ZD8A 1S0WA 2A3UA 3OPRA 2V1ZA 1KGEA 4FH4A 1M40A 2EX9A 3BRMA 4S2LA 2HDRA 1XPBA 3CZDA
chains in the Genus database with same CATH superfamily
1LLBA 1XX2A 4GN2A 4OKPA 1F98A 5DF7A 3GTCA 4IUKA 2DMWA 1Z09A 2WZZA 4E04A 1KGFA 4EUVA 3BFDA 1XP4A 1VETA 4EETB 3QHYA 4OQIA 3UDFA 3ZG0A 5JYPA 2VEAA 1K4EA 3FWLA 5TFQA 3Q7ZA 2WYXA 4RRGA 5L07A 2ZQCA 2V2FF 2VA0A 4PKYA 2HGVA 5DKLA 1IEMA 3LIAA 1L0GA 4FUWA 4KZ9A 2Y55A 3P7NA 4S2NA 3HLCA 3HUNA 5F68A 4KZ6A 3IT9A 1O07A 2L1MA 2V8FA 5KIZA 3IXBA 2HF6A 1PNEA 1OT9A 1K0KA 1XGIA 4F3LA 3QP8A 3BLSA 3W8KA 3DW0A 3LYXA 1XA7A 4JF4A 1UWNX 4LRXC 4LV2A 3E4QA 3KYQA 4RRAA 2XEPA 1VETB 4KZ4A 1RP5A 5CEDA 4NXEA 4ZBEA 2YKHA 3NDGA 3R4KA 4PPRA 3C4OA 4DN0A 1WYCA 2J3TD 2DRWA 4RR7A 4JF6A 3CLOA 1ZG6A 3PD4A 4LPZA 4EU0A 1HVBA 5F6AA 3KSHA 4OPQA 5EVIA 5BOHA 2B18A 3G6OA 5DF9A 1MXOA 3H9WA 3NI9A 3C38A 1PI5A 3PBQA 4YINA 3UMEA 1H3QA 4P0MA 5F82A 4F3LB 3NHQA 3W4QA 3UB6A 2Y2LA 2PBDP 4KZAA 2EXBA 2OWHA 4FSFA 3SOIA 4X68A 4IVIA 5AQAA 5F1FA 2WGWB 1Z6FA 2WUQA 4DF6A 4Y13A 4EQIA 5AQ9A 5FQIA 5LBRA 1T18A 2G7UA 3LY3A 4QPRA 2WKRA 3T4SA 2VV7A 2B95A 3DAVA 4OVDA 2OLVA 4F94A 1JVJA 3O3VA 3LGOA 1ERMA 2L0WA 2DCFA 5DFXA 1G6OA 1IOUA 4KQDA 3KOBA 1K55A 3GRJA 2W3FA 1ESUA 3BEBA 4E3NA 3NDEA 1EWZA 3ZVTA 2XFSA 4PM7A 4OQGA 4L9GA 3RFBA 4QHCA 2QZ6A 2W3DA 3IH9A 3R7WB 4NBJA 2PRFA 4WMCA 5GLDA 2PU2A 1OJGA 3GDIA 1W5DA 5AVFA 2C6WB 4FD8A 1TDLA 4GD6A 3UE6A 2VX8A 5AVEA 1MC0A 3N4IA 3NULA 4NBIA 1XXMA 5EFWA 1Y4OA 3IXHA 5AQBA 5CHJA 2PYPA 4RX2A 2ZQDA 4R1GA 2LB9A 3T1RA 5TR7A 5EVIC 3V3SA 1L3LA 2HDUA 1E25A 4S03A 5EOOA 1LI9A 4JXVA 4LENA 5FDHA 3C2WA 3SW1A 4BBTA 1L0FA 1WE4A 5HSQA 4E6XA 2OAP1 1LI0A 2OLUA 5HARA 1P9RA 3IF6C 1GCEA 1VQQA 4MNRA 2V0UA 2JKTI 1FR6A 1T1CA 4Z9QA 2HP6A 5A92A 5I5LA 1FQGA 4KQRA 4EERA 4OOMA 1KVLA 3A3FA 4MBKA 2ZM2A 3W4OA 4PM9A 3ITBA 4MMNA 2GDNA 1OJ5A 2PYRA 5DTKA 4EV4A 2O99A 4ZDXA 4ESPA 1Q2PA 2Y8HA 2X02A 1NWZA 3TE8A 4R6LA 1FILA 3LI9A 4X56A 4N92A 2CC1A 3UE0A 5HPIA 1IELA 5L8MA 4GS9A 4I39A 2R78A 2X01A 1ERQA 5J3WA 2KLIA 3NOUC 4FCFA 3MR0A 1YQSA 3EGDC 3S7PA 2P9VB 3FKWA 1PZOA 1NLYA 4WM9A 1Y54A 1ZKJA 4ZJ3A 4JGRA 3CITA 4HJ4A 5CERA 3ZG5A 5DKKA 1Y2QA 4FOFA 4I3IA 3KO3A 4HH2A 1BLPA 1E4DA 3IX3A 2ZC4B 5CGSA 3QNBA 5I94A 3H7WA 3N8SA 1GA0A 3T1XA 3JVUA 4PM5A 1TVFA 2V1BA 3EEHA 5HW3A 4WLAA 2J7VA 5EVLA 1PWDA 1SDEA 4HJ6A 4B9OA 1YLWA 4GS9B 5FAQA 3AGEA 2Y91A 1G28A 2ZLYA 3UPOA 2ZQ8A 1LL5A 2XA7M 1TF1A 3C4PA 5HX9A 4B88A 1H8YA 4OONA 4K08A 3PD5A 1EW0A 3NIAA 4UAAA 4OP5A 1YLTA 4EEPA 3HLBA 3E98A 3BFEA 4QD4A 2ZOIA 3IXDA 3QP4A 2VGJA 3KSIA 3PAEA 3H7WB 4JXGA 4GNUA 1DJBA 3RJUA 1VM1A 5HD5A 4OPZA 2J8YA 3VP2A 3LR3A 3HL9A 3VMAA 5CECA 1ES3A 3KX0X 4BL3A 4Z1WA 1NRFA 1BT5A 2XA7S 5CTNA 2R9WA 2A3UA 5IU1A 4RRMA 2V1ZA 4FH4A 3BRMA 4O8GA 5J4EA 3B47A 4HEFA 2WKIA 4E3MA 1K25A 3TJZC 3VSLA 3DTMA 4C3QA 2Z2MB 2W1TA 4R3JA 1S4RA 3KNPA 2AVXA 4QJGA 4ETZA 3T1QB 3RXWA 4WN5A 1G6AA 5DTSA 3EGXC 1I2SA 4HESA 4R23A 3BECA 4OQ0A 4U3TA 3G32A 5G4ZA 2BG1A 4S2MA 5FI6A 5IT5A 2JCHA 5M19A 2PU4A 3MJQA 3A0RA 1W63M 1CEGA 2WAFA 4ARZA 5EOEA 5GLBA 3CHWP 4QY5A 3VSKA 1TC5A 3UDXA 3CG5A 4Y15A 3N7WA 5EM0A 3KOCA 3O86A 4DE1A 1MWUA 4UEYA 1K6RA 1MKMA 5HDCA 4HNBA 1J9MA 1ONGA 2L4RA 2O0YA 2B02A 4R4RA 3KYZA 2W1TB 4BWIA 3FZCA 3IF5A 4JGQA 3VP3A 4CJNA 3VFFA 4BD1A 5L10A 3LR0A 3DTKA 3UPNA 1KE3A 3ZG9B 3S7QA 3D3OA 4MLLA 3BM6A 3G2ZA 4I38A 1MWSA 2V8CA 1JWZA 3HUMA 4HJ3A 4ARZB 2V0WA 2KX6A 2QMIA 4KUKA 5G18A 2FZ0A 1FCNA 3T50A 3IX8A 4K0WA 2J80A 1IYQA 5CHMA 4WZ4A 3A3EA 1DJAA 4DJ2A 3V50A 4HP4A 2HL0A 3LO7A 4WL9A 3W4PA 3T4QA 3CMZA 4X1MA 4RRFA 2V1AA 1P0ZA 1W8YA 4O0PA 3QP5A 1NJ4A 2I72A 1TS6A 2DNSA 4EW7A 2EX2A 2ZC5B 2ZBBA 4HBTA 1GA9A 3SH8A 3M2JA 4IUHA 3WS4A 1UWPX 3PXPA 1ES4A 4LCMA 3Q81A 4OQHA 1FSYA 3WS1A 4LV1A 3FPVA 2Y4AA 3E4OA 1ACFA 4RVAA 4QU3A 1HZOA 1AWIA 1XA1A 5FI2A 4X6TA 1K38A 2MJ6A 4KZ7A 1YMSA 3IH8A 4R4SA 4KG6A 3MBZA 4NKPA 2O9CA 5CX7A 3ZNYA 3ZG8B 1DY6A 3C30A 1C3BA 4BBUA 1M6KA 2GNXA 4O7DA 4NXGA 5F1GA 3PBRA 2M7UA 4BMWA 2WGWA 5FQKA 4CPKA 2OV5A 3K2NA 3VFHA 3HCYA 3OLOA 2VKSA 5HAPA 1ESIA 3KODA 1DRMA 1QMEA 3QP6A 3F1NA 2E8IA 3OC2A 1ZC2A 2XQZA 2EWVA 2XLNA 3SS5A 5F5YA 2XD1A 1HTZA 4EBNA 1CQAA 5DJTA 1FR1A 5E2HA 1K57A 4X69A 5EUAA 4RRKA 2I9VA 5FAOA 4S02A 3LIBA 4D60A 4GZBA 3N8LA 5FASA 2W3HA 4JXSA 5IS1A 1ZG4A 1YM1A 1SZVA 4GW9A 4D2OA 3OCLA 3VOLA 1L0EA 4R3BA 2ACGA 5KSHA 2IWCA 1YLJA 4I3JA 4KENB 3R7WA 3F1NB 2HDSA 4E3OA 4EBLA 3A0SA 3M6HA 2ZL1A 1LHYA 4OOLA 3PD3A 2QJ5A 1L2SA 1J7GA 3E2KA 4HOIA 2ZMFA 1BLSA 2JN7A 4XXRA 5FAPA 3MMHA 3LUQA 3DWKA 4S2NC 1YMXA 5EVID 4R0QA 3N6IA 5CRFA 4JF5A 4WUJA 4DJ3A 1W7FA 2EFUA 3V39A 1MBLA 3IWOA 1LSVA 1IYOA 2H10A 1T1BA 2JKTM 2P7JA 3U2AA 3KO7A 4L9EA 4S2PA 4BLMA 1XJ4A 3DTIA 3OZHA 1EI5A 2KOIA 1MZUA 2M7VA 3KSGA 3IS2A 4S2KA 1N9BA 3TRCA 1IYSA 3LEZA 1KVMA 4NK3A 2ZL1B 1W79A 2LB5A 2H5SA 2K2NA 3F1OA 3CI6A 4HBUA 3BFFA 4L9FA 4S2OA 3WS2A 4YOFA 3MZDA 2JKRI 1SCWA 3ZGAB 4LV0A 4R38A 3NBLA 2Q9NA 1PFLA 3GSGA 3UB7A 2WKEA 2O9AA 4I5SA 4S0KA 3MS6A 3NJAA 1CK3A 2XD5A 3HUOA 3A3JA 1PIOA 3RH8B 3BQ8A 2DBOA 4X25A 3A0VA 5U47A 2Y2NA 5HDDA 4E3KA 4DXBA 3WWXA 4OPRA 4QB8A 2HJ9C 2EFXA 4WEKA 4Y3IA 2BLSA 1JKEA 4RRQA 4XUXA 3UDIA 4PM6A 2ZMVA 4LRZE 4BENA 3DWZA 2XFTA 4GJ4A 1NYYA 3IS2B 2P9VA 2QPNA 1DJCA 3IWIA 5C5KA 2PBYA 3KO9A 1IKIA 4WMCD 5F83A 2PR6A 3SS3A 3F1OB 5M18A 4MN5A 3UB5P 4EESA 1OTBA 4PKYG 4G3KA 3IX4A 1D7EA 2ZOHA 1JTDA 1OT6A 5FL3A 1M40A 4S2LA 2HDRA 3CZDA 1FSWA 4GHIA 2W0NA 1GSXA 3HLFA 1K55C 4UQIS 2ZQ7A 2PHYA 4H8RA 2Y2MA 3HLEA 1V9YA 1YLYA 3C7VA 2JHEA 1GHPA 1S6RA 3O5YA 3UPPA 1K56A 2ZMAA 1KDWA 1F5MA 4CLCA 4JBFA 2H0YA 1WA9A 3EQUA 3G2YA 3V67A 3L9KA 1AXBA 1BULA 1NXYA 2OSUA 4BBVA 1LSWA 1YLZA 3T4TA 3NOTC 4PHTA 2BASA 2QHKA 2GX5A 3HLDA 3S7OA 4QY6A 1F9IA 3M2KA 3WS0A 5FQ9A 4GHIB 1S66L 3M6BA 4NXBA 3EQVA 5AJGA 1OTIA 2RCXA 3ICYA 4S0LA 4RRCA 3GECA 3LFVA 3K3CA 1TD5A 3F1PA 3V5MA 5DTTA 4E3JA 1H8ZA 4L0LA 2HKZA 4CLCB 5FQMA 3S7NA 4WELA 1XJ3A 4KQOA 4LCLA 1QMFA 4WZ5A 3SH9A 4O01A 4ETXA 3PBTA 3ZHHA 1DP8A 1NZUA 5E43A 3DBAA 5TJJA 2OWJA 3Q82A 2G2WA 3MSHA 4ME4A 4A5RA 2WKPA 2NUTC 3KO4A 4U0TA 3FYZA 4OLGA 3T1SA 1RCJA 5GHZA 4EQ1A 1NRJA 4GKUA 4EBPA 3CPTA 4X1LA 3NECA 2CMNA 2VV8A 5CTMA 1K6SA 3BW6A 3BFCA 1IKGA 3T4JA 4KZ5A 3FC7A 3F1PB 1H5XA 2EA9A 3ISGA 1XFQA 5EECA 2XR0A 5KZHA 2HZ5A 3VOZA 1FOFA 3Q7VA 1TS7A 4OLDA 1GSVA 4Y0TA 3FG8A 3OBFA 2XROA 3OCNA 4M3KA 1W8QA 4MBFA 1VB6A 3LIEA 4NETA 3GR2A 1G5UA 3T4LA 2C5WB 4EXOA 4RRIA 1L0DA 4Q0HA 3ZDJA 1Q2QA 1ES5A 4PMAA 4HIAA 3NY4A 4YWZA 4X55A 1TS0A 3CPTB 1S1YA 4HI4A 3MZEA 5CGXA 5MC7A 3ZNTA 1W63Q 1EROA 3MQQA 1N9NA 3BY9A 2NUPC 4RRJA 2EX6A 4N9KA 4NXFA 4RR6A 2GJ3A 1BSGA 2J9OA 2H28A 5A8BA 1YLPA 4I3AA 2Y2JA 5GLCA 4B4ZA 2VV6A 1E3UA 1YSPA 3BLMA 4DRTA 3MXSA 4S0IA 1DP6A 3W2ZA 3Q7VB 4Q0JA 4C75A 2A49A 4B93A 4JGOA 5HD3A 3ULFA 5HWWA 3KO5A 1GHIA 2WKHA 1S4SA 5F69A 5K5BA 3JPUA 3VP0A 4MBHA 3LMTA 4GLQA 4EUZA 3UB9A 4IBXA 3HJIA 1SHVA 3E2LA 1MY8A 5GHYA 2UV0E 3UO9A 2G2UA 3QNCA 2XRNA 2IWBA 3VP1A 4BL2A 3B3XA 3MQ0A 3WRTA 5DVAA 1JWVA 2A2LA 3HBRA 4DDSA 1PWCA 4Y7PA 4DE0A 1G68A 2EXAA 4S2JA 3BJNA 1BZAA 2VGKA 2PDRA 2KDKA 3IQAA 1KE4A 3IHBA 1IYPA 3P09A 4FTXA 4RRDA 4WEJA 4Y5FA 1STZA 2BTFP 3LR5A 4R70A 4OOYA 4E3IA 3IXGA 1WYBA 3EWKA 3FKVA 1TS8A 4ZAMA 1RGZA 1X0OA 4Y0OA 2PD7A 4N1XA 1YT4A 2PD8A 5FI7A 1NLZA 4UHUA 4Y0UA 2JE5A 3ZVWA 3G35A 2HL1A 2YKFA 1LSXA 4IVKA 4BD0A 4GB7A 3EOIA 1PRQA 1BUEA 1YAXA 2XSSA 4HQAA 3FV7A 1PYYA 2K7SA 1XJ6A 3Q07A 3CUEA 3MXQA 2IWDA 2UWXA 1P97A 2WK0A 3L7HA 4JPMA 3O87A 3VOYA 2J9PA 5J8XA 1FIKA 3S4XA 1PZPA 1SKOB 2GZAA 3TW8A 3IWQA 2RL3A 3SH7A 4RX3A 2D01A 5FQQA 4K91A 4E3LA 1U60A 3PBSA 1F2KA 1XJ2A 1O7EA 4HY8A 1N4OA 3G30A 1YKDA 1H0MA 5FEFA 2Z2LB 4IBRA 2QKPA 3RTYA 4XT2A 1K54A 3T4KA 4K0XA 1N9OA 3BYDA 4UA9A 4H6JA 3D9YA 2OOLA 1TDGA 4P6BA 4QWOA 3MFDA 1LL9A 3TG9A 5EE8A 3PTEA 4DDYA 4HHDA 5TGFA 2W1RA 5D3OA 1BYWA 4N1HA 2Q0OA 3HLWA 2HP9A 2XDMA 1I5QA 4GDBA 4UA7A 4R3AA 4LFUA 1ODVA 3HVFA 4YNRA 5HWTA 3LIDA 2E8JA 3LI8A 1MWRA 1CEFA 2JC7A 1GSWA 4G3VA 3OPPA 1CI9A 2VZWA 2VJWA 2WAEA 2ZQAA 5HFOA 3LICA 4C6YA 4ZTKA 2JKRM 5FEGA 5EVEA 2H0TA 3G31A 3KYEA 4XT2B 5HL1A 1HD8A 1D1JA 2QWSA 3UN7A 4KQQA 3MXRA 5AQ7A 4ZJ1A 4H6JB 3IF6A 2VLGA 2ZD8A 3OPRA 1KGEA 1XPBA 4X53A 1SKFA 4LGWA 3ZQ5A 3OPHA 1CI8A 3TOIA 1BTLA 2PT7A 4JXWA 4RA7A 4KZBA 5FQJA 4RRLA 5FSRA 3CUEC 5CXWA 2J3TC 2FFYA 3T4OA 3ZCZA 5J7EA 5EVIB 5M1AA 4NEED 4S0JA 4RR9A 3NC8A 4UA6A 1PW1A 2P04A 4AFIA 5DF8A 4KUOA 3WS5A 3O88A 4RYEA 1XKZA 4RR8A 1N9LA 2WGVA 3A3IA 3IF6B 3OPLA 1SDNA 3VE3A 4GOGA 3P98A 5TBMA 1K54C 2Y79A 3UE3A 4ID4A 2VK3A 3JYIA 3GQZA 3BY8A 4LLOB 5HPFA 1K57C 1NYMA 2HV1A 5EPHA 4RQ9A 1OTAA 4RRRA 1S1ZA 4WBGA 1NZOA 3MF0A 3GV9A 2PR5A 2W27A 4S2IA 2D02A 4UQIM 2XH9A 1LL8A 1KGGA 1MWTA 5GL9A 5HDSA 3HREA 4KG2A 1PW8A 1JWPA 2Y2GA 5TBMB 3PD2A 2X71A 4P6ZM 3CJMA 3MKEA 3LCEA 4HP9A 4P87A 3V3RA 1YSQA 3PBNA 4KZ3A 5L2FA 1MKIA 2VGLM 3B42A 3DTEA 5A90A 1ZTUA 4XUZA 2V20A 3GMWA 4BQMA 4E6WA 5JYOA 2O9BA 5CHUA 5G4YA 2M1CA 1T19A 3G4PA 3LIFA 4P6ZS 1NY0A 2ZC7A 1YPRA 3BQAA 1VEUA 3I7JA 4MN6A 1KOUA 4FH2A 1CF0A 4GD8A 3G34A 2XGNA 4LRYC 5E2GA 1A0KA 2VGLS 4II7A 4DMZA 2Q9MA 4RRBA 1D06A 3PYPA 2P74A 3BWLA 2QYBA 4RRHA 3AGDA 4IHQA 3CWFA 3S1YA 3HJKA 3TSGA 1OPXA 3S22A 3E0YA 4P85A 5KMWA 2Y2HA 1ALQA 5IHVA 1UGUA 1OMEA 2FFFB 3FPWA 5J61A 1KDSA 3KNFA 3SS4A 3MKFA 5GLAA 2HPBA 2JBFA 4ZJ2A 2ZJ9A 5FA7A 5E2FA 3LMUA 3LR4A 2OAQ1 4KZ8A 4GDNA 1Y28A 2ZC3B 5FDSA 4DXCA 1K56D 1VEUB 4CLCD 4OH0A 5A91A 3D72A 4Q8IA 3RXXA 3PHYA 3K3DA 4BJPA 4YFMA 2Y2KA 1IFQA 2HJEA 2HL2A 4CLCE 2Y59A 2PAVP 4GCZA 3WRZA 1I2WA 3T12B 2QJ7A 2Z6CA 3SZTA 1ZHHB 3NOPC 5DJUA 1ES2A 5CEBA 4JLFA 2R9XA 4ZRRA 5HAQA 5EM1A 2OKVA 2Y2IA 2HP5A 3C7UA 3QP1A 3EEAA 3B33A 5E2EA 3N8RA 3LMVA 5HAIA 3C5AA 1OTEA 2EX8A 3A3DA 5HL6A 2XK1A 1VHMA 1TEMA 1V9ZA 3ZG7B 1FCMA 4Q0IA 4DE2A 1MPLA 3GVBA 2Y2OA 3MFXA 4CLCC 2ZM8A 4U0XA 4WF0A 4MCWA 1DP9A 1PI4A 1XGJA 1LT0A 5HZHA 4WYYA 3JVVA 3UNWA 3MZFA 2Z6DA 2Y2PA 3MQOA 3CAXA 2A24A 5KSCA 2HDQA 1S67L 4DE3A 1HLUP 1OTDA 1ONHA 3HLGA 4JGPA 4CQHA 5EV0A 3VP4A 2Y2QA 3NCKA 1RGYA 3PAGA 3UY6A 5CGWA 1BLHA 2XF3A 4KG5A 4IJGA 3ITAA 3BFGA 3IBJA 3IBRA 4MN7A 3H82A 3Q1FA 3PBOA 5FATA 5DFYA 1P9WA 2K31A 1JNUA 2W3GA 3UB8A 4PAUA 3LY4A 3E4PA 4Y2FA 4PM8A 3UE1A 4WZ5C 3C8CA 2JKFA 5A93A 5HWVA 4JKTA 4EWFA 1J3WA 4Y17A 2ZM0A 3QP2A 4DKIA 4HH3A 3VV4A 2A24B 4B4XA 1XFNA 2EWWA 4IEDA 4EEUA 1K4FA 3OOVA 4M4XA 1FCOA 3IHAA 3U4LP 2W3EA 2IA2A 4G3WA 1PWGA 1T1AA 2P08A 2ZC6B 3AGFA 3H82B 3D4FA 2INWA 5GHXA 1H8MA 2WADA 3LEQA 1JTGA 2WZXA 3VE4A 4MDZA 4N9LA 5L09A 2WKQA 1E3UD 4OP8A 3ZFZA 1GHMA 2JKGA 4LV3A 2J3WA 3KO6A 1BLCA 2V9AA 2ZQ9A 1SKOA 2WGIA 3KSFA 4MEZA 1KE0A 2B5RA 3ZYTA 2FH5A 3P01A 4OPYA 1CJFA 1S0WA 3UMDA 3PR6A 2EX9A 4NG2A
chains in the Genus database with same CATH topology
4X53A 1SKFA 1FSWA 1LLBA 1XX2A 3OPHA 4GN2A 4HEFA 4OKPA 5DF7A 3GTCA 3HLFA 2WKIA 1CI8A 3TOIA 1K55C 4E3MA 1BTLA 1K25A 4JXWA 2WZZA 4RA7A 4KZBA 1KGFA 5FQJA 3BFDA 1XP4A 4RRLA 2ZQ7A 3VSLA 4H8RA 5FSRA 3DTMA 2Y2MA 3HLEA 5CXWA 4C3QA 3QHYA 1YLYA 2Z2MB 2FFYA 3C7VA 4OQIA 4R3JA 3ZCZA 3KNPA 3UDFA 3ZG0A 5JYPA 1K4EA 4QJGA 1GHPA 1S6RA 3FWLA 3UPPA 1K56A 2ZMAA 5EVIB 5TFQA 3Q7ZA 3RXWA 2WYXA 4RRGA 2ZQCA 1KDWA 1G6AA 2V2FF 5DTSA 5M1AA 4JBFA 1IEMA 1L0GA 1I2SA 4HESA 2H0YA 4R23A 3EQUA 4S0JA 3G2YA 4KZ9A 3BECA 2Y55A 4OQ0A 4U3TA 4RR9A 3G32A 4S2NA 2BG1A 1AXBA 3NC8A 1BULA 3HLCA 4S2MA 5FI6A 2JCHA 4UA6A 3HUNA 1NXYA 2OSUA 1PW1A 5M19A 2PU4A 4KZ6A 1CEGA 3IT9A 1O07A 1YLZA 2WAFA 5DF8A 3WS5A 5EOEA 3O88A 4RYEA 5GLBA 3IXBA 4QY5A 3VSKA 1TC5A 3UDXA 1XKZA 3CG5A 4RR8A 2WGVA 3A3IA 3IF6B 3OPLA 1SDNA 1XGIA 3N7WA 3HLDA 4QY6A 3BLSA 3P98A 4GOGA 3W8KA 3DW0A 3M2KA 3WS0A 3KOCA 1K54C 3O86A 4DE1A 5FQ9A 1XA7A 4JF4A 4LV2A 1MWUA 1K6RA 3UE3A 3M6BA 4ID4A 3JYIA 3EQVA 4RRAA 2XEPA 3GQZA 1J9MA 1ONGA 4KZ4A 1RP5A 2RCXA 5CEDA 4R4RA 4S0LA 4RRCA 4ZBEA 1K57C 1NYMA 5EPHA 3NDGA 3V5MA 4RRRA 5DTTA 3FZCA 4E3JA 4PPRA 1H8ZA 3IF5A 3C4OA 4L0LA 2HKZA 4WBGA 1NZOA 1WYCA 3VP3A 4CJNA 3VFFA 4BD1A 5FQMA 4WELA 3GV9A 2DRWA 4KQOA 4LCLA 4RR7A 4JF6A 1QMFA 1KE3A 4WZ5A 3UPNA 3SH9A 3ZG9B 1ZG6A 3PBTA 3ZHHA 4MLLA 3PD4A 3BM6A 3G2ZA 1NZUA 4S2IA 5E43A 1HVBA 1MWSA 1JWZA 5EVIA 4OPQA 5BOHA 3HUMA 5DF9A 1MXOA 3Q82A 2G2WA 2XH9A 3NI9A 1PI5A 3PBQA 4YINA 4A5RA 1KGGA 2QMIA 3KO4A 1MWTA 4U0TA 3FYZA 5G18A 5GL9A 3HREA 4KG2A 4P0MA 4OLGA 1FCNA 1PW8A 5F82A 1JWPA 1RCJA 2Y2GA 5GHZA 3W4QA 2Y2LA 3PD2A 4KZAA 2X71A 4K0WA 1IYQA 2EXBA 3CJMA 4FSFA 4GKUA 4EBPA 3SOIA 5CHMA 4X68A 4IVIA 4WZ4A 5AQAA 3MKEA 3LCEA 5F1FA 3A3EA 1DJAA 5CTMA 4P87A 1K6SA 3V3RA 3BFCA 1IKGA 3V50A 2HL0A 3PBNA 4KZ3A 2WGWB 3LO7A 4KZ5A 5L2FA 3W4PA 1MKIA 1Z6FA 2WUQA 4DF6A 3CMZA 5AQ9A 5FQIA 4EQIA 1H5XA 3ISGA 5EECA 3LY3A 2XR0A 4RRFA 5A90A 1W8YA 1NJ4A 2I72A 5KZHA 2DNSA 3VOZA 2EX2A 4OVDA 1FOFA 2OLVA 1JVJA 4F94A 2ZC5B 3O3VA 3Q7VA 4HBTA 4OLDA 1GA9A 3SH8A 3M2JA 4Y0TA 3WS4A 1ERMA 3OCNA 4XUZA 2V20A 2DCFA 3GMWA 4BQMA 4M3KA 4E6WA 1W8QA 5JYOA 4MBFA 1ES4A 5CHUA 3KOBA 4LCMA 3Q81A 3G4PA 4NETA 4OQHA 1FSYA 3GR2A 2C5WB 4RRIA 3WS1A 1L0DA 1NY0A 3ZDJA 4LV1A 2ZC7A 1Q2QA 2Y4AA 3I7JA 1ES5A 4RVAA 4PMAA 1K55A 4QU3A 1HZOA 3NY4A 4FH2A 1XA1A 3GRJA 4GD8A 5FI2A 4X6TA 1K38A 3G34A 4KZ7A 4X55A 1ESUA 3BEBA 2XGNA 1YMSA 4E3NA 3NDEA 5E2GA 1EWZA 3IH8A 2Q9MA 4R4SA 4KG6A 3MBZA 3ZVTA 2XFSA 4RRBA 4PM7A 3MZEA 5CGXA 2P74A 4OQGA 3ZNYA 3ZNTA 3ZG8B 1DY6A 1EROA 4QHCA 4RRHA 2QZ6A 3AGDA 3IH9A 4RRJA 1C3BA 2EX6A 4N9KA 3S1YA 4RR6A 3TSGA 3S22A 1BSGA 1M6KA 2J9OA 4P85A 4O7DA 5KMWA 4NBJA 5F1GA 1YLPA 2Y2JA 5GLCA 3PBRA 4WMCA 5GLDA 4B4ZA 2PU2A 2Y2HA 1E3UA 1ALQA 3BLMA 5IHVA 4DRTA 3MXSA 4S0IA 1OMEA 2FFFB 2WGWA 5FQKA 3Q7VB 4CPKA 2OV5A 1W5DA 5J61A 3VFHA 2C6WB 4FD8A 1KDSA 4C75A 2A49A 3KNFA 3SS4A 3MKFA 1TDLA 4GD6A 5HAPA 5GLAA 2HPBA 1ESIA 2JBFA 2ZJ9A 5FA7A 5E2FA 4ZJ2A 1QMEA 3N4IA 3KODA 3LMUA 4NBIA 3KO5A 4KZ8A 1GHIA 2WKHA 1XXMA 4GDNA 3IXHA 2ZC3B 5AQBA 2E8IA 5CHJA 3VP0A 1K56D 4DXCA 4MBHA 3OC2A 1ZC2A 2XQZA 2ZQDA 4R1GA 4RX2A 3LMTA 4EUZA 5TR7A 5EVIC 2XLNA 3V3SA 4OH0A 2HDUA 5A91A 1E25A 4IBXA 4S03A 5EOOA 1SHVA 3SS5A 3E2LA 1LI9A 1MY8A 2XD1A 4JXVA 4Q8IA 1HTZA 4LENA 3RXXA 5FDHA 5GHYA 4BJPA 4YFMA 4EBNA 3UO9A 2Y2KA 2G2UA 1FR1A 3QNCA 5E2HA 3VP1A 2IWBA 1K57A 4X69A 5EUAA 1L0FA 4RRKA 2HL2A 4BL2A 2Y59A 3B3XA 3WRZA 3WRTA 1WE4A 5DVAA 5FAOA 1JWVA 4S02A 4E6XA 3HBRA 4GZBA 1I2WA 4DDSA 1LI0A 1PWCA 2OLUA 5HARA 4Y7PA 3N8LA 4DE0A 1ES2A 1G68A 3IF6C 5FASA 5CEBA 1GCEA 1VQQA 4MNRA 2EXAA 4JLFA 4S2JA 2R9XA 4JXSA 1FR6A 4Z9QA 2HP6A 5HAQA 5A92A 1ZG4A 1BZAA 1FQGA 4KQRA 1YM1A 2VGKA 2OKVA 4OOMA 4D2OA 3OCLA 2Y2IA 1KVLA 2HP5A 1KE4A 1L0EA 3A3FA 3C7UA 3IHBA 3IQAA 4MBKA 1IYPA 2ZM2A 4R3BA 5E2EA 3W4OA 4PM9A 3ITBA 2IWCA 3P09A 5KSHA 1YLJA 3N8RA 3LMVA 4RRDA 4WEJA 2GDNA 4KENB 5HAIA 3C5AA 5DTKA 4EV4A 2HDSA 4E3OA 4OOYA 4E3IA 2EX8A 3IXGA 3A3DA 1WYBA 1Q2PA 4EBLA 4ZDXA 2X02A 3FKVA 2XK1A 3M6HA 1LHYA 1TEMA 4OOLA 3ZG7B 3PD3A 1FCMA 4ZAMA 1L2SA 4DE2A 1MPLA 1RGZA 3GVBA 4Y0OA 1J7GA 2Y2OA 3E2KA 4N1XA 1YT4A 4X56A 5FI7A 2ZM8A 4UHUA 1BLSA 4XXRA 4U0XA 5FAPA 4Y0UA 4N92A 2JE5A 3DWKA 3G35A 3ZVWA 2CC1A 3UE0A 2HL1A 4S2NC 1IELA 1PI4A 1YMXA 1XGJA 4IVKA 4BD0A 5EVID 4GB7A 4R0QA 3N6IA 5CRFA 4JF5A 1BUEA 4WYYA 3UNWA 1W7FA 2X01A 1ERQA 2EFUA 3FV7A 3V39A 3MZFA 1MBLA 4FCFA 1PYYA 3IWOA 2Y2PA 1YQSA 1IYOA 3Q07A 2H10A 5KSCA 2HDQA 2P9VB 2IWDA 2UWXA 3FKWA 1PZOA 4DE3A 2WK0A 4WM9A 1ONHA 3HLGA 1Y54A 4JPMA 3O87A 1ZKJA 3VP4A 4S2PA 2Y2QA 3KO7A 4ZJ3A 3NCKA 3VOYA 4BLMA 1RGYA 3PAGA 3UY6A 5CGWA 1BLHA 3OZHA 2XF3A 1EI5A 2J9PA 5J8XA 4KG5A 5CERA 3ITAA 3ZG5A 3BFGA 1Y2QA 3KO3A 3Q1FA 4S2KA 3S4XA 1BLPA 1N9BA 1PZPA 1E4DA 3PBOA 2ZC4B 1IYSA 3LEZA 5FATA 3IWQA 5CGSA 2RL3A 3QNBA 3SH7A 1KVMA 5I94A 4NK3A 4RX3A 1W79A 5FQQA 3N8SA 1GA0A 2H5SA 4K91A 4E3LA 1U60A 3PBSA 3LY4A 4HBUA 4PM5A 3BFFA 4S2OA 1TVFA 3WS2A 4PM8A 3UE1A 1O7EA 5HW3A 1N4OA 4WZ5C 2J7VA 3G30A 3MZDA 5EVLA 1SCWA 3ZGAB 1PWDA 4LV0A 5A93A 1SDEA 2Z2LB 4IBRA 3NBLA 2Q9NA 1K54A 3GSGA 2WKEA 4K0XA 1YLWA 3BYDA 4JKTA 4UA9A 4EWFA 4S0KA 1CK3A 2XD5A 5FAQA 3HUOA 3A3JA 1PIOA 2ZM0A 3AGEA 1TDGA 4P6BA 4DKIA 2DBOA 3MFDA 5U47A 1LL9A 2Y2NA 2Y91A 4E3KA 4DXBA 3TG9A 4B4XA 2ZLYA 5EE8A 3UPOA 3PTEA 3WWXA 2ZQ8A 4DDYA 4IEDA 1LL5A 4OPRA 5TGFA 4QB8A 1K4FA 3C4PA 5HX9A 1FCOA 2EFXA 3IHAA 4WEKA 5D3OA 4B88A 1H8YA 2BLSA 1JKEA 4OONA 4RRQA 1PWGA 4XUXA 3UDIA 4N1HA 4PM6A 3PD5A 2ZC6B 3HLWA 4BENA 2HP9A 3NIAA 2XDMA 4OP5A 4UAAA 1YLTA 3DWZA 1I5QA 2XFTA 3AGFA 1NYYA 2P9VA 2QPNA 3D4FA 4GDBA 4UA7A 3HLBA 1DJCA 5GHXA 2WADA 3BFEA 3IWIA 1JTGA 2WZXA 4QD4A 4N9LA 3HVFA 3IXDA 2VGJA 3PAEA 2PBYA 3KO9A 1IKIA 4JXGA 4GNUA 4WMCD 1DJBA 5F83A 3RJUA 1VM1A 1E3UD 4OP8A 4OPZA 1GHMA 3ZFZA 3SS3A 5M18A 1MWRA 1CEFA 2JC7A 2WAEA 1CI9A 3OPPA 4LV3A 2ZQAA 2J8YA 5HFOA 3VP2A 1BLCA 2ZQ9A 3HL9A 2WGIA 4MEZA 4C6YA 4ZTKA 3VMAA 1KE0A 2B5RA 2H0TA 5CECA 3G31A 1ES3A 4BL3A 1HD8A 5HL1A 1NRFA 1BT5A 4OPYA 3UN7A 5CTNA 4KQQA 3MXRA 5AQ7A 4ZJ1A 1JTDA 3IF6A 2R9WA 2ZD8A 1S0WA 2A3UA 3OPRA 4RRMA 2V1ZA 1KGEA 4FH4A 1M40A 2EX9A 3BRMA 4S2LA 2HDRA 1XPBA 3CZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X53 A;  1SKF A;  1FSW A;  1LLB A;  1XX2 A;  3OPH A;  4GN2 A;  4HEF A;  4OKP A;  5DF7 A;  3GTC A;  3HLF A;  2WKI A;  1CI8 A;  3TOI A;  1K55 C;  4E3M A;  1BTL A;  1K25 A;  4JXW A;  2WZZ A;  4RA7 A;  4KZB A;  1KGF A;  5FQJ A;  3BFD A;  1XP4 A;  2ZQ7 A;  3VSL A;  4H8R A;  5FSR A;  3DTM A;  2Y2M A;  3HLE A;  5CXW A;  4C3Q A;  3QHY A;  1YLY A;  2Z2M B;  2FFY A;  3C7V A;  4OQI A;  4R3J A;  3ZCZ A;  3UDF A;  3ZG0 A;  5JYP A;  1K4E A;  4QJG A;  1GHP A;  1S6R A;  3FWL A;  3UPP A;  1K56 A;  2ZMA A;  5EVI B;  5TFQ A;  3Q7Z A;  3RXW A;  2WYX A;  2ZQC A;  1KDW A;  1G6A A;  2V2F F;  5DTS A;  5M1A A;  4JBF A;  1IEM A;  1L0G A;  1I2S A;  4HES A;  2H0Y A;  4R23 A;  3EQU A;  3G2Y A;  4KZ9 A;  3BEC A;  2Y55 A;  4OQ0 A;  4U3T A;  3G32 A;  4S2N A;  2BG1 A;  1AXB A;  3NC8 A;  1BUL A;  3HLC A;  4S2M A;  5FI6 A;  2JCH A;  4UA6 A;  3HUN A;  1NXY A;  2OSU A;  1PW1 A;  5M19 A;  2PU4 A;  4KZ6 A;  1CEG A;  3IT9 A;  1O07 A;  1YLZ A;  2WAF A;  5DF8 A;  3WS5 A;  5EOE A;  3O88 A;  4RYE A;  5GLB A;  3IXB A;  4QY5 A;  3VSK A;  3UDX A;  1XKZ A;  3CG5 A;  2WGV A;  3A3I A;  3IF6 B;  3OPL A;  1SDN A;  1XGI A;  3N7W A;  3HLD A;  4QY6 A;  3BLS A;  3P98 A;  4GOG A;  3W8K A;  3DW0 A;  3M2K A;  3WS0 A;  1K54 C;  3O86 A;  4DE1 A;  5FQ9 A;  1XA7 A;  4JF4 A;  4LV2 A;  1MWU A;  1K6R A;  3UE3 A;  3M6B A;  4ID4 A;  3JYI A;  3EQV A;  2XEP A;  3GQZ A;  1J9M A;  1ONG A;  4KZ4 A;  1RP5 A;  2RCX A;  5CED A;  4R4R A;  4ZBE A;  1K57 C;  1NYM A;  5EPH A;  3NDG A;  3V5M A;  5DTT A;  3FZC A;  4E3J A;  4PPR A;  1H8Z A;  3IF5 A;  3C4O A;  4L0L A;  4WBG A;  1NZO A;  1WYC A;  3VP3 A;  4CJN A;  3VFF A;  4BD1 A;  5FQM A;  4WEL A;  3GV9 A;  2DRW A;  4KQO A;  4LCL A;  4JF6 A;  1QMF A;  1KE3 A;  4WZ5 A;  3UPN A;  3SH9 A;  3ZG9 B;  1ZG6 A;  3PBT A;  3ZHH A;  4MLL A;  3BM6 A;  3G2Z A;  1NZU A;  4S2I A;  5E43 A;  1HVB A;  1MWS A;  1JWZ A;  5EVI A;  4OPQ A;  5BOH A;  3HUM A;  5DF9 A;  1MXO A;  3Q82 A;  2G2W A;  2XH9 A;  3NI9 A;  1PI5 A;  3PBQ A;  4YIN A;  4A5R A;  1KGG A;  2QMI A;  1MWT A;  4U0T A;  3FYZ A;  5G18 A;  5GL9 A;  3HRE A;  4KG2 A;  4P0M A;  4OLG A;  1FCN A;  1PW8 A;  5F82 A;  1JWP A;  1RCJ A;  2Y2G A;  5GHZ A;  3W4Q A;  2Y2L A;  4KZA A;  2X71 A;  4K0W A;  1IYQ A;  2EXB A;  3CJM A;  4FSF A;  4GKU A;  4EBP A;  3SOI A;  5CHM A;  4X68 A;  4IVI A;  4WZ4 A;  5AQA A;  3MKE A;  3LCE A;  5F1F A;  3A3E A;  1DJA A;  5CTM A;  4P87 A;  1K6S A;  3V3R A;  3BFC A;  1IKG A;  3V50 A;  3PBN A;  4KZ3 A;  2WGW B;  3LO7 A;  4KZ5 A;  5L2F A;  3W4P A;  1MKI A;  1Z6F A;  2WUQ A;  4DF6 A;  3CMZ A;  5AQ9 A;  5FQI A;  4EQI A;  1H5X A;  3ISG A;  5EEC A;  3LY3 A;  2XR0 A;  5A90 A;  1W8Y A;  1NJ4 A;  2I72 A;  5KZH A;  2DNS A;  3VOZ A;  2EX2 A;  4OVD A;  1FOF A;  2OLV A;  1JVJ A;  4F94 A;  2ZC5 B;  3O3V A;  3Q7V A;  4HBT A;  4OLD A;  1GA9 A;  3SH8 A;  3M2J A;  4Y0T A;  3WS4 A;  1ERM A;  3OCN A;  4XUZ A;  2V20 A;  2DCF A;  3GMW A;  4BQM A;  4M3K A;  4E6W A;  1W8Q A;  5JYO A;  4MBF A;  1ES4 A;  5CHU A;  4LCM A;  3Q81 A;  3G4P A;  4NET A;  4OQH A;  1FSY A;  3GR2 A;  2C5W B;  3WS1 A;  1L0D A;  1NY0 A;  3ZDJ A;  4LV1 A;  2ZC7 A;  1Q2Q A;  2Y4A A;  3I7J A;  1ES5 A;  4RVA A;  4PMA A;  1K55 A;  4QU3 A;  1HZO A;  3NY4 A;  4FH2 A;  1XA1 A;  3GRJ A;  4GD8 A;  5FI2 A;  4X6T A;  1K38 A;  3G34 A;  4KZ7 A;  4X55 A;  1ESU A;  3BEB A;  2XGN A;  1YMS A;  4E3N A;  3NDE A;  5E2G A;  1EWZ A;  3IH8 A;  2Q9M A;  4R4S A;  4KG6 A;  3MBZ A;  3ZVT A;  2XFS A;  4PM7 A;  3MZE A;  5CGX A;  2P74 A;  4OQG A;  3ZNY A;  3ZNT A;  3ZG8 B;  1DY6 A;  1ERO A;  4QHC A;  2QZ6 A;  3AGD A;  3IH9 A;  1C3B A;  2EX6 A;  4N9K A;  3S1Y A;  3TSG A;  3S22 A;  1BSG A;  1M6K A;  2J9O A;  4P85 A;  4O7D A;  5KMW A;  5F1G A;  1YLP A;  2Y2J A;  5GLC A;  3PBR A;  4WMC A;  5GLD A;  4B4Z A;  2PU2 A;  2Y2H A;  1E3U A;  1ALQ A;  3BLM A;  5IHV A;  4DRT A;  3MXS A;  1OME A;  2FFF B;  2WGW A;  5FQK A;  3Q7V B;  4CPK A;  2OV5 A;  1W5D A;  3VFH A;  2C6W B;  4FD8 A;  1KDS A;  4C75 A;  2A49 A;  3SS4 A;  3MKF A;  1TDL A;  4GD6 A;  5HAP A;  5GLA A;  2HPB A;  1ESI A;  2JBF A;  2ZJ9 A;  5FA7 A;  5E2F A;  4ZJ2 A;  1QME A;  3N4I A;  4KZ8 A;  1GHI A;  2WKH A;  1XXM A;  4GDN A;  3IXH A;  2ZC3 B;  5AQB A;  2E8I A;  5CHJ A;  3VP0 A;  1K56 D;  4DXC A;  4MBH A;  3OC2 A;  1ZC2 A;  2XQZ A;  2ZQD A;  4R1G A;  4RX2 A;  4EUZ A;  5TR7 A;  5EVI C;  2XLN A;  3V3S A;  4OH0 A;  2HDU A;  5A91 A;  1E25 A;  4IBX A;  5EOO A;  1SHV A;  3SS5 A;  3E2L A;  1LI9 A;  1MY8 A;  2XD1 A;  4JXV A;  4Q8I A;  1HTZ A;  4LEN A;  3RXX A;  5FDH A;  5GHY A;  4BJP A;  4YFM A;  4EBN A;  3UO9 A;  2Y2K A;  2G2U A;  1FR1 A;  3QNC A;  5E2H A;  3VP1 A;  2IWB A;  1K57 A;  4X69 A;  5EUA A;  1L0F A;  4BL2 A;  2Y59 A;  3B3X A;  3WRZ A;  3WRT A;  1WE4 A;  5DVA A;  5FAO A;  1JWV A;  4E6X A;  3HBR A;  4GZB A;  1I2W A;  4DDS A;  1LI0 A;  1PWC A;  2OLU A;  5HAR A;  4Y7P A;  3N8L A;  4DE0 A;  1ES2 A;  1G68 A;  3IF6 C;  5FAS A;  5CEB A;  1GCE A;  1VQQ A;  4MNR A;  2EXA A;  4JLF A;  4S2J A;  2R9X A;  4JXS A;  1FR6 A;  4Z9Q A;  2HP6 A;  5HAQ A;  5A92 A;  1ZG4 A;  1BZA A;  1FQG A;  4KQR A;  1YM1 A;  2VGK A;  4OOM A;  4D2O A;  3OCL A;  2Y2I A;  1KVL A;  2HP5 A;  1KE4 A;  1L0E A;  3A3F A;  3C7U A;  3IHB A;  3IQA A;  4MBK A;  1IYP A;  2ZM2 A;  4R3B A;  5E2E A;  3W4O A;  4PM9 A;  3ITB A;  2IWC A;  3P09 A;  5KSH A;  1YLJ A;  3N8R A;  4WEJ A;  2GDN A;  4KEN B;  5HAI A;  3C5A A;  5DTK A;  4EV4 A;  2HDS A;  4E3O A;  4OOY A;  4E3I A;  2EX8 A;  3IXG A;  3A3D A;  1WYB A;  1Q2P A;  4EBL A;  4ZDX A;  2X02 A;  3FKV A;  2XK1 A;  3M6H A;  1LHY A;  1TEM A;  4OOL A;  3ZG7 B;  1FCM A;  4ZAM A;  1L2S A;  4DE2 A;  1MPL A;  1RGZ A;  3GVB A;  4Y0O A;  2Y2O A;  3E2K A;  4N1X A;  1YT4 A;  4X56 A;  5FI7 A;  2ZM8 A;  4UHU A;  1BLS A;  4XXR A;  4U0X A;  5FAP A;  4Y0U A;  4N92 A;  2JE5 A;  3DWK A;  3G35 A;  3ZVW A;  2CC1 A;  3UE0 A;  4S2N C;  1IEL A;  1PI4 A;  1YMX A;  1XGJ A;  4IVK A;  4BD0 A;  5EVI D;  4GB7 A;  4R0Q A;  3N6I A;  5CRF A;  4JF5 A;  1BUE A;  4WYY A;  3UNW A;  1W7F A;  2X01 A;  1ERQ A;  2EFU A;  3FV7 A;  3V39 A;  3MZF A;  1MBL A;  4FCF A;  1PYY A;  3IWO A;  2Y2P A;  1YQS A;  1IYO A;  3Q07 A;  2H10 A;  5KSC A;  2HDQ A;  2P9V B;  2IWD A;  2UWX A;  3FKW A;  1PZO A;  4DE3 A;  2WK0 A;  4WM9 A;  1ONH A;  3HLG A;  1Y54 A;  4JPM A;  3O87 A;  1ZKJ A;  3VP4 A;  4S2P A;  2Y2Q A;  4ZJ3 A;  3NCK A;  3VOY A;  4BLM A;  1RGY A;  3PAG A;  3UY6 A;  5CGW A;  1BLH A;  3OZH A;  2XF3 A;  1EI5 A;  2J9P A;  5J8X A;  4KG5 A;  5CER A;  3ITA A;  3ZG5 A;  3BFG A;  3Q1F A;  4S2K A;  3S4X A;  1BLP A;  1N9B A;  1PZP A;  1E4D A;  3PBO A;  2ZC4 B;  1IYS A;  3LEZ A;  5FAT A;  3IWQ A;  5CGS A;  2RL3 A;  3QNB A;  3SH7 A;  1KVM A;  5I94 A;  4NK3 A;  4RX3 A;  1W79 A;  5FQQ A;  3N8S A;  1GA0 A;  2H5S A;  4K91 A;  4E3L A;  1U60 A;  3PBS A;  3LY4 A;  4HBU A;  4PM5 A;  3BFF A;  4S2O A;  1TVF A;  3WS2 A;  4PM8 A;  3UE1 A;  1O7E A;  5HW3 A;  1N4O A;  4WZ5 C;  2J7V A;  3G30 A;  3MZD A;  5EVL A;  1SCW A;  3ZGA B;  1PWD A;  4LV0 A;  5A93 A;  1SDE A;  2Z2L B;  4IBR A;  3NBL A;  2Q9N A;  1K54 A;  3GSG A;  2WKE A;  4K0X A;  1YLW A;  3BYD A;  4JKT A;  4UA9 A;  4EWF A;  1CK3 A;  2XD5 A;  5FAQ A;  3HUO A;  3A3J A;  1PIO A;  2ZM0 A;  3AGE A;  1TDG A;  4P6B A;  4DKI A;  3MFD A;  5U47 A;  1LL9 A;  2Y2N A;  2Y91 A;  4E3K A;  4DXB A;  3TG9 A;  4B4X A;  2ZLY A;  5EE8 A;  3UPO A;  3PTE A;  3WWX A;  2ZQ8 A;  4DDY A;  4IED A;  1LL5 A;  4OPR A;  5TGF A;  4QB8 A;  1K4F A;  3C4P A;  5HX9 A;  1FCO A;  2EFX A;  3IHA A;  4WEK A;  5D3O A;  4B88 A;  1H8Y A;  2BLS A;  4OON A;  1PWG A;  4XUX A;  3UDI A;  4N1H A;  4PM6 A;  2ZC6 B;  3HLW A;  4BEN A;  2HP9 A;  3NIA A;  2XDM A;  4OP5 A;  4UAA A;  1YLT A;  3DWZ A;  1I5Q A;  2XFT A;  3AGF A;  1NYY A;  2P9V A;  2QPN A;  3D4F A;  4GDB A;  4UA7 A;  3HLB A;  1DJC A;  5GHX A;  2WAD A;  3BFE A;  3IWI A;  1JTG A;  2WZX A;  4QD4 A;  4N9L A;  3HVF A;  3IXD A;  2VGJ A;  3PAE A;  2PBY A;  1IKI A;  4JXG A;  4GNU A;  4WMC D;  1DJB A;  5F83 A;  3RJU A;  1VM1 A;  1E3U D;  4OP8 A;  4OPZ A;  1GHM A;  3ZFZ A;  3SS3 A;  5M18 A;  1MWR A;  1CEF A;  2JC7 A;  2WAE A;  1CI9 A;  3OPP A;  4LV3 A;  2ZQA A;  2J8Y A;  5HFO A;  3VP2 A;  1BLC A;  2ZQ9 A;  3HL9 A;  2WGI A;  4MEZ A;  4C6Y A;  4ZTK A;  3VMA A;  1KE0 A;  2B5R A;  2H0T A;  5CEC A;  3G31 A;  1ES3 A;  4BL3 A;  1HD8 A;  5HL1 A;  1NRF A;  1BT5 A;  4OPY A;  3UN7 A;  5CTN A;  4KQQ A;  3MXR A;  5AQ7 A;  4ZJ1 A;  1JTD A;  3IF6 A;  2R9W A;  2ZD8 A;  1S0W A;  2A3U A;  3OPR A;  2V1Z A;  1KGE A;  4FH4 A;  1M40 A;  2EX9 A;  3BRM A;  4S2L A;  2HDR A;  1XPB A;  3CZD A; 
#chains in the Genus database with same CATH topology
 1LLB A;  1XX2 A;  4GN2 A;  4OKP A;  1F98 A;  5DF7 A;  3GTC A;  4IUK A;  2DMW A;  1Z09 A;  2WZZ A;  4E04 A;  1KGF A;  4EUV A;  3BFD A;  1XP4 A;  1VET A;  4EET B;  3QHY A;  4OQI A;  3UDF A;  3ZG0 A;  5JYP A;  2VEA A;  1K4E A;  3FWL A;  5TFQ A;  3Q7Z A;  2WYX A;  4RRG A;  5L07 A;  2ZQC A;  2V2F F;  2VA0 A;  4PKY A;  2HGV A;  5DKL A;  1IEM A;  3LIA A;  1L0G A;  4FUW A;  4KZ9 A;  2Y55 A;  3P7N A;  4S2N A;  3HLC A;  3HUN A;  5F68 A;  4KZ6 A;  3IT9 A;  1O07 A;  2L1M A;  2V8F A;  5KIZ A;  3IXB A;  2HF6 A;  1PNE A;  1OT9 A;  1K0K A;  1XGI A;  4F3L A;  3QP8 A;  3BLS A;  3W8K A;  3DW0 A;  3LYX A;  1XA7 A;  4JF4 A;  1UWN X;  4LRX C;  4LV2 A;  3E4Q A;  3KYQ A;  4RRA A;  2XEP A;  1VET B;  4KZ4 A;  1RP5 A;  5CED A;  4NXE A;  4ZBE A;  2YKH A;  3NDG A;  3R4K A;  4PPR A;  3C4O A;  4DN0 A;  1WYC A;  2J3T D;  2DRW A;  4RR7 A;  4JF6 A;  3CLO A;  1ZG6 A;  3PD4 A;  4LPZ A;  4EU0 A;  1HVB A;  5F6A A;  3KSH A;  4OPQ A;  5EVI A;  5BOH A;  2B18 A;  3G6O A;  5DF9 A;  1MXO A;  3H9W A;  3NI9 A;  3C38 A;  1PI5 A;  3PBQ A;  4YIN A;  3UME A;  1H3Q A;  4P0M A;  5F82 A;  4F3L B;  3NHQ A;  3W4Q A;  3UB6 A;  2Y2L A;  2PBD P;  4KZA A;  2EXB A;  2OWH A;  4FSF A;  3SOI A;  4X68 A;  4IVI A;  5AQA A;  5F1F A;  2WGW B;  1Z6F A;  2WUQ A;  4DF6 A;  4Y13 A;  4EQI A;  5AQ9 A;  5FQI A;  5LBR A;  1T18 A;  2G7U A;  3LY3 A;  4QPR A;  2WKR A;  3T4S A;  2VV7 A;  2B95 A;  3DAV A;  4OVD A;  2OLV A;  4F94 A;  1JVJ A;  3O3V A;  3LGO A;  1ERM A;  2L0W A;  2DCF A;  5DFX A;  1G6O A;  1IOU A;  4KQD A;  3KOB A;  1K55 A;  3GRJ A;  2W3F A;  1ESU A;  3BEB A;  4E3N A;  3NDE A;  1EWZ A;  3ZVT A;  2XFS A;  4PM7 A;  4OQG A;  4L9G A;  3RFB A;  4QHC A;  2QZ6 A;  2W3D A;  3IH9 A;  3R7W B;  4NBJ A;  2PRF A;  4WMC A;  5GLD A;  2PU2 A;  1OJG A;  3GDI A;  1W5D A;  5AVF A;  2C6W B;  4FD8 A;  1TDL A;  4GD6 A;  3UE6 A;  2VX8 A;  5AVE A;  1MC0 A;  3N4I A;  3NUL A;  4NBI A;  1XXM A;  5EFW A;  1Y4O A;  3IXH A;  5AQB A;  5CHJ A;  2PYP A;  4RX2 A;  2ZQD A;  4R1G A;  2LB9 A;  3T1R A;  5TR7 A;  5EVI C;  3V3S A;  1L3L A;  2HDU A;  1E25 A;  4S03 A;  5EOO A;  1LI9 A;  4JXV A;  4LEN A;  5FDH A;  3C2W A;  3SW1 A;  4BBT A;  1L0F A;  1WE4 A;  5HSQ A;  4E6X A;  2OAP 1;  1LI0 A;  2OLU A;  5HAR A;  1P9R A;  3IF6 C;  1GCE A;  1VQQ A;  4MNR A;  2V0U A;  2JKT I;  1FR6 A;  1T1C A;  4Z9Q A;  2HP6 A;  5A92 A;  5I5L A;  1FQG A;  4KQR A;  4EER A;  4OOM A;  1KVL A;  3A3F A;  4MBK A;  2ZM2 A;  3W4O A;  4PM9 A;  3ITB A;  4MMN A;  2GDN A;  1OJ5 A;  2PYR A;  5DTK A;  4EV4 A;  2O99 A;  4ZDX A;  4ESP A;  1Q2P A;  2Y8H A;  2X02 A;  1NWZ A;  3TE8 A;  4R6L A;  1FIL A;  3LI9 A;  4X56 A;  4N92 A;  2CC1 A;  3UE0 A;  5HPI A;  1IEL A;  5L8M A;  4GS9 A;  4I39 A;  2R78 A;  2X01 A;  1ERQ A;  5J3W A;  2KLI A;  3NOU C;  4FCF A;  3MR0 A;  1YQS A;  3EGD C;  3S7P A;  2P9V B;  3FKW A;  1PZO A;  1NLY A;  4WM9 A;  1Y54 A;  1ZKJ A;  4ZJ3 A;  4JGR A;  3CIT A;  4HJ4 A;  5CER A;  3ZG5 A;  5DKK A;  1Y2Q A;  4FOF A;  4I3I A;  3KO3 A;  4HH2 A;  1BLP A;  1E4D A;  3IX3 A;  2ZC4 B;  5CGS A;  3QNB A;  5I94 A;  3H7W A;  3N8S A;  1GA0 A;  3T1X A;  3JVU A;  4PM5 A;  1TVF A;  2V1B A;  3EEH A;  5HW3 A;  4WLA A;  2J7V A;  5EVL A;  1PWD A;  1SDE A;  4HJ6 A;  4B9O A;  1YLW A;  4GS9 B;  5FAQ A;  3AGE A;  2Y91 A;  1G28 A;  2ZLY A;  3UPO A;  2ZQ8 A;  1LL5 A;  2XA7 M;  1TF1 A;  3C4P A;  5HX9 A;  4B88 A;  1H8Y A;  4OON A;  4K08 A;  3PD5 A;  1EW0 A;  3NIA A;  4UAA A;  4OP5 A;  1YLT A;  4EEP A;  3HLB A;  3E98 A;  3BFE A;  4QD4 A;  2ZOI A;  3IXD A;  3QP4 A;  2VGJ A;  3KSI A;  3PAE A;  3H7W B;  4JXG A;  4GNU A;  1DJB A;  3RJU A;  1VM1 A;  5HD5 A;  4OPZ A;  2J8Y A;  3VP2 A;  3LR3 A;  3HL9 A;  3VMA A;  5CEC A;  1ES3 A;  3KX0 X;  4BL3 A;  4Z1W A;  1NRF A;  1BT5 A;  2XA7 S;  5CTN A;  2R9W A;  2A3U A;  5IU1 A;  4RRM A;  2V1Z A;  4FH4 A;  3BRM A;  4O8G A;  5J4E A;  3B47 A;  4HEF A;  2WKI A;  4E3M A;  1K25 A;  3TJZ C;  3VSL A;  3DTM A;  4C3Q A;  2Z2M B;  2W1T A;  4R3J A;  1S4R A;  3KNP A;  2AVX A;  4QJG A;  4ETZ A;  3T1Q B;  3RXW A;  4WN5 A;  1G6A A;  5DTS A;  3EGX C;  1I2S A;  4HES A;  4R23 A;  3BEC A;  4OQ0 A;  4U3T A;  3G32 A;  5G4Z A;  2BG1 A;  4S2M A;  5FI6 A;  5IT5 A;  2JCH A;  5M19 A;  2PU4 A;  3MJQ A;  3A0R A;  1W63 M;  1CEG A;  2WAF A;  4ARZ A;  5EOE A;  5GLB A;  3CHW P;  4QY5 A;  3VSK A;  1TC5 A;  3UDX A;  3CG5 A;  4Y15 A;  3N7W A;  5EM0 A;  3KOC A;  3O86 A;  4DE1 A;  1MWU A;  4UEY A;  1K6R A;  1MKM A;  5HDC A;  4HNB A;  1J9M A;  1ONG A;  2L4R A;  2O0Y A;  2B02 A;  4R4R A;  3KYZ A;  2W1T B;  4BWI A;  3FZC A;  3IF5 A;  4JGQ A;  3VP3 A;  4CJN A;  3VFF A;  4BD1 A;  5L10 A;  3LR0 A;  3DTK A;  3UPN A;  1KE3 A;  3ZG9 B;  3S7Q A;  3D3O A;  4MLL A;  3BM6 A;  3G2Z A;  4I38 A;  1MWS A;  2V8C A;  1JWZ A;  3HUM A;  4HJ3 A;  4ARZ B;  2V0W A;  2KX6 A;  2QMI A;  4KUK A;  5G18 A;  2FZ0 A;  1FCN A;  3T50 A;  3IX8 A;  4K0W A;  2J80 A;  1IYQ A;  5CHM A;  4WZ4 A;  3A3E A;  1DJA A;  4DJ2 A;  3V50 A;  4HP4 A;  2HL0 A;  3LO7 A;  4WL9 A;  3W4P A;  3T4Q A;  3CMZ A;  4X1M A;  4RRF A;  2V1A A;  1P0Z A;  1W8Y A;  4O0P A;  3QP5 A;  1NJ4 A;  2I72 A;  1TS6 A;  2DNS A;  4EW7 A;  2EX2 A;  2ZC5 B;  2ZBB A;  4HBT A;  1GA9 A;  3SH8 A;  3M2J A;  4IUH A;  3WS4 A;  1UWP X;  3PXP A;  1ES4 A;  4LCM A;  3Q81 A;  4OQH A;  1FSY A;  3WS1 A;  4LV1 A;  3FPV A;  2Y4A A;  3E4O A;  1ACF A;  4RVA A;  4QU3 A;  1HZO A;  1AWI A;  1XA1 A;  5FI2 A;  4X6T A;  1K38 A;  2MJ6 A;  4KZ7 A;  1YMS A;  3IH8 A;  4R4S A;  4KG6 A;  3MBZ A;  4NKP A;  2O9C A;  5CX7 A;  3ZNY A;  3ZG8 B;  1DY6 A;  3C30 A;  1C3B A;  4BBU A;  1M6K A;  2GNX A;  4O7D A;  4NXG A;  5F1G A;  3PBR A;  2M7U A;  4BMW A;  2WGW A;  5FQK A;  4CPK A;  2OV5 A;  3K2N A;  3VFH A;  3HCY A;  3OLO A;  2VKS A;  5HAP A;  1ESI A;  3KOD A;  1DRM A;  1QME A;  3QP6 A;  3F1N A;  2E8I A;  3OC2 A;  1ZC2 A;  2XQZ A;  2EWV A;  2XLN A;  3SS5 A;  5F5Y A;  2XD1 A;  1HTZ A;  4EBN A;  1CQA A;  5DJT A;  1FR1 A;  5E2H A;  1K57 A;  4X69 A;  5EUA A;  4RRK A;  2I9V A;  5FAO A;  4S02 A;  3LIB A;  4D60 A;  4GZB A;  3N8L A;  5FAS A;  2W3H A;  4JXS A;  5IS1 A;  1ZG4 A;  1YM1 A;  1SZV A;  4GW9 A;  4D2O A;  3OCL A;  3VOL A;  1L0E A;  4R3B A;  2ACG A;  5KSH A;  2IWC A;  1YLJ A;  4I3J A;  4KEN B;  3R7W A;  3F1N B;  2HDS A;  4E3O A;  4EBL A;  3A0S A;  3M6H A;  2ZL1 A;  1LHY A;  4OOL A;  3PD3 A;  2QJ5 A;  1L2S A;  1J7G A;  3E2K A;  4HOI A;  2ZMF A;  1BLS A;  2JN7 A;  4XXR A;  5FAP A;  3MMH A;  3LUQ A;  3DWK A;  4S2N C;  1YMX A;  5EVI D;  4R0Q A;  3N6I A;  5CRF A;  4JF5 A;  4WUJ A;  4DJ3 A;  1W7F A;  2EFU A;  3V39 A;  1MBL A;  3IWO A;  1LSV A;  1IYO A;  2H10 A;  1T1B A;  2JKT M;  2P7J A;  3U2A A;  3KO7 A;  4L9E A;  4S2P A;  4BLM A;  1XJ4 A;  3DTI A;  3OZH A;  1EI5 A;  2KOI A;  1MZU A;  2M7V A;  3KSG A;  3IS2 A;  4S2K A;  1N9B A;  3TRC A;  1IYS A;  3LEZ A;  1KVM A;  4NK3 A;  2ZL1 B;  1W79 A;  2LB5 A;  2H5S A;  2K2N A;  3F1O A;  3CI6 A;  4HBU A;  3BFF A;  4L9F A;  4S2O A;  3WS2 A;  4YOF A;  3MZD A;  2JKR I;  1SCW A;  3ZGA B;  4LV0 A;  4R38 A;  3NBL A;  2Q9N A;  1PFL A;  3GSG A;  3UB7 A;  2WKE A;  2O9A A;  4I5S A;  4S0K A;  3MS6 A;  3NJA A;  1CK3 A;  2XD5 A;  3HUO A;  3A3J A;  1PIO A;  3RH8 B;  3BQ8 A;  2DBO A;  4X25 A;  3A0V A;  5U47 A;  2Y2N A;  5HDD A;  4E3K A;  4DXB A;  3WWX A;  4OPR A;  4QB8 A;  2HJ9 C;  2EFX A;  4WEK A;  4Y3I A;  2BLS A;  1JKE A;  4RRQ A;  4XUX A;  3UDI A;  4PM6 A;  2ZMV A;  4LRZ E;  4BEN A;  3DWZ A;  2XFT A;  4GJ4 A;  1NYY A;  3IS2 B;  2P9V A;  2QPN A;  1DJC A;  3IWI A;  5C5K A;  2PBY A;  3KO9 A;  1IKI A;  4WMC D;  5F83 A;  2PR6 A;  3SS3 A;  3F1O B;  5M18 A;  4MN5 A;  3UB5 P;  4EES A;  1OTB A;  4PKY G;  4G3K A;  3IX4 A;  1D7E A;  2ZOH A;  1JTD A;  1OT6 A;  5FL3 A;  1M40 A;  4S2L A;  2HDR A;  3CZD A;  1FSW A;  4GHI A;  2W0N A;  1GSX A;  3HLF A;  1K55 C;  4UQI S;  2ZQ7 A;  2PHY A;  4H8R A;  2Y2M A;  3HLE A;  1V9Y A;  1YLY A;  3C7V A;  2JHE A;  1GHP A;  1S6R A;  3O5Y A;  3UPP A;  1K56 A;  2ZMA A;  1KDW A;  1F5M A;  4CLC A;  4JBF A;  2H0Y A;  1WA9 A;  3EQU A;  3G2Y A;  3V67 A;  3L9K A;  1AXB A;  1BUL A;  1NXY A;  2OSU A;  4BBV A;  1LSW A;  1YLZ A;  3T4T A;  3NOT C;  4PHT A;  2BAS A;  2QHK A;  2GX5 A;  3HLD A;  3S7O A;  4QY6 A;  1F9I A;  3M2K A;  3WS0 A;  5FQ9 A;  4GHI B;  1S66 L;  3M6B A;  4NXB A;  3EQV A;  5AJG A;  1OTI A;  2RCX A;  3ICY A;  4S0L A;  4RRC A;  3GEC A;  3LFV A;  3K3C A;  1TD5 A;  3F1P A;  3V5M A;  5DTT A;  4E3J A;  1H8Z A;  4L0L A;  2HKZ A;  4CLC B;  5FQM A;  3S7N A;  4WEL A;  1XJ3 A;  4KQO A;  4LCL A;  1QMF A;  4WZ5 A;  3SH9 A;  4O01 A;  4ETX A;  3PBT A;  3ZHH A;  1DP8 A;  1NZU A;  5E43 A;  3DBA A;  5TJJ A;  2OWJ A;  3Q82 A;  2G2W A;  3MSH A;  4ME4 A;  4A5R A;  2WKP A;  2NUT C;  3KO4 A;  4U0T A;  3FYZ A;  4OLG A;  3T1S A;  1RCJ A;  5GHZ A;  4EQ1 A;  1NRJ A;  4GKU A;  4EBP A;  3CPT A;  4X1L A;  3NEC A;  2CMN A;  2VV8 A;  5CTM A;  1K6S A;  3BW6 A;  3BFC A;  1IKG A;  3T4J A;  4KZ5 A;  3FC7 A;  3F1P B;  1H5X A;  2EA9 A;  3ISG A;  1XFQ A;  5EEC A;  2XR0 A;  5KZH A;  2HZ5 A;  3VOZ A;  1FOF A;  3Q7V A;  1TS7 A;  4OLD A;  1GSV A;  4Y0T A;  3FG8 A;  3OBF A;  2XRO A;  3OCN A;  4M3K A;  1W8Q A;  4MBF A;  1VB6 A;  3LIE A;  4NET A;  3GR2 A;  1G5U A;  3T4L A;  2C5W B;  4EXO A;  4RRI A;  1L0D A;  4Q0H A;  3ZDJ A;  1Q2Q A;  1ES5 A;  4PMA A;  4HIA A;  3NY4 A;  4YWZ A;  4X55 A;  1TS0 A;  3CPT B;  1S1Y A;  4HI4 A;  3MZE A;  5CGX A;  5MC7 A;  3ZNT A;  1W63 Q;  1ERO A;  3MQQ A;  1N9N A;  3BY9 A;  2NUP C;  4RRJ A;  2EX6 A;  4N9K A;  4NXF A;  4RR6 A;  2GJ3 A;  1BSG A;  2J9O A;  2H28 A;  5A8B A;  1YLP A;  4I3A A;  2Y2J A;  5GLC A;  4B4Z A;  2VV6 A;  1E3U A;  1YSP A;  3BLM A;  4DRT A;  3MXS A;  4S0I A;  1DP6 A;  3W2Z A;  3Q7V B;  4Q0J A;  4C75 A;  2A49 A;  4B93 A;  4JGO A;  5HD3 A;  3ULF A;  5HWW A;  3KO5 A;  1GHI A;  2WKH A;  1S4S A;  5F69 A;  5K5B A;  3JPU A;  3VP0 A;  4MBH A;  3LMT A;  4GLQ A;  4EUZ A;  3UB9 A;  4IBX A;  3HJI A;  1SHV A;  3E2L A;  1MY8 A;  5GHY A;  2UV0 E;  3UO9 A;  2G2U A;  3QNC A;  2XRN A;  2IWB A;  3VP1 A;  4BL2 A;  3B3X A;  3MQ0 A;  3WRT A;  5DVA A;  1JWV A;  2A2L A;  3HBR A;  4DDS A;  1PWC A;  4Y7P A;  4DE0 A;  1G68 A;  2EXA A;  4S2J A;  3BJN A;  1BZA A;  2VGK A;  2PDR A;  2KDK A;  3IQA A;  1KE4 A;  3IHB A;  1IYP A;  3P09 A;  4FTX A;  4RRD A;  4WEJ A;  4Y5F A;  1STZ A;  2BTF P;  3LR5 A;  4R70 A;  4OOY A;  4E3I A;  3IXG A;  1WYB A;  3EWK A;  3FKV A;  1TS8 A;  4ZAM A;  1RGZ A;  1X0O A;  4Y0O A;  2PD7 A;  4N1X A;  1YT4 A;  2PD8 A;  5FI7 A;  1NLZ A;  4UHU A;  4Y0U A;  2JE5 A;  3ZVW A;  3G35 A;  2HL1 A;  2YKF A;  1LSX A;  4IVK A;  4BD0 A;  4GB7 A;  3EOI A;  1PRQ A;  1BUE A;  1YAX A;  2XSS A;  4HQA A;  3FV7 A;  1PYY A;  2K7S A;  1XJ6 A;  3Q07 A;  3CUE A;  3MXQ A;  2IWD A;  2UWX A;  1P97 A;  2WK0 A;  3L7H A;  4JPM A;  3O87 A;  3VOY A;  2J9P A;  5J8X A;  1FIK A;  3S4X A;  1PZP A;  1SKO B;  2GZA A;  3TW8 A;  3IWQ A;  2RL3 A;  3SH7 A;  4RX3 A;  2D01 A;  5FQQ A;  4K91 A;  4E3L A;  1U60 A;  3PBS A;  1F2K A;  1XJ2 A;  1O7E A;  4HY8 A;  1N4O A;  3G30 A;  1YKD A;  1H0M A;  5FEF A;  2Z2L B;  4IBR A;  2QKP A;  3RTY A;  4XT2 A;  1K54 A;  3T4K A;  4K0X A;  1N9O A;  3BYD A;  4UA9 A;  4H6J A;  3D9Y A;  2OOL A;  1TDG A;  4P6B A;  4QWO A;  3MFD A;  1LL9 A;  3TG9 A;  5EE8 A;  3PTE A;  4DDY A;  4HHD A;  5TGF A;  2W1R A;  5D3O A;  1BYW A;  4N1H A;  2Q0O A;  3HLW A;  2HP9 A;  2XDM A;  1I5Q A;  4GDB A;  4UA7 A;  4R3A A;  4LFU A;  1ODV A;  3HVF A;  4YNR A;  5HWT A;  3LID A;  2E8J A;  3LI8 A;  1MWR A;  1CEF A;  2JC7 A;  1GSW A;  4G3V A;  3OPP A;  1CI9 A;  2VZW A;  2VJW A;  2WAE A;  2ZQA A;  5HFO A;  3LIC A;  4C6Y A;  4ZTK A;  2JKR M;  5FEG A;  5EVE A;  2H0T A;  3G31 A;  3KYE A;  4XT2 B;  5HL1 A;  1HD8 A;  1D1J A;  2QWS A;  3UN7 A;  4KQQ A;  3MXR A;  5AQ7 A;  4ZJ1 A;  4H6J B;  3IF6 A;  2VLG A;  2ZD8 A;  3OPR A;  1KGE A;  1XPB A;  4X53 A;  1SKF A;  4LGW A;  3ZQ5 A;  3OPH A;  1CI8 A;  3TOI A;  1BTL A;  2PT7 A;  4JXW A;  4RA7 A;  4KZB A;  5FQJ A;  4RRL A;  5FSR A;  3CUE C;  5CXW A;  2J3T C;  2FFY A;  3T4O A;  3ZCZ A;  5J7E A;  5EVI B;  5M1A A;  4NEE D;  4S0J A;  4RR9 A;  3NC8 A;  4UA6 A;  1PW1 A;  2P04 A;  4AFI A;  5DF8 A;  4KUO A;  3WS5 A;  3O88 A;  4RYE A;  1XKZ A;  4RR8 A;  1N9L A;  2WGV A;  3A3I A;  3IF6 B;  3OPL A;  1SDN A;  3VE3 A;  4GOG A;  3P98 A;  5TBM A;  1K54 C;  2Y79 A;  3UE3 A;  4ID4 A;  2VK3 A;  3JYI A;  3GQZ A;  3BY8 A;  4LLO B;  5HPF A;  1K57 C;  1NYM A;  2HV1 A;  5EPH A;  4RQ9 A;  1OTA A;  4RRR A;  1S1Z A;  4WBG A;  1NZO A;  3MF0 A;  3GV9 A;  2PR5 A;  2W27 A;  4S2I A;  2D02 A;  4UQI M;  2XH9 A;  1LL8 A;  1KGG A;  1MWT A;  5GL9 A;  5HDS A;  3HRE A;  4KG2 A;  1PW8 A;  1JWP A;  2Y2G A;  5TBM B;  3PD2 A;  2X71 A;  4P6Z M;  3CJM A;  3MKE A;  3LCE A;  4HP9 A;  4P87 A;  3V3R A;  1YSQ A;  3PBN A;  4KZ3 A;  5L2F A;  1MKI A;  2VGL M;  3B42 A;  3DTE A;  5A90 A;  1ZTU A;  4XUZ A;  2V20 A;  3GMW A;  4BQM A;  4E6W A;  5JYO A;  2O9B A;  5CHU A;  5G4Y A;  2M1C A;  1T19 A;  3G4P A;  3LIF A;  4P6Z S;  1NY0 A;  2ZC7 A;  1YPR A;  3BQA A;  1VEU A;  3I7J A;  4MN6 A;  1KOU A;  4FH2 A;  1CF0 A;  4GD8 A;  3G34 A;  2XGN A;  4LRY C;  5E2G A;  1A0K A;  2VGL S;  4II7 A;  4DMZ A;  2Q9M A;  4RRB A;  1D06 A;  3PYP A;  2P74 A;  3BWL A;  2QYB A;  4RRH A;  3AGD A;  4IHQ A;  3CWF A;  3S1Y A;  3HJK A;  3TSG A;  1OPX A;  3S22 A;  3E0Y A;  4P85 A;  5KMW A;  2Y2H A;  1ALQ A;  5IHV A;  1UGU A;  1OME A;  2FFF B;  3FPW A;  5J61 A;  1KDS A;  3KNF A;  3SS4 A;  3MKF A;  5GLA A;  2HPB A;  2JBF A;  4ZJ2 A;  2ZJ9 A;  5FA7 A;  5E2F A;  3LMU A;  3LR4 A;  2OAQ 1;  4KZ8 A;  4GDN A;  1Y28 A;  2ZC3 B;  5FDS A;  4DXC A;  1K56 D;  1VEU B;  4CLC D;  4OH0 A;  5A91 A;  3D72 A;  4Q8I A;  3RXX A;  3PHY A;  3K3D A;  4BJP A;  4YFM A;  2Y2K A;  1IFQ A;  2HJE A;  2HL2 A;  4CLC E;  2Y59 A;  2PAV P;  4GCZ A;  3WRZ A;  1I2W A;  3T12 B;  2QJ7 A;  2Z6C A;  3SZT A;  1ZHH B;  3NOP C;  5DJU A;  1ES2 A;  5CEB A;  4JLF A;  2R9X A;  4ZRR A;  5HAQ A;  5EM1 A;  2OKV A;  2Y2I A;  2HP5 A;  3C7U A;  3QP1 A;  3EEA A;  3B33 A;  5E2E A;  3N8R A;  3LMV A;  5HAI A;  3C5A A;  1OTE A;  2EX8 A;  3A3D A;  5HL6 A;  2XK1 A;  1VHM A;  1TEM A;  1V9Z A;  3ZG7 B;  1FCM A;  4Q0I A;  4DE2 A;  1MPL A;  3GVB A;  2Y2O A;  3MFX A;  4CLC C;  2ZM8 A;  4U0X A;  4WF0 A;  4MCW A;  1DP9 A;  1PI4 A;  1XGJ A;  1LT0 A;  5HZH A;  4WYY A;  3JVV A;  3UNW A;  3MZF A;  2Z6D A;  2Y2P A;  3MQO A;  3CAX A;  2A24 A;  5KSC A;  2HDQ A;  1S67 L;  4DE3 A;  1HLU P;  1OTD A;  1ONH A;  3HLG A;  4JGP A;  4CQH A;  5EV0 A;  3VP4 A;  2Y2Q A;  3NCK A;  1RGY A;  3PAG A;  3UY6 A;  5CGW A;  1BLH A;  2XF3 A;  4KG5 A;  4IJG A;  3ITA A;  3BFG A;  3IBJ A;  3IBR A;  4MN7 A;  3H82 A;  3Q1F A;  3PBO A;  5FAT A;  5DFY A;  1P9W A;  2K31 A;  1JNU A;  2W3G A;  3UB8 A;  4PAU A;  3LY4 A;  3E4P A;  4Y2F A;  4PM8 A;  3UE1 A;  4WZ5 C;  3C8C A;  2JKF A;  5A93 A;  5HWV A;  4JKT A;  4EWF A;  1J3W A;  4Y17 A;  2ZM0 A;  3QP2 A;  4DKI A;  4HH3 A;  3VV4 A;  2A24 B;  4B4X A;  1XFN A;  2EWW A;  4IED A;  4EEU A;  1K4F A;  3OOV A;  4M4X A;  1FCO A;  3IHA A;  3U4L P;  2W3E A;  2IA2 A;  4G3W A;  1PWG A;  1T1A A;  2P08 A;  2ZC6 B;  3AGF A;  3H82 B;  3D4F A;  2INW A;  5GHX A;  1H8M A;  2WAD A;  3LEQ A;  1JTG A;  2WZX A;  3VE4 A;  4MDZ A;  4N9L A;  5L09 A;  2WKQ A;  1E3U D;  4OP8 A;  3ZFZ A;  1GHM A;  2JKG A;  4LV3 A;  2J3W A;  3KO6 A;  1BLC A;  2V9A A;  2ZQ9 A;  1SKO A;  2WGI A;  3KSF A;  4MEZ A;  1KE0 A;  2B5R A;  3ZYT A;  2FH5 A;  3P01 A;  4OPY A;  1CJF A;  1S0W A;  3UMD A;  3PR6 A;  2EX9 A;  4NG2 A; 
#chains in the Genus database with same CATH homology
 4X53 A;  1SKF A;  1FSW A;  1LLB A;  1XX2 A;  3OPH A;  4GN2 A;  4HEF A;  4OKP A;  5DF7 A;  3GTC A;  3HLF A;  2WKI A;  1CI8 A;  3TOI A;  1K55 C;  4E3M A;  1BTL A;  1K25 A;  4JXW A;  2WZZ A;  4RA7 A;  4KZB A;  1KGF A;  5FQJ A;  3BFD A;  1XP4 A;  4RRL A;  2ZQ7 A;  3VSL A;  4H8R A;  5FSR A;  3DTM A;  2Y2M A;  3HLE A;  5CXW A;  4C3Q A;  3QHY A;  1YLY A;  2Z2M B;  2FFY A;  3C7V A;  4OQI A;  4R3J A;  3ZCZ A;  3KNP A;  3UDF A;  3ZG0 A;  5JYP A;  1K4E A;  4QJG A;  1GHP A;  1S6R A;  3FWL A;  3UPP A;  1K56 A;  2ZMA A;  5EVI B;  5TFQ A;  3Q7Z A;  3RXW A;  2WYX A;  4RRG A;  2ZQC A;  1KDW A;  1G6A A;  2V2F F;  5DTS A;  5M1A A;  4JBF A;  1IEM A;  1L0G A;  1I2S A;  4HES A;  2H0Y A;  4R23 A;  3EQU A;  4S0J A;  3G2Y A;  4KZ9 A;  3BEC A;  2Y55 A;  4OQ0 A;  4U3T A;  4RR9 A;  3G32 A;  4S2N A;  2BG1 A;  1AXB A;  3NC8 A;  1BUL A;  3HLC A;  4S2M A;  5FI6 A;  2JCH A;  4UA6 A;  3HUN A;  1NXY A;  2OSU A;  1PW1 A;  5M19 A;  2PU4 A;  4KZ6 A;  1CEG A;  3IT9 A;  1O07 A;  1YLZ A;  2WAF A;  5DF8 A;  3WS5 A;  5EOE A;  3O88 A;  4RYE A;  5GLB A;  3IXB A;  4QY5 A;  3VSK A;  1TC5 A;  3UDX A;  1XKZ A;  3CG5 A;  4RR8 A;  2WGV A;  3A3I A;  3IF6 B;  3OPL A;  1SDN A;  1XGI A;  3N7W A;  3HLD A;  4QY6 A;  3BLS A;  3P98 A;  4GOG A;  3W8K A;  3DW0 A;  3M2K A;  3WS0 A;  3KOC A;  1K54 C;  3O86 A;  4DE1 A;  5FQ9 A;  1XA7 A;  4JF4 A;  4LV2 A;  1MWU A;  1K6R A;  3UE3 A;  3M6B A;  4ID4 A;  3JYI A;  3EQV A;  4RRA A;  2XEP A;  3GQZ A;  1J9M A;  1ONG A;  4KZ4 A;  1RP5 A;  2RCX A;  5CED A;  4R4R A;  4S0L A;  4RRC A;  4ZBE A;  1K57 C;  1NYM A;  5EPH A;  3NDG A;  3V5M A;  4RRR A;  5DTT A;  3FZC A;  4E3J A;  4PPR A;  1H8Z A;  3IF5 A;  3C4O A;  4L0L A;  2HKZ A;  4WBG A;  1NZO A;  1WYC A;  3VP3 A;  4CJN A;  3VFF A;  4BD1 A;  5FQM A;  4WEL A;  3GV9 A;  2DRW A;  4KQO A;  4LCL A;  4RR7 A;  4JF6 A;  1QMF A;  1KE3 A;  4WZ5 A;  3UPN A;  3SH9 A;  3ZG9 B;  1ZG6 A;  3PBT A;  3ZHH A;  4MLL A;  3PD4 A;  3BM6 A;  3G2Z A;  1NZU A;  4S2I A;  5E43 A;  1HVB A;  1MWS A;  1JWZ A;  5EVI A;  4OPQ A;  5BOH A;  3HUM A;  5DF9 A;  1MXO A;  3Q82 A;  2G2W A;  2XH9 A;  3NI9 A;  1PI5 A;  3PBQ A;  4YIN A;  4A5R A;  1KGG A;  2QMI A;  3KO4 A;  1MWT A;  4U0T A;  3FYZ A;  5G18 A;  5GL9 A;  3HRE A;  4KG2 A;  4P0M A;  4OLG A;  1FCN A;  1PW8 A;  5F82 A;  1JWP A;  1RCJ A;  2Y2G A;  5GHZ A;  3W4Q A;  2Y2L A;  3PD2 A;  4KZA A;  2X71 A;  4K0W A;  1IYQ A;  2EXB A;  3CJM A;  4FSF A;  4GKU A;  4EBP A;  3SOI A;  5CHM A;  4X68 A;  4IVI A;  4WZ4 A;  5AQA A;  3MKE A;  3LCE A;  5F1F A;  3A3E A;  1DJA A;  5CTM A;  4P87 A;  1K6S A;  3V3R A;  3BFC A;  1IKG A;  3V50 A;  2HL0 A;  3PBN A;  4KZ3 A;  2WGW B;  3LO7 A;  4KZ5 A;  5L2F A;  3W4P A;  1MKI A;  1Z6F A;  2WUQ A;  4DF6 A;  3CMZ A;  5AQ9 A;  5FQI A;  4EQI A;  1H5X A;  3ISG A;  5EEC A;  3LY3 A;  2XR0 A;  4RRF A;  5A90 A;  1W8Y A;  1NJ4 A;  2I72 A;  5KZH A;  2DNS A;  3VOZ A;  2EX2 A;  4OVD A;  1FOF A;  2OLV A;  1JVJ A;  4F94 A;  2ZC5 B;  3O3V A;  3Q7V A;  4HBT A;  4OLD A;  1GA9 A;  3SH8 A;  3M2J A;  4Y0T A;  3WS4 A;  1ERM A;  3OCN A;  4XUZ A;  2V20 A;  2DCF A;  3GMW A;  4BQM A;  4M3K A;  4E6W A;  1W8Q A;  5JYO A;  4MBF A;  1ES4 A;  5CHU A;  3KOB A;  4LCM A;  3Q81 A;  3G4P A;  4NET A;  4OQH A;  1FSY A;  3GR2 A;  2C5W B;  4RRI A;  3WS1 A;  1L0D A;  1NY0 A;  3ZDJ A;  4LV1 A;  2ZC7 A;  1Q2Q A;  2Y4A A;  3I7J A;  1ES5 A;  4RVA A;  4PMA A;  1K55 A;  4QU3 A;  1HZO A;  3NY4 A;  4FH2 A;  1XA1 A;  3GRJ A;  4GD8 A;  5FI2 A;  4X6T A;  1K38 A;  3G34 A;  4KZ7 A;  4X55 A;  1ESU A;  3BEB A;  2XGN A;  1YMS A;  4E3N A;  3NDE A;  5E2G A;  1EWZ A;  3IH8 A;  2Q9M A;  4R4S A;  4KG6 A;  3MBZ A;  3ZVT A;  2XFS A;  4RRB A;  4PM7 A;  3MZE A;  5CGX A;  2P74 A;  4OQG A;  3ZNY A;  3ZNT A;  3ZG8 B;  1DY6 A;  1ERO A;  4QHC A;  4RRH A;  2QZ6 A;  3AGD A;  3IH9 A;  4RRJ A;  1C3B A;  2EX6 A;  4N9K A;  3S1Y A;  4RR6 A;  3TSG A;  3S22 A;  1BSG A;  1M6K A;  2J9O A;  4P85 A;  4O7D A;  5KMW A;  4NBJ A;  5F1G A;  1YLP A;  2Y2J A;  5GLC A;  3PBR A;  4WMC A;  5GLD A;  4B4Z A;  2PU2 A;  2Y2H A;  1E3U A;  1ALQ A;  3BLM A;  5IHV A;  4DRT A;  3MXS A;  4S0I A;  1OME A;  2FFF B;  2WGW A;  5FQK A;  3Q7V B;  4CPK A;  2OV5 A;  1W5D A;  5J61 A;  3VFH A;  2C6W B;  4FD8 A;  1KDS A;  4C75 A;  2A49 A;  3KNF A;  3SS4 A;  3MKF A;  1TDL A;  4GD6 A;  5HAP A;  5GLA A;  2HPB A;  1ESI A;  2JBF A;  2ZJ9 A;  5FA7 A;  5E2F A;  4ZJ2 A;  1QME A;  3N4I A;  3KOD A;  3LMU A;  4NBI A;  3KO5 A;  4KZ8 A;  1GHI A;  2WKH A;  1XXM A;  4GDN A;  3IXH A;  2ZC3 B;  5AQB A;  2E8I A;  5CHJ A;  3VP0 A;  1K56 D;  4DXC A;  4MBH A;  3OC2 A;  1ZC2 A;  2XQZ A;  2ZQD A;  4R1G A;  4RX2 A;  3LMT A;  4EUZ A;  5TR7 A;  5EVI C;  2XLN A;  3V3S A;  4OH0 A;  2HDU A;  5A91 A;  1E25 A;  4IBX A;  4S03 A;  5EOO A;  1SHV A;  3SS5 A;  3E2L A;  1LI9 A;  1MY8 A;  2XD1 A;  4JXV A;  4Q8I A;  1HTZ A;  4LEN A;  3RXX A;  5FDH A;  5GHY A;  4BJP A;  4YFM A;  4EBN A;  3UO9 A;  2Y2K A;  2G2U A;  1FR1 A;  3QNC A;  5E2H A;  3VP1 A;  2IWB A;  1K57 A;  4X69 A;  5EUA A;  1L0F A;  4RRK A;  2HL2 A;  4BL2 A;  2Y59 A;  3B3X A;  3WRZ A;  3WRT A;  1WE4 A;  5DVA A;  5FAO A;  1JWV A;  4S02 A;  4E6X A;  3HBR A;  4GZB A;  1I2W A;  4DDS A;  1LI0 A;  1PWC A;  2OLU A;  5HAR A;  4Y7P A;  3N8L A;  4DE0 A;  1ES2 A;  1G68 A;  3IF6 C;  5FAS A;  5CEB A;  1GCE A;  1VQQ A;  4MNR A;  2EXA A;  4JLF A;  4S2J A;  2R9X A;  4JXS A;  1FR6 A;  4Z9Q A;  2HP6 A;  5HAQ A;  5A92 A;  1ZG4 A;  1BZA A;  1FQG A;  4KQR A;  1YM1 A;  2VGK A;  2OKV A;  4OOM A;  4D2O A;  3OCL A;  2Y2I A;  1KVL A;  2HP5 A;  1KE4 A;  1L0E A;  3A3F A;  3C7U A;  3IHB A;  3IQA A;  4MBK A;  1IYP A;  2ZM2 A;  4R3B A;  5E2E A;  3W4O A;  4PM9 A;  3ITB A;  2IWC A;  3P09 A;  5KSH A;  1YLJ A;  3N8R A;  3LMV A;  4RRD A;  4WEJ A;  2GDN A;  4KEN B;  5HAI A;  3C5A A;  5DTK A;  4EV4 A;  2HDS A;  4E3O A;  4OOY A;  4E3I A;  2EX8 A;  3IXG A;  3A3D A;  1WYB A;  1Q2P A;  4EBL A;  4ZDX A;  2X02 A;  3FKV A;  2XK1 A;  3M6H A;  1LHY A;  1TEM A;  4OOL A;  3ZG7 B;  3PD3 A;  1FCM A;  4ZAM A;  1L2S A;  4DE2 A;  1MPL A;  1RGZ A;  3GVB A;  4Y0O A;  1J7G A;  2Y2O A;  3E2K A;  4N1X A;  1YT4 A;  4X56 A;  5FI7 A;  2ZM8 A;  4UHU A;  1BLS A;  4XXR A;  4U0X A;  5FAP A;  4Y0U A;  4N92 A;  2JE5 A;  3DWK A;  3G35 A;  3ZVW A;  2CC1 A;  3UE0 A;  2HL1 A;  4S2N C;  1IEL A;  1PI4 A;  1YMX A;  1XGJ A;  4IVK A;  4BD0 A;  5EVI D;  4GB7 A;  4R0Q A;  3N6I A;  5CRF A;  4JF5 A;  1BUE A;  4WYY A;  3UNW A;  1W7F A;  2X01 A;  1ERQ A;  2EFU A;  3FV7 A;  3V39 A;  3MZF A;  1MBL A;  4FCF A;  1PYY A;  3IWO A;  2Y2P A;  1YQS A;  1IYO A;  3Q07 A;  2H10 A;  5KSC A;  2HDQ A;  2P9V B;  2IWD A;  2UWX A;  3FKW A;  1PZO A;  4DE3 A;  2WK0 A;  4WM9 A;  1ONH A;  3HLG A;  1Y54 A;  4JPM A;  3O87 A;  1ZKJ A;  3VP4 A;  4S2P A;  2Y2Q A;  3KO7 A;  4ZJ3 A;  3NCK A;  3VOY A;  4BLM A;  1RGY A;  3PAG A;  3UY6 A;  5CGW A;  1BLH A;  3OZH A;  2XF3 A;  1EI5 A;  2J9P A;  5J8X A;  4KG5 A;  5CER A;  3ITA A;  3ZG5 A;  3BFG A;  1Y2Q A;  3KO3 A;  3Q1F A;  4S2K A;  3S4X A;  1BLP A;  1N9B A;  1PZP A;  1E4D A;  3PBO A;  2ZC4 B;  1IYS A;  3LEZ A;  5FAT A;  3IWQ A;  5CGS A;  2RL3 A;  3QNB A;  3SH7 A;  1KVM A;  5I94 A;  4NK3 A;  4RX3 A;  1W79 A;  5FQQ A;  3N8S A;  1GA0 A;  2H5S A;  4K91 A;  4E3L A;  1U60 A;  3PBS A;  3LY4 A;  4HBU A;  4PM5 A;  3BFF A;  4S2O A;  1TVF A;  3WS2 A;  4PM8 A;  3UE1 A;  1O7E A;  5HW3 A;  1N4O A;  4WZ5 C;  2J7V A;  3G30 A;  3MZD A;  5EVL A;  1SCW A;  3ZGA B;  1PWD A;  4LV0 A;  5A93 A;  1SDE A;  2Z2L B;  4IBR A;  3NBL A;  2Q9N A;  1K54 A;  3GSG A;  2WKE A;  4K0X A;  1YLW A;  3BYD A;  4JKT A;  4UA9 A;  4EWF A;  4S0K A;  1CK3 A;  2XD5 A;  5FAQ A;  3HUO A;  3A3J A;  1PIO A;  2ZM0 A;  3AGE A;  1TDG A;  4P6B A;  4DKI A;  2DBO A;  3MFD A;  5U47 A;  1LL9 A;  2Y2N A;  2Y91 A;  4E3K A;  4DXB A;  3TG9 A;  4B4X A;  2ZLY A;  5EE8 A;  3UPO A;  3PTE A;  3WWX A;  2ZQ8 A;  4DDY A;  4IED A;  1LL5 A;  4OPR A;  5TGF A;  4QB8 A;  1K4F A;  3C4P A;  5HX9 A;  1FCO A;  2EFX A;  3IHA A;  4WEK A;  5D3O A;  4B88 A;  1H8Y A;  2BLS A;  1JKE A;  4OON A;  4RRQ A;  1PWG A;  4XUX A;  3UDI A;  4N1H A;  4PM6 A;  3PD5 A;  2ZC6 B;  3HLW A;  4BEN A;  2HP9 A;  3NIA A;  2XDM A;  4OP5 A;  4UAA A;  1YLT A;  3DWZ A;  1I5Q A;  2XFT A;  3AGF A;  1NYY A;  2P9V A;  2QPN A;  3D4F A;  4GDB A;  4UA7 A;  3HLB A;  1DJC A;  5GHX A;  2WAD A;  3BFE A;  3IWI A;  1JTG A;  2WZX A;  4QD4 A;  4N9L A;  3HVF A;  3IXD A;  2VGJ A;  3PAE A;  2PBY A;  3KO9 A;  1IKI A;  4JXG A;  4GNU A;  4WMC D;  1DJB A;  5F83 A;  3RJU A;  1VM1 A;  1E3U D;  4OP8 A;  4OPZ A;  1GHM A;  3ZFZ A;  3SS3 A;  5M18 A;  1MWR A;  1CEF A;  2JC7 A;  2WAE A;  1CI9 A;  3OPP A;  4LV3 A;  2ZQA A;  2J8Y A;  5HFO A;  3VP2 A;  1BLC A;  2ZQ9 A;  3HL9 A;  2WGI A;  4MEZ A;  4C6Y A;  4ZTK A;  3VMA A;  1KE0 A;  2B5R A;  2H0T A;  5CEC A;  3G31 A;  1ES3 A;  4BL3 A;  1HD8 A;  5HL1 A;  1NRF A;  1BT5 A;  4OPY A;  3UN7 A;  5CTN A;  4KQQ A;  3MXR A;  5AQ7 A;  4ZJ1 A;  1JTD A;  3IF6 A;  2R9W A;  2ZD8 A;  1S0W A;  2A3U A;  3OPR A;  4RRM A;  2V1Z A;  1KGE A;  4FH4 A;  1M40 A;  2EX9 A;  3BRM A;  4S2L A;  2HDR A;  1XPB A;  3CZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...