2EXBA

Crystal structure of penicillin binding protein 4 (dacb) from escherichia coli, complexed with flomox
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
454
structure length
446
Chain Sequence
b'DEYITQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKYELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYAVRIPLVRFESRLYKDIYQNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 4
publication title Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, both in the native form and covalently linked to various antibiotics
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 137
structure length 446
sequence length 454
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2005-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2exbA01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 2exbA02
4OPZA 4WEJA 1BLCA 1KE3A 3AGFA 1TDGA 3QNBA 1HTZA 3UE1A 2H10A 3N8LA 4NETA 4KZ6A 4P0MA 2J9PA 2WGVA 3N7WA 4X53A 5FQQA 1LLBA 1IYOA 3G2YA 4JXSA 3IWIA 1CK3A 1YLZA 1NZOA 3EQUA 2WKEA 2ZQ7A 5CHUA 3IXBA 1KVMA 4OOYA 1PI4A 4LV0A 3ZNTA 2WKIA 3SS5A 4QU3A 3W4OA 5EVIA 3V39A 4B4XA 5E2GA 2PU2A 1JTDA 2Y2LA 3VOYA 4BD0A 3ZCZA 3P98A 5CGXA 2ZC7A 3OC2A 4E3LA 3SOIA 3DWKA 1PI5A 1G6AA 3UPOA 4RX2A 3V50A 1EWZA 4E3JA 3GQZA 3MZEA 2H0YA 4PMAA 3VSKA 2JC7A 5A93A 3IXGA 3ZDJA 1IELA 2HDRA 1S0WA 3A3EA 3HBRA 5DTSA 5FQMA 5FQKA 4EV4A 4EWFA 5KSHA 3V5MA 5F1GA 3OCNA 3Q7VB 2ZQCA 3WS4A 3G31A 1C3BA 5TFQA 2RCXA 1L0EA 4JLFA 1K57C 2HDQA 1GCEA 4N9LA 2XFSA 1TEMA 3OPPA 4JF5A 1FCMA 1HZOA 4WZ4A 1L0FA 5EUAA 5GLAA 4KG5A 1Q2PA 2P9VB 2WGWA 1XPBA 3D4FA 3G30A 3OPLA 4IBRA 1MXOA 3DWZA 1XGJA 1E25A 5TR7A 2VGJA 5GHZA 1W8QA 2WK0A 3UPPA 5M1AA 2Y2NA 3M6BA 5DF7A 3VP3A 5FATA 2GDNA 1FCNA 3PBOA 5CHMA 4Q8IA 2WZXA 5I94A 5GLDA 4JF6A 5CEDA 4UA6A 5FI6A 4OPRA 3NDEA 3O87A 4N92A 4ZJ1A 4OKPA 5HFOA 2E8IA 4OQIA 2X01A 3E2LA 1H8YA 2Y59A 3AGDA 4O7DA 4E6WA 1DY6A 1ZG6A 2R9XA 4OP8A 1XXMA 1S6RA 4LCMA 4KZ9A 3WRZA 3IH8A 4EBLA 3WS0A 3LY3A 1RGYA 1NRFA 4WELA 1FSWA 4JBFA 3N6IA 3C4OA 1DJCA 4WZ5A 5F83A 1BUEA 5CGWA 4RYEA 5E2HA 1PWGA 2RL3A 3PBNA 1EROA 1I5QA 3NBLA 3HLFA 5F1FA 4X69A 5AQ7A 4MNRA 3HUOA 1FR6A 1CEGA 3FV7A 3LO7A 4S2PA 4Y0TA 4OPQA 1L2SA 3HLWA 1K25A 4YFMA 4JXVA 5EE8A 4DXBA 3IH9A 4R4SA 4PM9A 5HX9A 1ZKJA 1W79A 4OQHA 3PBQA 4HESA 4IVKA 3UY6A 1MPLA 1E3UD 3VP1A 4R1GA 3PAGA 4GNUA 3VMAA 5BOHA 1PYYA 1YLJA 5CGSA 4QY6A 1KDSA 3Q7VA 4DF6A 5CEBA 3GR2A 5KSCA 1CI9A 5U47A 5FASA 2Y91A 3UDXA 4BD1A 5EOOA 4KQQA 4PPRA 2PBYA 3O86A 3A3IA 3UE3A 3JYIA 3CJMA 4KG2A 2WGIA 4S2NC 1IEMA 4R3JA 2X71A 2P9VA 3IXDA 4QY5A 2ZQDA 3RXXA 2IWCA 3IF6A 2X02A 2XH9A 4BJPA 4E3NA 1IYSA 4WYYA 3MZFA 3IXHA 3C7UA 2XQZA 2ZMAA 1DJBA 1ES5A 3IHAA 3BRMA 4PM8A 4U0TA 4KZ8A 1GA0A 4BL3A 1YLTA 1PW8A 3VSLA 1E4DA 5FI7A 3VFFA 2HP9A 1BULA 4FH2A 4Y0OA 3RXWA 3TOIA 3G35A 4QHCA 1K4EA 4KZ5A 3A3FA 3UDFA 1BSGA 1K6RA 1YLWA 5KZHA 2J7VA 1JWZA 2Y2OA 4K0XA 3OPHA 4UHUA 4RA7A 1M40A 1YM1A 3LY4A 1AXBA 3G4PA 3GTCA 1IYPA 1PW1A 3MXRA 2ZM2A 2HDUA 3S22A 1LL5A 3FKVA 4MBFA 2ZC3B 4FH4A 4OPYA 4OQGA 3IHBA 1FCOA 3HLGA 4DE1A 1K56A 3M2KA 3ISGA 5EVIC 4CPKA 3GRJA 4UA7A 1XX2A 4DE2A 2C6WB 3HLCA 5FAPA 5M19A 4H8RA 4FCFA 2WZZA 3HLEA 3Q7ZA 2XLNA 3GVBA 1BLSA 1MWRA 2DRWA 2ZM8A 4JF4A 4LV3A 4MBKA 2JE5A 3A3JA 1DJAA 1RCJA 1I2SA 2XD1A 4JXWA 3HL9A 4KZ3A 5CTNA 3SH9A 4KZAA 3GSGA 4S2MA 3NI9A 2ZC6B 1LHYA 2FFFB 1BZAA 3ZFZA 3HREA 2HP5A 4X68A 2J8YA 3C4PA 1TDLA 2G2WA 3FZCA 4K0WA 3UN7A 2XDMA 1ES3A 1PZOA 2Y2PA 3IF6B 3Q1FA 1RP5A 2HP6A 3HLBA 4EBNA 2UWXA 3MFDA 3ZVWA 1CI8A 2ZM0A 2ZQ8A 3BLMA 4A5RA 1Y54A 4IVIA 4KZ4A 5DTKA 1PWCA 2HPBA 4ZAMA 5E2EA 1E3UA 5EPHA 3IWQA 5CTMA 3MZDA 4JXGA 3VFHA 1PIOA 4QJGA 2B5RA 1NJ4A 5DTTA 3WS5A 5FQJA 3HUNA 1K56D 4E6XA 1WYBA 1LI0A 2IWDA 1ERQA 5A90A 2WYXA 3O88A 3UDIA 4E3IA 2V1ZA 3TG9A 3WRTA 3RJUA 3ZHHA 1ES4A 5HAQA 3BFGA 3G34A 1MWUA 1NY0A 1ESUA 2WUQA 4FD8A 4P85A 4Z9QA 2Y2KA 3BEBA 2Q9MA 4Y7PA 3I7JA 4K91A 3ZG9B 4S2LA 3IQAA 1PZPA 3VP2A 4BENA 1ESIA 3HLDA 1MBLA 3LCEA 1QMEA 4WZ5C 1IKIA 1KGEA 1ONHA 3B3XA 1SCWA 3OCLA 4KG6A 2QPNA 2Y4AA 4MLLA 5JYOA 4S2KA 3M2JA 4R4RA 1W7FA 1K6SA 3LEZA 2IWBA 1N9BA 5FI2A 2Y2GA 1ONGA 5EECA 2EXAA 2WKHA 1KE4A 2A49A 2H0TA 3W4PA 4KQOA 3SH7A 3G2ZA 4DKIA 3ZG0A 5HW3A 1K55A 1MY8A 3MBZA 5TGFA 4X6TA 3NIAA 1YMSA 5FDHA 2P74A 4KZ7A 4BL2A 2DCFA 4LENA 4DE3A 3SS4A 1J9MA 1K54A 4OOMA 1ERMA 5FA7A 2BLSA 2QZ6A 2XF3A 2EFUA 5DF8A 4E3MA 3SS3A 5HL1A 1ZG4A 3N4IA 4F94A 3BFFA 4EBPA 3NCKA 3QHYA 4RVAA 3W4QA 3ZGAB 2Q9NA 4LV1A 3IF6C 2ZC5B 4S2JA 3IWOA 1GHPA 2BG1A 5CHJA 3PBRA 1CEFA 3N8SA 4CJNA 4JKTA 5HARA 2PU4A 4MEZA 4DDYA 4BQMA 1BTLA 3A3DA 4KQRA 3S4XA 5GHYA 1HD8A 3DW0A 3Q82A 2ZLYA 4U0XA 2G2UA 2OLUA 5CXWA 2XK1A 2EX9A 3O3VA 3UNWA 4E3OA 1FOFA 2EX6A 4IEDA 4GN2A 3FWLA 1SHVA 5D3OA 1XP4A 3P09A 1FSYA 1H8ZA 3PAEA 5HAPA 2J9OA 2ZQAA 3ZVTA 4MBHA 5IHVA 3BFDA 3EQVA 4U3TA 3W8KA 5DF9A 4GB7A 4C75A 4WBGA 1KE0A 3Q81A 4R0QA 1VQQA 3ZNYA 3AGEA 4ZDXA 4N9KA 5KMWA 1Q2QA 3ITBA 4DDSA 2JCHA 4N1XA 3PBTA 1K38A 4GD8A 3CG5A 3E2KA 4XUXA 4KENB 1XKZA 2A3UA 3VP0A 1U60A 1OMEA 1KDWA 4UAAA 1BLHA 1ES2A 4XUZA 1WYCA 5A92A 4GDNA 3BLSA 4PM5A 1Z6FA 2EXBA 1JVJA 3MKFA 1N4OA 5EOEA 3S1YA 5FAQA 4R3BA 5J8XA 4ID4A 2C5WB 1W5DA 2HDSA 3MXSA 4C3QA 2XR0A 1BLPA 3OZHA 1IKGA 1MWTA 3UPNA 1BT5A 2ZD8A 3NY4A 4PM7A 3WS1A 1ALQA 4FSFA 1YLPA 5M18A 1XA1A 4OP5A 2DNSA 3BYDA 4OH0A 4C6YA 3IF5A 3UE0A 2Y2HA 1JWPA 4ZTKA 1K57A 1GA9A 3ZG8B 1NYMA 1WE4A 3GV9A 4HBUA 1SDNA 5AQAA 4RX3A 5AQBA 2QMIA 2WADA 3OPRA 1NXYA 2XGNA 4OQ0A 5G18A 1K4FA 2EX8A 4WEKA 4PM6A 3Q07A 3BFCA 3FYZA 2OSUA 1YLYA 1NYYA 2OLVA 2JBFA 4WMCA 5EVLA 1TVFA 4OLGA 4GKUA 1PWDA 4DRTA 4QB8A 4YINA 2Y2IA 2OV5A 4S2IA 3VP4A 4NK3A 1LL9A 3DTMA 2WAEA 2ZC4B 4DE0A 4JPMA 1KVLA 1M6KA 2Z2MB 3C5AA 3NDGA 3BECA 4X56A 2XEPA 5EVID 4DXCA 5HAIA 4LV2A 1KGFA 4OLDA 3N8RA 2R9WA 1VM1A 4ZJ3A 4B88A 4B4ZA 2WAFA 1JTGA 4HBTA 1SDEA 1SKFA 4ZJ2A 3ZG5A 2V20A 2FFYA 5FAOA 5GHXA 5FQIA 3ITAA 4QD4A 2Y2MA 3TSGA 1L0GA 5A91A 5EVIB 3C7VA 3UO9A 1I2WA 5E2FA 1YMXA 5GLBA 3NC8A 1NZUA 3QNCA 4WM9A 1QMFA 2ZQ9A 4GZBA 2V2FF 2Z2LB 3BFEA 3PTEA 4OVDA 1RGZA 4GOGA 5CRFA 4BLMA 4M3KA 5GLCA 4IBXA 4GD6A 4ZBEA 2EFXA 2H5SA 4EQIA 4LCLA 3CZDA 4WMCD 5FQ9A 2EX2A 1L0DA 1GHIA 1XGIA 3FKWA 1K55C 2XD5A 5E43A 5CERA 3PBSA 3G32A 4P87A 1G68A 4Y0UA 4EUZA 3GMWA 1YQSA 1XA7A 1H5XA 2Y2QA 5GL9A 1GHMA 5DVAA 1K54C 3V3RA 4L0LA 5AQ9A 1HVBA 4OONA 5FSRA 4S2NA 3ZG7B 4KZBA 1MKIA 2XFTA 3IT9A 3HVFA 2Y2JA 2Y55A 3BM6A 1KGGA 4N1HA 4XXRA 2WGWB 1ZC2A 3HUMA 4GDBA 4X55A 3WS2A 1O07A 1JWVA 1O7EA 1MWSA 2I72A 2CC1A 1FQGA 3MKEA 5CECA 4UA9A 4D2OA 3CMZA 4OOLA 5F82A 1YT4A 5L2FA 3M6HA 4P6BA 3V3SA 4R23A 3SH8A 5JYPA 4E3KA 4S2OA 1FR1A 3VOZA 1LI9A 3WWXA 2ZJ9A 1EI5A 2VGKA 4HEFA 1IYQA 1W8YA
chains in the Genus database with same CATH superfamily
3C8CA 1TDGA 3QNBA 1HTZA 4NXBA 3UE1A 2PR6A 3UB5P 3U2AA 4P0MA 1LLBA 3G2YA 1PI4A 4LV0A 4QU3A 2Y2LA 2V8FA 1OTDA 5CGXA 3SZTA 5DJUA 3UPOA 4E3JA 3VSKA 3KNFA 3IXGA 3O5YA 1S0WA 3MFXA 5FQKA 4Q0HA 1ZHHB 4EV4A 4EWFA 5CX7A 5IT5A 4EERA 1C3BA 2RCXA 3KO7A 1K57C 4P6ZM 3OPPA 1HZOA 1YSPA 1L0FA 3LI8A 4RRHA 4MN5A 4Y15A 1Q2PA 2VKSA 1F98A 2WGWA 2M7UA 1XGJA 3H7WA 5GHZA 2O9BA 1W8QA 2JKTI 2IA2A 2Y2NA 4RRDA 5FATA 1XJ6A 4Q8IA 3NECA 2LB5A 3NDEA 3QP5A 4ZJ1A 4OQIA 2X01A 1CJFA 3AGDA 4E6WA 1W63M 2ZL1A 3WS0A 3LY3A 4WELA 3C4OA 4GLQA 4S0JA 2RL3A 1EROA 1LL8A 5F1FA 5AQ7A 1CEGA 5EM0A 4S2PA 4Y0TA 4OPQA 2QJ5A 1K25A 5HX9A 4RR9A 1W79A 3MR0A 3BWLA 2EWWA 3PAGA 5BOHA 4GS9A 4QY6A 3E4QA 2PT7A 5HDSA 2XROA 1UGUA 3GR2A 4L9FA 5KSCA 1CI9A 2Y79A 4BD1A 5HDDA 2PBYA 3A3IA 2P7JA 3CJMA 4KQDA 4F3LA 2X71A 3EGXC 2P9VA 3IXDA 2IWCA 2ZOHA 1EW0A 3C38A 1DJBA 4RRFA 4PM8A 2HF6A 1OT6A 1TS6A 4Y0OA 3G35A 4KZ5A 4YWZA 4DJ2A 5DFXA 3OPHA 3P7NA 4RA7A 1M40A 1IYPA 3MXRA 1LL5A 4MBFA 2ZC3B 4OPYA 4RRLA 2B95A 1A0KA 1ZTUA 2HJEA 4DE2A 2C6WB 2UV0E 5FAPA 5M19A 1P9WA 4FCFA 5IS1A 4Y3IA 4S0KA 3CWFA 1RCJA 4EU0A 4KZ3A 5CTNA 5C5KA 2YKHA 1DP6A 4S2MA 2HP5A 2J8YA 4LGWA 4S02A 2VA0A 2XDMA 1PZOA 2Y2PA 3HLBA 1T19A 1D7EA 3H9WA 3MFDA 3ZVWA 3IS2A 3IX8A 1PWCA 1E3UA 3F1PA 2JKRM 3RTYA 3T4OA 5DTTA 3HUNA 3MQ0A 1LI0A 1ERQA 5EV0A 4KUOA 4E3IA 3RJUA 3G34A 1JKEA 1ESUA 2WUQA 1GSXA 2Y2KA 3BEBA 3QP4A 2OAQ1 3I7JA 3ZG9B 5HZHA 1S67L 3VP2A 1MBLA 3LCEA 1QMEA 3KODA 5G4ZA 4KG6A 2Y4AA 3B33A 3T1RA 1ACFA 2OWJA 5AVFA 4S2KA 3M2JA 3LEZA 2IWBA 1ONGA 2WKHA 2A49A 5EVEA 3G2ZA 3VOLA 1MY8A 2HZ5A 1H3QA 5FDHA 2K31A 1TS0A 3VV4A 1K54A 1PFLA 4OOMA 1J7GA 2W3EA 2OAP1 2JN7A 3G6OA 3QHYA 4RVAA 3IF6C 4GHIA 1TD5A 3IWOA 3T4KA 4HJ3A 4WN5A 5CHJA 3PBRA 3LR0A 3DTKA 4HY8A 2PU4A 4DDYA 2W0NA 3A3DA 4KQRA 3E0YA 3FPVA 2OLUA 2EX9A 3OLOA 3UNWA 4IEDA 4GN2A 4FTXA 3EGDC 1XP4A 3ZVTA 3EQVA 3GDIA 1KE0A 3Q81A 1VB6A 1UWNX 3D9YA 3PBTA 2J80A 3PR6A 4GD8A 3E2KA 3VP0A 1U60A 4XUZA 5A8BA 4GDNA 3PD4A 5HWWA 1Z6FA 4RR7A 5EOEA 1MZUA 3V67A 1W5DA 2HDSA 4C3QA 3VE4A 1BLPA 4Z1WA 1N9NA 3NY4A 1SZVA 3WS1A 4FSFA 1YLPA 3UMDA 3MMHA 4ZTKA 3ZG8B 1D1JA 2WADA 3LYXA 3UB9A 1NXYA 1K4FA 4BBUA 3FYZA 4WMCA 2D01A 3S7PA 1T1CA 4EUVA 3DTMA 2WAEA 2ZC4B 4JPMA 4R38A 1VETA 3H82A 4LV2A 1JTGA 2FZ0A 2W3GA 2DMWA 3ZG5A 3NOTC 4JGRA 4RRCA 2FFYA 3MJQA 2Y2MA 1YSQA 3UO9A 5EM1A 4O8GA 1NZUA 1OPXA 5HDCA 2HL0A 3PTEA 4BLMA 4M3KA 5GLCA 2INWA 3E4OA 4EQIA 5HWVA 4ETZA 3A0VA 5DKKA 2EX2A 1CF0A 1XGIA 3FKWA 1K55C 4CLCD 3KYQA 1GHMA 4L0LA 5AQ9A 2JKFA 4RRBA 4KZBA 3HJKA 3HVFA 2Y2JA 1KGGA 4XXRA 2VX8A 3WS2A 1VHMA 3D72A 3KYEA 3MKEA 5F82A 1PRQA 1NLZA 5AVEA 1P97A 3T12B 3N7WA 4X53A 5FQQA 4JXSA 3IWIA 1CK3A 4D60A 2WKEA 3ZNTA 2WKIA 3W4OA 3V39A 1JTDA 3VOYA 4BD0A 2OKVA 3ZCZA 2A2LA 5L10A 2ZC7A 2QWSA 4RX2A 2O9CA 1OT9A 2A24A 1IELA 3A3EA 3HBRA 4RRQA 1HLUP 1WA9A 3Q7VB 3G31A 1L0EA 4JLFA 1NWZA 4N9LA 2XFSA 4WZ4A 1Y28A 2V1BA 3PYPA 1XPBA 3G30A 3OPLA 1MXOA 3DWZA 1E25A 2Y8HA 2WK0A 4CQHA 1N9LA 3M6BA 5DF7A 4ESPA 2GDNA 1FCNA 5CHMA 2WZXA 3U4LP 4JF6A 4UA6A 5FI6A 3BQAA 4CLCE 3O87A 4OKPA 4XT2B 5HFOA 3E2LA 1H8YA 2Y59A 4HJ4A 1ZG6A 4KZ9A 3WRZA 3IH8A 3KOCA 1RGYA 1FSWA 4Q0IA 5CGWA 2HL2A 3HLFA 1DP9A 4MNRA 3LO7A 1H8MA 3HLWA 1STZA 3IH9A 4R4SA 1ZKJA 1Y2QA 3KO4A 3PBQA 4PKYG 4GNUA 5HSQA 4DF6A 5CEBA 5U47A 3UDXA 3T4SA 5EOOA 4KQQA 4PPRA 5AJGA 2W1TA 3CUEC 2P04A 4QY5A 3RXXA 2X02A 1YAXA 4E3NA 1IYSA 4WYYA 2ZMAA 1ES5A 4U0TA 2VEAA 1GA0A 3MXQA 2Q0OA 4X1LA 2QKPA 3PD3A 2K7SA 3RXWA 3PHYA 1K6RA 1JWZA 4UHUA 3B47A 1YM1A 3F1OB 1VEUA 5DKLA 2HDUA 4NKPA 4O0PA 3FKVA 3ICYA 4OQGA 3IHBA 4DE1A 3ISGA 3GRJA 4UA7A 4H8RA 2WZZA 3HLEA 3Q7ZA 3GVBA 1BLSA 1MWRA 2DRWA 3PD2A 2ZM8A 4JF4A 4LV3A 1MC0A 1DJAA 1I2SA 3LFVA 3HL9A 3NI9A 2GJ3A 2ZC6B 1LHYA 4LRXC 3ZFZA 4X68A 1TDLA 1DP8A 4K0WA 3Q1FA 3KO3A 1RP5A 2HP6A 1AWIA 2ZQ8A 3BLMA 1Y54A 2HPBA 5HPFA 5EPHA 4I38A 5CTMA 3MZDA 4WUJA 3KX0X 1NJ4A 3LIAA 3WS5A 2CMNA 5FDSA 2BTFP 2P08A 5A90A 2WYXA 3UDIA 5IU1A 2V1ZA 1ES4A 1MWUA 3QP1A 1NY0A 4FD8A 2Q9MA 4Y7PA 3DAVA 2Z6CA 4BENA 2PBDP 2R78A 4LRZE 4RR6A 4UEYA 1SCWA 3OCLA 1IFQA 4HQAA 2QPNA 5JYOA 1W7FA 1K6SA 4WL9A 5I5LA 5FI2A 2Y2GA 4X1MA 2EXAA 3W4PA 1KE4A 3L9KA 3SH7A 4H6JB 1J3WA 3KO9A 3MBZA 3LI9A 4X6TA 4DE3A 3SS4A 5TBMA 1J9MA 1ERMA 5FA7A 4RRRA 4E3MA 5DF8A 5J4EA 5HL1A 1NLYA 2PAVP 4EBPA 3W4QA 2Q9NA 2VV8A 1Y4OA 3N8SA 4CJNA 1LT0A 5HARA 3DW0A 3Q82A 3R7WA 2O0YA 2ZLYA 1YKDA 5L07A 2XK1A 3O3VA 4FUWA 1FOFA 2EX6A 1V9ZA 1SHVA 5HAPA 2J9OA 4IHQA 4MBHA 5IHVA 3BFDA 3LMTA 2OOLA 3NOUC 3T4QA 5DF9A 3W2ZA 4C75A 4HI4A 3AGEA 1Q2QA 3CITA 3F1NB 1MKMA 1XJ4A 4N1XA 3NJAA 4XUXA 1XKZA 3S7OA 1OMEA 5A92A 1TF1A 3BLSA 4YNRA 2EXBA 1S4RA 3S1YA 5J8XA 3LGOA 1IKGA 1MWTA 2VJWA 2AVXA 3UPNA 2NUTC 1XA1A 4G3VA 1LSWA 1XJ2A 2DNSA 3BYDA 4OH0A 4C6YA 2V9AA 3GV9A 4HBUA 1SDNA 5AQAA 5AQBA 2QMIA 3C2WA 2ZMVA 5G18A 4WEKA 4PM6A 2OLVA 2JBFA 1TVFA 2PD7A 4GKUA 1PWDA 1DRMA 4QB8A 3CPTB 4S2IA 3MS6A 4NK3A 1LL9A 4CLCA 1M6KA 2I9VA 4RR8A 5HAIA 3N8RA 1S1YA 4HBTA 1SDEA 1SKFA 4BBTA 3B42A 1F2KA 3BJNA 1G28A 2VZWA 5FQIA 4QD4A 3TE8A 1L0GA 5A91A 1TS7A 3UMEA 1I2WA 2L0WA 1YMXA 2K2NA 4R6LA 2ZQ9A 3MSHA 2V2FF 3T50A 1RGZA 4ARZA 4QWOA 2H5SA 4ZBEA 3ZYTA 3S7QA 5F69A 3ULFA 1L0DA 4GJ4A 1GHIA 1G68A 1XA7A 2Y2QA 5DVAA 1K54C 4Y17A 1HVBA 4II7A 1T18A 4OONA 5FSRA 4S2NA 1GSVA 4N1HA 2WGWB 1ZC2A 3HUMA 3H7WB 3TRCA 2CC1A 2W3FA 3UB6A 4UA9A 4S03A 4OOLA 2JKRI 3M6HA 5DFYA 3V3SA 4RRMA 4R23A 4S2OA 4I3JA 3SW1A 2VGKA 4HEFA 5DJTA 1IYQA 4E04A 4OPZA 4WEJA 1BLCA 1KE3A 3AGFA 2H10A 4NETA 3LR5A 4KZ6A 3JVUA 2ZL1B 2J9PA 1YLZA 3GECA 5CHUA 2VV7A 1KVMA 4LLOB 4HNBA 5EVIA 3MF0A 4EW7A 4JGQA 3HCYA 3P98A 4BMWA 3OC2A 1OTBA 2W27A 3SOIA 4E3LA 4EETB 1PI5A 1G6AA 3V50A 1EWZA 4R70A 2H0YA 4PMAA 2JC7A 5A93A 2HDRA 5KSHA 5FQMA 2GX5A 4LFUA 4GS9B 2VK3A 3V5MA 5F1GA 3OCNA 2ZQCA 5TFQA 1TEMA 5GLAA 1FCMA 5TJJA 4F3LB 1UWPX 2P9VB 3D4FA 5TR7A 3IX4A 4B9OA 4O01A 5M1AA 1N9OA 5K5BA 5GLDA 5CEDA 1PNEA 3JVVA 4OPRA 2KDKA 4G3KA 4N92A 3A0RA 3EOIA 4O7DA 1XXMA 3LICA 1S6RA 4LCMA 4X25A 4EBLA 1NRFA 4JBFA 3N6IA 1DJCA 4WZ5A 5F83A 1BUEA 5L09A 4RYEA 5E2HA 1PWGA 4AFIA 1I5QA 2GZAA 2HKZA 3NBLA 2KX6A 1FR6A 2VGLS 3FV7A 4YFMA 4JXVA 4GCZA 5EE8A 4DXBA 1V9YA 2H28A 4IVKA 3UY6A 1MPLA 1E3UD 4R1GA 5HL6A 4BBVA 3EEAA 5CGSA 4LPZA 1KDSA 2B18A 5FASA 2Y91A 3UB8A 3UE3A 2V0UA 3C30A 4KG2A 2WGIA 1IEMA 3IS2B 4R3JA 1ODVA 2HGVA 2G7UA 2GNXA 2XH9A 4NG2A 4BJPA 3F1PB 3MZFA 3A0SA 3IXHA 4IUHA 2XQZA 1F5MA 4EXOA 3LR3A 3BRMA 4BL3A 1YLTA 2XSSA 4DMZA 4HHDA 1PW8A 3VFFA 3TOIA 1YLWA 2Y2OA 4Y13A 1AXBA 1PW1A 3S22A 3PD5A 4FH4A 2O9AA 4CPKA 1Z09A 4JGOA 3HLCA 2Z6DA 2PYPA 4NXGA 2ZOIA 4MBKA 2XD1A 4JXWA 4KZAA 3GSGA 3LIDA 2FFFB 1BZAA 3HREA 3BW6A 3C4PA 2G2WA 4ZRRA 3BQ8A 3KYZA 3P01A 4MDZA 3IF6B 3NULA 2UWXA 1CI8A 2ZM0A 4A5RA 3K3CA 4IVIA 4ZAMA 5E2EA 3IWQA 4GHIB 3VFHA 5F6AA 2B5RA 1K56D 4B93A 2O99A 1WYBA 3LIBA 4HP4A 3O88A 5F68A 3TG9A 3WRTA 3ZHHA 3BFGA 4R3AA 3IQAA 1PZPA 1ESIA 3HLDA 4HJ6A 3B3XA 4GW9A 2KLIA 2QJ7A 4S0IA 1TS8A 4I39A 2ACGA 1TC5A 4DKIA 1F9IA 3ZG0A 5HW3A 5TGFA 3NIAA 3D3OA 4L9GA 3T4TA 4BL2A 2DCFA 1S66L 5G4YA 3LIEA 2NUPC 1LSVA 2EFUA 1ZG4A 3N4IA 4F94A 3NCKA 3ZGAB 4S2JA 1GHPA 2BG1A 3T1XA 1FIKA 4IUKA 4BWIA 2MJ6A 1BTLA 1GSWA 3S4XA 4BQMA 5GHYA 1HD8A 4I5SA 1S4SA 3CLOA 4NXEA 2G2UA 1VETB 5CXWA 3H82B 4E3OA 2B02A 2VGLM 3FWLA 3K2NA 1XFNA 5D3OA 3P09A 1FSYA 3PAEA 2ZQAA 4U3TA 5HD5A 4GB7A 4RRKA 2L1MA 4WBGA 4R0QA 4RRGA 4N9KA 2WKQA 4DDSA 1K38A 3CG5A 3ZQ5A 4KENB 2A3UA 1BLHA 1OTEA 4WF0A 5FAQA 3QP6A 4R3BA 2WKRA 3MXSA 5F5YA 1G5UA 3KOBA 2ZD8A 5EFWA 2WKPA 4PM7A 5HWTA 1ALQA 3LUQA 4OP5A 3UE0A 2Y2HA 4Y2FA 1K57A 1GA9A 4NEED 1NYMA 1WE4A 3FPWA 3OPRA 2XGNA 4OQ0A 1K0KA 2EX8A 3EWKA 3BY9A 3Q07A 2OSUA 2M7VA 5EVLA 1SKOB 2Y2IA 2OV5A 5FL3A 1KVLA 2V1AA 2Z2MB 3NDGA 3R4KA 3BECA 4X56A 2XEPA 2ZMFA 1KGFA 4OLDA 3FC7A 1VM1A 4ZJ3A 4B4ZA 1XFQA 3IBRA 2V20A 1LSXA 4NXFA 1XJ3A 5GLBA 3NC8A 5J61A 4WM9A 3BFEA 4GOGA 5CRFA 3FG8A 3LR4A 4GD6A 5LBRA 3KSFA 5KIZA 4LCLA 2A24B 5CERA 3CI6A 3PBSA 4Y0UA 4EUZA 3GMWA 1YQSA 1W63Q 1JNUA 5HPIA 1OTIA 3LIFA 5HD3A 2HJ9C 2QYBA 1MKIA 2XFTA 3IT9A 1O07A 1FQGA 3KSGA 4MCWA 3KO5A 4DN0A 3KO6A 1YT4A 4P6BA 5JYPA 2VLGA 2PRFA 4E3KA 3CAXA 1FR1A 3VOZA 1LI9A 2ZJ9A 4NBIA 3S7NA 4PKYA 1W8YA 4FOFA 1D06A 3N8LA 1T1BA 2WGVA 3T1SA 3UE6A 1IYOA 1NZOA 4Y5FA 3EQUA 2ZQ7A 3IXBA 4OOYA 3SS5A 3E98A 4B4XA 5E2GA 2PU2A 3DWKA 3GQZA 3MZEA 4RRIA 2E8JA 3ZDJA 2L4RA 5DTSA 2PD8A 3WS4A 2HDQA 1GCEA 4NBJA 5EUAA 4JF5A 2W1TB 3RH8B 4KG5A 4IBRA 2VGJA 3UPPA 1OTAA 2XA7S 3VP3A 3PBOA 4CLCC 5I94A 1S1ZA 2J3TC 1H0MA 3NOPC 2E8IA 2V8CA 5MC7A 1DY6A 2R9XA 2V0WA 4OP8A 4S0LA 1VEUB 1BYWA 5FEGA 4L9EA 3L7HA 3PBNA 1L3LA 4X69A 3HUOA 4HH3A 1L2SA 2D02A 4I3AA 4PM9A 4OQHA 4EEUA 2JHEA 4HESA 3VP1A 4RRJA 2J3WA 4HIAA 3VMAA 1PYYA 1YLJA 3KNPA 3Q7VA 4EEPA 3DBAA 3O86A 4YOFA 3JYIA 4S2NC 2ZQDA 3IF6A 4EQ1A 2JKGA 3C7UA 3LMVA 3IHAA 4KZ8A 3VSLA 1E4DA 5FI7A 2HP9A 1BULA 4FH2A 4QHCA 1K4EA 4XT2A 3A3FA 3UDFA 1BSGA 5KZHA 2J7VA 4K0XA 5FEFA 3LY4A 3G4PA 3GTCA 2ZM2A 3OBFA 3HLGA 1K56A 3M2KA 5EVIC 4Q0JA 1XX2A 1T1AA 2QHKA 3MQQA 1G6OA 2XLNA 3QP2A 4MN7A 2JE5A 3A3JA 3SH9A 5J3WA 3TW8A 3NHQA 3FZCA 5TBMB 3UN7A 1ES3A 4UQIS 4PAUA 4EBNA 3VE3A 3IX3A 4KZ4A 5DTKA 4IJGA 4JXGA 4M4XA 1PIOA 4QJGA 5FQJA 4E6XA 3E4PA 2IWDA 2PHYA 2PR5A 5HAQA 3MQOA 4QPRA 3R7WB 4HP9A 4P85A 3EEHA 4Z9QA 2HV1A 4K91A 3TJZC 4S2LA 3F1OA 4WZ5C 4ETXA 1IKIA 1KGEA 1ONHA 4RQ9A 3T4LA 3KSIA 4MLLA 1P9RA 4R4RA 2KOIA 3RFBA 1N9BA 5J7EA 5EECA 2H0TA 3T4JA 4KQOA 1P0ZA 1OJ5A 3IBJA 1K55A 4LRYC 4MMNA 1YMSA 5L8MA 2P74A 4KZ7A 3HJIA 4LENA 2XA7M 2BASA 2BLSA 2J3TD 2QZ6A 4G3WA 2XF3A 3JPUA 3SS3A 1FILA 3BFFA 2PYRA 4LV1A 2ZC5B 4K08A 4KUKA 1CEFA 4JKTA 4CLCB 4MEZA 4P6ZS 1IOUA 4U0XA 1SKOA 2YKFA 2W3DA 1H8ZA 3LEQA 3K3DA 3W8KA 2ZBBA 1VQQA 3ZNYA 4ZDXA 2FH5A 5KMWA 2PDRA 3ITBA 2JCHA 1OJGA 4PHTA 1KDWA 4UAAA 1ES2A 3BY8A 1WYCA 4ARZB 4PM5A 3T1QB 1JVJA 3MKFA 1N4OA 1KOUA 4ID4A 2C5WB 2W3HA 4H6JA 3OZHA 3KSHA 1BT5A 2EWVA 4I3IA 5M18A 3IF5A 3CHWP 1JWPA 3UB7A 2VV6A 1X0OA 4RX3A 2W1RA 2HL1A 3OOVA 4HOIA 3BFCA 1YLYA 1NYYA 3PXPA 4OLGA 4DRTA 4YINA 3VP4A 1NRJA 4DE0A 1CQAA 3C5AA 5EVID 4DXCA 4EESA 2R9WA 4B88A 3LMUA 2WAFA 4ZJ2A 5FAOA 5GHXA 4DJ3A 4JGPA 3ITAA 4MN6A 3TSGA 3F1NA 4ME4A 3C7VA 5EVIB 5E2FA 3QNCA 1QMFA 2EA9A 4RRAA 4GZBA 2Z2LB 4OVDA 3QP8A 3DTIA 4UQIM 4IBXA 2EFXA 2OWHA 4WMCD 3CZDA 5FQ9A 2XD5A 5E43A 3G32A 4P87A 4HH2A 1YPRA 1H5XA 5GL9A 2DBOA 3V3RA 2JKTM 3ZG7B 2LB9A 3CUEA 2Y55A 3BM6A 4GDBA 4X55A 1JWVA 1O7EA 1MWSA 2I72A 5CECA 4D2OA 3CMZA 5L2FA 3DTEA 3SH8A 3CPTA 4WLAA 3WWXA 1EI5A 2M1CA 2XRNA 2XR0A 1FCOA
chains in the Genus database with same CATH topology
4OPZA 4WEJA 1BLCA 1KE3A 3AGFA 1TDGA 3QNBA 1HTZA 3UE1A 2H10A 3N8LA 4NETA 4KZ6A 4P0MA 2J9PA 2WGVA 3N7WA 4X53A 5FQQA 1LLBA 1IYOA 3G2YA 4JXSA 3IWIA 1CK3A 1YLZA 1NZOA 3EQUA 2WKEA 2ZQ7A 5CHUA 3IXBA 1KVMA 4OOYA 1PI4A 4LV0A 3ZNTA 2WKIA 3SS5A 4QU3A 3W4OA 5EVIA 3V39A 4B4XA 5E2GA 2PU2A 1JTDA 2Y2LA 3VOYA 4BD0A 2OKVA 3ZCZA 3P98A 5CGXA 2ZC7A 3OC2A 4E3LA 3SOIA 3DWKA 1PI5A 1G6AA 3UPOA 4RX2A 3V50A 1EWZA 4E3JA 3GQZA 3MZEA 2H0YA 4PMAA 3VSKA 2JC7A 3KNFA 4RRIA 5A93A 3IXGA 3ZDJA 1IELA 2HDRA 1S0WA 3A3EA 3HBRA 5DTSA 5FQMA 5FQKA 4EV4A 4EWFA 5KSHA 4RRQA 3V5MA 5F1GA 3OCNA 3Q7VB 2ZQCA 3WS4A 3G31A 1C3BA 5TFQA 2RCXA 1L0EA 4JLFA 3KO7A 1K57C 2HDQA 1GCEA 4N9LA 2XFSA 4NBJA 1TEMA 3OPPA 4JF5A 1FCMA 1HZOA 4WZ4A 1L0FA 5EUAA 5GLAA 4RRHA 4KG5A 1Q2PA 2P9VB 2WGWA 1XPBA 3D4FA 3G30A 3OPLA 4IBRA 1MXOA 3DWZA 1XGJA 1E25A 5TR7A 2VGJA 5GHZA 1W8QA 2WK0A 3UPPA 5M1AA 2Y2NA 3M6BA 5DF7A 3VP3A 4RRDA 5FATA 2GDNA 1FCNA 3PBOA 5CHMA 4Q8IA 2WZXA 5I94A 5GLDA 4JF6A 5CEDA 4UA6A 5FI6A 4OPRA 3NDEA 3O87A 4N92A 4ZJ1A 4OKPA 5HFOA 2E8IA 4OQIA 2X01A 3E2LA 1H8YA 2Y59A 3AGDA 4O7DA 4E6WA 1DY6A 1ZG6A 2R9XA 4OP8A 1XXMA 1S6RA 4S0LA 4LCMA 4KZ9A 3WRZA 3IH8A 4EBLA 3WS0A 3KOCA 3LY3A 1RGYA 1NRFA 4WELA 1FSWA 4JBFA 3N6IA 3C4OA 1DJCA 4WZ5A 5F83A 1BUEA 5CGWA 4RYEA 5E2HA 1PWGA 2RL3A 4S0JA 3PBNA 2HL2A 1EROA 1I5QA 2HKZA 3NBLA 3HLFA 5F1FA 4X69A 5AQ7A 4MNRA 3HUOA 1FR6A 1CEGA 3FV7A 3LO7A 4S2PA 4Y0TA 4OPQA 1L2SA 3HLWA 1K25A 4YFMA 4JXVA 5EE8A 4DXBA 3IH9A 4R4SA 4PM9A 5HX9A 4RR9A 1ZKJA 1Y2QA 3KO4A 1W79A 4OQHA 3PBQA 4HESA 4IVKA 3UY6A 1MPLA 1E3UD 3VP1A 4R1GA 3PAGA 4GNUA 4RRJA 3VMAA 5BOHA 1PYYA 1YLJA 5CGSA 4QY6A 1KDSA 3KNPA 3Q7VA 4DF6A 5CEBA 3GR2A 5KSCA 1CI9A 5U47A 5FASA 2Y91A 3UDXA 4BD1A 5EOOA 4KQQA 4PPRA 2PBYA 3O86A 3A3IA 3UE3A 3JYIA 3CJMA 4KG2A 2WGIA 4S2NC 1IEMA 4R3JA 2X71A 2P9VA 3IXDA 4QY5A 2ZQDA 3RXXA 2IWCA 3IF6A 2X02A 2XH9A 4BJPA 4E3NA 1IYSA 4WYYA 3MZFA 3IXHA 3C7UA 2XQZA 2ZMAA 1DJBA 3LMVA 1ES5A 3IHAA 3BRMA 4PM8A 4U0TA 4RRFA 4KZ8A 1GA0A 4BL3A 1YLTA 1PW8A 3VSLA 1E4DA 5FI7A 3VFFA 2HP9A 1BULA 3PD3A 4FH2A 4Y0OA 3RXWA 3TOIA 3G35A 4QHCA 1K4EA 4KZ5A 3A3FA 3UDFA 1BSGA 1K6RA 1YLWA 5KZHA 2J7VA 1JWZA 2Y2OA 4K0XA 3OPHA 4UHUA 4RA7A 1M40A 1YM1A 3LY4A 1AXBA 3G4PA 3GTCA 1IYPA 1PW1A 3MXRA 2ZM2A 2HDUA 3S22A 3PD5A 1LL5A 3FKVA 4MBFA 2ZC3B 4FH4A 4OPYA 4RRLA 4OQGA 3IHBA 1FCOA 3HLGA 4DE1A 1K56A 3M2KA 3ISGA 5EVIC 4CPKA 3GRJA 4UA7A 1XX2A 4DE2A 2C6WB 3HLCA 5FAPA 5M19A 4H8RA 4FCFA 2WZZA 3HLEA 3Q7ZA 2XLNA 3GVBA 1BLSA 1MWRA 4S0KA 2DRWA 3PD2A 2ZM8A 4JF4A 4LV3A 4MBKA 2JE5A 3A3JA 1DJAA 1RCJA 1I2SA 2XD1A 4JXWA 3HL9A 4KZ3A 5CTNA 3SH9A 4KZAA 3GSGA 4S2MA 3NI9A 2ZC6B 1LHYA 2FFFB 1BZAA 3ZFZA 3HREA 2HP5A 4X68A 2J8YA 3C4PA 1TDLA 2G2WA 4S02A 3FZCA 4K0WA 3UN7A 2XDMA 1ES3A 1PZOA 2Y2PA 3IF6B 3Q1FA 3KO3A 1RP5A 2HP6A 3HLBA 4EBNA 2UWXA 3MFDA 3ZVWA 1CI8A 2ZM0A 2ZQ8A 3BLMA 4A5RA 1Y54A 4IVIA 4KZ4A 5DTKA 1PWCA 2HPBA 4ZAMA 5E2EA 1E3UA 5EPHA 3IWQA 5CTMA 3MZDA 4JXGA 3VFHA 1PIOA 4QJGA 2B5RA 1NJ4A 5DTTA 3WS5A 5FQJA 3HUNA 1K56D 4E6XA 1WYBA 1LI0A 2IWDA 1ERQA 5A90A 2WYXA 3O88A 3UDIA 4E3IA 2V1ZA 3TG9A 3WRTA 3RJUA 3ZHHA 1ES4A 5HAQA 3BFGA 3G34A 1MWUA 1NY0A 1JKEA 1ESUA 2WUQA 4FD8A 4P85A 4Z9QA 2Y2KA 3BEBA 2Q9MA 4Y7PA 3I7JA 4K91A 3ZG9B 4S2LA 3IQAA 1PZPA 3VP2A 4BENA 1ESIA 3HLDA 1MBLA 3LCEA 1QMEA 4WZ5C 4RR6A 1IKIA 1KGEA 1ONHA 3B3XA 3KODA 1SCWA 3OCLA 4KG6A 4S0IA 2QPNA 2Y4AA 4MLLA 5JYOA 4S2KA 3M2JA 4R4RA 1W7FA 1K6SA 3LEZA 2IWBA 1N9BA 5FI2A 2Y2GA 1ONGA 5EECA 2EXAA 2WKHA 1KE4A 2A49A 2H0TA 3W4PA 4KQOA 3SH7A 3G2ZA 1TC5A 4DKIA 3ZG0A 5HW3A 1K55A 3KO9A 1MY8A 3MBZA 5TGFA 4X6TA 3NIAA 1YMSA 5FDHA 2P74A 4KZ7A 4BL2A 2DCFA 4LENA 4DE3A 3SS4A 1J9MA 1K54A 1J7GA 4OOMA 1ERMA 5FA7A 4RRRA 2BLSA 2QZ6A 2XF3A 2EFUA 5DF8A 4E3MA 3SS3A 5HL1A 1ZG4A 3N4IA 4F94A 3BFFA 4EBPA 3NCKA 3QHYA 4RVAA 3W4QA 3ZGAB 2Q9NA 4LV1A 3IF6C 2ZC5B 4S2JA 3IWOA 1GHPA 2BG1A 5CHJA 3PBRA 1CEFA 3N8SA 4CJNA 4JKTA 5HARA 2PU4A 4MEZA 4DDYA 4BQMA 1BTLA 3A3DA 4KQRA 3S4XA 5GHYA 1HD8A 3DW0A 3Q82A 2ZLYA 4U0XA 2G2UA 2OLUA 5CXWA 2XK1A 2EX9A 3O3VA 3UNWA 4E3OA 1FOFA 2EX6A 4IEDA 4GN2A 3FWLA 1SHVA 5D3OA 1XP4A 3P09A 1FSYA 1H8ZA 3PAEA 5HAPA 2J9OA 2ZQAA 3ZVTA 4MBHA 5IHVA 3BFDA 3LMTA 3EQVA 4U3TA 3W8KA 5DF9A 4GB7A 4RRKA 4C75A 4WBGA 1KE0A 3Q81A 4R0QA 1VQQA 3ZNYA 4RRGA 3AGEA 4ZDXA 4N9KA 5KMWA 1Q2QA 3ITBA 4DDSA 2JCHA 4N1XA 3PBTA 1K38A 4GD8A 3CG5A 3E2KA 4XUXA 4KENB 1XKZA 2A3UA 3VP0A 1U60A 1OMEA 1KDWA 4UAAA 1BLHA 1ES2A 4XUZA 1WYCA 5A92A 4GDNA 3PD4A 3BLSA 4PM5A 1Z6FA 2EXBA 1JVJA 3MKFA 1N4OA 5EOEA 3S1YA 5FAQA 4RR7A 4R3BA 5J8XA 4ID4A 2C5WB 1W5DA 2HDSA 3MXSA 4C3QA 2XR0A 1BLPA 3OZHA 1IKGA 1MWTA 3KOBA 3UPNA 1BT5A 2ZD8A 3NY4A 4PM7A 3WS1A 1ALQA 4FSFA 1YLPA 5M18A 1XA1A 4OP5A 2DNSA 3BYDA 4OH0A 4C6YA 3IF5A 3UE0A 2Y2HA 1JWPA 4ZTKA 1K57A 1GA9A 3ZG8B 1NYMA 1WE4A 3GV9A 4HBUA 1SDNA 5AQAA 4RX3A 2HL1A 5AQBA 2QMIA 2WADA 3OPRA 1NXYA 2XGNA 4OQ0A 5G18A 1K4FA 2EX8A 4WEKA 4PM6A 3Q07A 3BFCA 3FYZA 2OSUA 1YLYA 1NYYA 2OLVA 2JBFA 4WMCA 5EVLA 1TVFA 4OLGA 4GKUA 1PWDA 4DRTA 4QB8A 4YINA 2Y2IA 2OV5A 4S2IA 3VP4A 4NK3A 1LL9A 3DTMA 2WAEA 2ZC4B 4DE0A 4JPMA 1KVLA 1M6KA 4RR8A 2Z2MB 3C5AA 3NDGA 3BECA 4X56A 2XEPA 5EVID 4DXCA 5HAIA 4LV2A 1KGFA 4OLDA 3N8RA 2R9WA 1VM1A 4ZJ3A 4B88A 4B4ZA 3LMUA 2WAFA 1JTGA 4HBTA 1SDEA 1SKFA 4ZJ2A 3ZG5A 2V20A 4RRCA 2FFYA 5FAOA 5GHXA 5FQIA 3ITAA 4QD4A 2Y2MA 3TSGA 1L0GA 5A91A 5EVIB 3C7VA 3UO9A 1I2WA 5E2FA 1YMXA 5GLBA 3NC8A 1NZUA 5J61A 3QNCA 4WM9A 1QMFA 2ZQ9A 4RRAA 4GZBA 2V2FF 2Z2LB 3BFEA 3PTEA 4OVDA 2HL0A 1RGZA 4GOGA 5CRFA 4BLMA 4M3KA 5GLCA 4IBXA 4GD6A 4ZBEA 2EFXA 2H5SA 4EQIA 4LCLA 3CZDA 4WMCD 5FQ9A 2EX2A 1L0DA 1GHIA 1XGIA 3FKWA 1K55C 2XD5A 5E43A 5CERA 3PBSA 3G32A 4P87A 1G68A 4Y0UA 4EUZA 3GMWA 1YQSA 1XA7A 1H5XA 2Y2QA 5GL9A 1GHMA 5DVAA 1K54C 2DBOA 3V3RA 4L0LA 5AQ9A 1HVBA 4OONA 4RRBA 5FSRA 4S2NA 3ZG7B 4KZBA 1MKIA 2XFTA 3IT9A 3HVFA 2Y2JA 2Y55A 3BM6A 1KGGA 4N1HA 4XXRA 2WGWB 1ZC2A 3HUMA 4GDBA 4X55A 3WS2A 1O07A 1JWVA 1O7EA 1MWSA 2I72A 2CC1A 1FQGA 3MKEA 5CECA 3KO5A 4UA9A 4S03A 4D2OA 3CMZA 4OOLA 5F82A 1YT4A 5L2FA 4RRMA 3M6HA 4P6BA 3V3SA 4R23A 3SH8A 5JYPA 4E3KA 4S2OA 1FR1A 3VOZA 1LI9A 3WWXA 2ZJ9A 1EI5A 2VGKA 4HEFA 4NBIA 1IYQA 1W8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPZ A;  4WEJ A;  1BLC A;  1KE3 A;  3AGF A;  1TDG A;  3QNB A;  1HTZ A;  3UE1 A;  2H10 A;  3N8L A;  4NET A;  4KZ6 A;  4P0M A;  2J9P A;  2WGV A;  3N7W A;  4X53 A;  5FQQ A;  1LLB A;  1IYO A;  3G2Y A;  4JXS A;  3IWI A;  1CK3 A;  1YLZ A;  1NZO A;  3EQU A;  2WKE A;  2ZQ7 A;  5CHU A;  3IXB A;  1KVM A;  4OOY A;  1PI4 A;  4LV0 A;  3ZNT A;  2WKI A;  3SS5 A;  4QU3 A;  3W4O A;  5EVI A;  3V39 A;  4B4X A;  5E2G A;  2PU2 A;  1JTD A;  2Y2L A;  3VOY A;  4BD0 A;  3ZCZ A;  3P98 A;  5CGX A;  2ZC7 A;  3OC2 A;  4E3L A;  3SOI A;  3DWK A;  1PI5 A;  1G6A A;  3UPO A;  4RX2 A;  3V50 A;  1EWZ A;  4E3J A;  3GQZ A;  3MZE A;  2H0Y A;  4PMA A;  3VSK A;  2JC7 A;  5A93 A;  3IXG A;  3ZDJ A;  1IEL A;  2HDR A;  1S0W A;  3A3E A;  3HBR A;  5DTS A;  5FQM A;  5FQK A;  4EV4 A;  4EWF A;  5KSH A;  3V5M A;  5F1G A;  3OCN A;  3Q7V B;  2ZQC A;  3WS4 A;  3G31 A;  1C3B A;  5TFQ A;  2RCX A;  1L0E A;  4JLF A;  1K57 C;  2HDQ A;  1GCE A;  4N9L A;  2XFS A;  1TEM A;  3OPP A;  4JF5 A;  1FCM A;  1HZO A;  4WZ4 A;  1L0F A;  5EUA A;  5GLA A;  4KG5 A;  1Q2P A;  2P9V B;  2WGW A;  1XPB A;  3D4F A;  3G30 A;  3OPL A;  4IBR A;  1MXO A;  3DWZ A;  1XGJ A;  1E25 A;  5TR7 A;  2VGJ A;  5GHZ A;  1W8Q A;  2WK0 A;  3UPP A;  5M1A A;  2Y2N A;  3M6B A;  5DF7 A;  3VP3 A;  5FAT A;  2GDN A;  1FCN A;  3PBO A;  5CHM A;  4Q8I A;  2WZX A;  5I94 A;  5GLD A;  4JF6 A;  5CED A;  4UA6 A;  5FI6 A;  4OPR A;  3NDE A;  3O87 A;  4N92 A;  4ZJ1 A;  4OKP A;  5HFO A;  2E8I A;  4OQI A;  2X01 A;  3E2L A;  1H8Y A;  2Y59 A;  3AGD A;  4O7D A;  4E6W A;  1DY6 A;  1ZG6 A;  2R9X A;  4OP8 A;  1XXM A;  1S6R A;  4LCM A;  4KZ9 A;  3WRZ A;  3IH8 A;  4EBL A;  3WS0 A;  3LY3 A;  1RGY A;  1NRF A;  4WEL A;  1FSW A;  4JBF A;  3N6I A;  3C4O A;  1DJC A;  4WZ5 A;  5F83 A;  1BUE A;  5CGW A;  4RYE A;  5E2H A;  1PWG A;  2RL3 A;  3PBN A;  1ERO A;  1I5Q A;  3NBL A;  3HLF A;  5F1F A;  4X69 A;  5AQ7 A;  4MNR A;  3HUO A;  1FR6 A;  1CEG A;  3FV7 A;  3LO7 A;  4S2P A;  4Y0T A;  4OPQ A;  1L2S A;  3HLW A;  1K25 A;  4YFM A;  4JXV A;  5EE8 A;  4DXB A;  3IH9 A;  4R4S A;  4PM9 A;  5HX9 A;  1ZKJ A;  1W79 A;  4OQH A;  3PBQ A;  4HES A;  4IVK A;  3UY6 A;  1MPL A;  1E3U D;  3VP1 A;  4R1G A;  3PAG A;  4GNU A;  3VMA A;  5BOH A;  1PYY A;  1YLJ A;  5CGS A;  4QY6 A;  1KDS A;  3Q7V A;  4DF6 A;  5CEB A;  3GR2 A;  5KSC A;  1CI9 A;  5U47 A;  5FAS A;  2Y91 A;  3UDX A;  4BD1 A;  5EOO A;  4KQQ A;  4PPR A;  2PBY A;  3O86 A;  3A3I A;  3UE3 A;  3JYI A;  3CJM A;  4KG2 A;  2WGI A;  4S2N C;  1IEM A;  4R3J A;  2X71 A;  2P9V A;  3IXD A;  4QY5 A;  2ZQD A;  3RXX A;  2IWC A;  3IF6 A;  2X02 A;  2XH9 A;  4BJP A;  4E3N A;  1IYS A;  4WYY A;  3MZF A;  3IXH A;  3C7U A;  2XQZ A;  2ZMA A;  1DJB A;  1ES5 A;  3IHA A;  3BRM A;  4PM8 A;  4U0T A;  4KZ8 A;  1GA0 A;  4BL3 A;  1YLT A;  1PW8 A;  3VSL A;  1E4D A;  5FI7 A;  3VFF A;  2HP9 A;  1BUL A;  4FH2 A;  4Y0O A;  3RXW A;  3TOI A;  3G35 A;  4QHC A;  1K4E A;  4KZ5 A;  3A3F A;  3UDF A;  1BSG A;  1K6R A;  1YLW A;  5KZH A;  2J7V A;  1JWZ A;  2Y2O A;  4K0X A;  3OPH A;  4UHU A;  4RA7 A;  1M40 A;  1YM1 A;  3LY4 A;  1AXB A;  3G4P A;  3GTC A;  1IYP A;  1PW1 A;  3MXR A;  2ZM2 A;  2HDU A;  3S22 A;  1LL5 A;  3FKV A;  4MBF A;  2ZC3 B;  4FH4 A;  4OPY A;  4OQG A;  3IHB A;  1FCO A;  3HLG A;  4DE1 A;  1K56 A;  3M2K A;  3ISG A;  5EVI C;  4CPK A;  3GRJ A;  4UA7 A;  1XX2 A;  4DE2 A;  2C6W B;  3HLC A;  5FAP A;  5M19 A;  4H8R A;  4FCF A;  2WZZ A;  3HLE A;  3Q7Z A;  2XLN A;  3GVB A;  1BLS A;  1MWR A;  2DRW A;  2ZM8 A;  4JF4 A;  4LV3 A;  4MBK A;  2JE5 A;  3A3J A;  1DJA A;  1RCJ A;  1I2S A;  2XD1 A;  4JXW A;  3HL9 A;  4KZ3 A;  5CTN A;  3SH9 A;  4KZA A;  3GSG A;  4S2M A;  3NI9 A;  2ZC6 B;  1LHY A;  2FFF B;  1BZA A;  3ZFZ A;  3HRE A;  2HP5 A;  4X68 A;  2J8Y A;  3C4P A;  1TDL A;  2G2W A;  3FZC A;  4K0W A;  3UN7 A;  2XDM A;  1ES3 A;  1PZO A;  2Y2P A;  3IF6 B;  3Q1F A;  1RP5 A;  2HP6 A;  3HLB A;  4EBN A;  2UWX A;  3MFD A;  3ZVW A;  1CI8 A;  2ZM0 A;  2ZQ8 A;  3BLM A;  4A5R A;  1Y54 A;  4IVI A;  4KZ4 A;  5DTK A;  1PWC A;  2HPB A;  4ZAM A;  5E2E A;  1E3U A;  5EPH A;  3IWQ A;  5CTM A;  3MZD A;  4JXG A;  3VFH A;  1PIO A;  4QJG A;  2B5R A;  1NJ4 A;  5DTT A;  3WS5 A;  5FQJ A;  3HUN A;  1K56 D;  4E6X A;  1WYB A;  1LI0 A;  2IWD A;  1ERQ A;  5A90 A;  2WYX A;  3O88 A;  3UDI A;  4E3I A;  2V1Z A;  3TG9 A;  3WRT A;  3RJU A;  3ZHH A;  1ES4 A;  5HAQ A;  3BFG A;  3G34 A;  1MWU A;  1NY0 A;  1ESU A;  2WUQ A;  4FD8 A;  4P85 A;  4Z9Q A;  2Y2K A;  3BEB A;  2Q9M A;  4Y7P A;  3I7J A;  4K91 A;  3ZG9 B;  4S2L A;  3IQA A;  1PZP A;  3VP2 A;  4BEN A;  1ESI A;  3HLD A;  1MBL A;  3LCE A;  1QME A;  4WZ5 C;  1IKI A;  1KGE A;  1ONH A;  3B3X A;  1SCW A;  3OCL A;  4KG6 A;  2QPN A;  2Y4A A;  4MLL A;  5JYO A;  4S2K A;  3M2J A;  4R4R A;  1W7F A;  1K6S A;  3LEZ A;  2IWB A;  1N9B A;  5FI2 A;  2Y2G A;  1ONG A;  5EEC A;  2EXA A;  2WKH A;  1KE4 A;  2A49 A;  2H0T A;  3W4P A;  4KQO A;  3SH7 A;  3G2Z A;  4DKI A;  3ZG0 A;  5HW3 A;  1K55 A;  1MY8 A;  3MBZ A;  5TGF A;  4X6T A;  3NIA A;  1YMS A;  5FDH A;  2P74 A;  4KZ7 A;  4BL2 A;  2DCF A;  4LEN A;  4DE3 A;  3SS4 A;  1J9M A;  1K54 A;  4OOM A;  1ERM A;  5FA7 A;  2BLS A;  2QZ6 A;  2XF3 A;  2EFU A;  5DF8 A;  4E3M A;  3SS3 A;  5HL1 A;  1ZG4 A;  3N4I A;  4F94 A;  3BFF A;  4EBP A;  3NCK A;  3QHY A;  4RVA A;  3W4Q A;  3ZGA B;  2Q9N A;  4LV1 A;  3IF6 C;  2ZC5 B;  4S2J A;  3IWO A;  1GHP A;  2BG1 A;  5CHJ A;  3PBR A;  1CEF A;  3N8S A;  4CJN A;  4JKT A;  5HAR A;  2PU4 A;  4MEZ A;  4DDY A;  4BQM A;  1BTL A;  3A3D A;  4KQR A;  3S4X A;  5GHY A;  1HD8 A;  3DW0 A;  3Q82 A;  2ZLY A;  4U0X A;  2G2U A;  2OLU A;  5CXW A;  2XK1 A;  2EX9 A;  3O3V A;  3UNW A;  4E3O A;  1FOF A;  2EX6 A;  4IED A;  4GN2 A;  3FWL A;  1SHV A;  5D3O A;  1XP4 A;  3P09 A;  1FSY A;  1H8Z A;  3PAE A;  5HAP A;  2J9O A;  2ZQA A;  3ZVT A;  4MBH A;  5IHV A;  3BFD A;  3EQV A;  4U3T A;  3W8K A;  5DF9 A;  4GB7 A;  4C75 A;  4WBG A;  1KE0 A;  3Q81 A;  4R0Q A;  1VQQ A;  3ZNY A;  3AGE A;  4ZDX A;  4N9K A;  5KMW A;  1Q2Q A;  3ITB A;  4DDS A;  2JCH A;  4N1X A;  3PBT A;  1K38 A;  4GD8 A;  3CG5 A;  3E2K A;  4XUX A;  4KEN B;  1XKZ A;  2A3U A;  3VP0 A;  1U60 A;  1OME A;  1KDW A;  4UAA A;  1BLH A;  1ES2 A;  4XUZ A;  1WYC A;  5A92 A;  4GDN A;  3BLS A;  4PM5 A;  1Z6F A;  2EXB A;  1JVJ A;  3MKF A;  1N4O A;  5EOE A;  3S1Y A;  5FAQ A;  4R3B A;  5J8X A;  4ID4 A;  2C5W B;  1W5D A;  2HDS A;  3MXS A;  4C3Q A;  2XR0 A;  1BLP A;  3OZH A;  1IKG A;  1MWT A;  3UPN A;  1BT5 A;  2ZD8 A;  3NY4 A;  4PM7 A;  3WS1 A;  1ALQ A;  4FSF A;  1YLP A;  5M18 A;  1XA1 A;  4OP5 A;  2DNS A;  3BYD A;  4OH0 A;  4C6Y A;  3IF5 A;  3UE0 A;  2Y2H A;  1JWP A;  4ZTK A;  1K57 A;  1GA9 A;  3ZG8 B;  1NYM A;  1WE4 A;  3GV9 A;  4HBU A;  1SDN A;  5AQA A;  4RX3 A;  5AQB A;  2QMI A;  2WAD A;  3OPR A;  1NXY A;  2XGN A;  4OQ0 A;  5G18 A;  1K4F A;  2EX8 A;  4WEK A;  4PM6 A;  3Q07 A;  3BFC A;  3FYZ A;  2OSU A;  1YLY A;  1NYY A;  2OLV A;  2JBF A;  4WMC A;  5EVL A;  1TVF A;  4OLG A;  4GKU A;  1PWD A;  4DRT A;  4QB8 A;  4YIN A;  2Y2I A;  2OV5 A;  4S2I A;  3VP4 A;  4NK3 A;  1LL9 A;  3DTM A;  2WAE A;  2ZC4 B;  4DE0 A;  4JPM A;  1KVL A;  1M6K A;  2Z2M B;  3C5A A;  3NDG A;  3BEC A;  4X56 A;  2XEP A;  5EVI D;  4DXC A;  5HAI A;  4LV2 A;  1KGF A;  4OLD A;  3N8R A;  2R9W A;  1VM1 A;  4ZJ3 A;  4B88 A;  4B4Z A;  2WAF A;  1JTG A;  4HBT A;  1SDE A;  1SKF A;  4ZJ2 A;  3ZG5 A;  2V20 A;  2FFY A;  5FAO A;  5GHX A;  5FQI A;  3ITA A;  4QD4 A;  2Y2M A;  3TSG A;  1L0G A;  5A91 A;  5EVI B;  3C7V A;  3UO9 A;  1I2W A;  5E2F A;  1YMX A;  5GLB A;  3NC8 A;  1NZU A;  3QNC A;  4WM9 A;  1QMF A;  2ZQ9 A;  4GZB A;  2V2F F;  2Z2L B;  3BFE A;  3PTE A;  4OVD A;  1RGZ A;  4GOG A;  5CRF A;  4BLM A;  4M3K A;  5GLC A;  4IBX A;  4GD6 A;  4ZBE A;  2EFX A;  2H5S A;  4EQI A;  4LCL A;  3CZD A;  4WMC D;  5FQ9 A;  2EX2 A;  1L0D A;  1GHI A;  1XGI A;  3FKW A;  1K55 C;  2XD5 A;  5E43 A;  5CER A;  3PBS A;  3G32 A;  4P87 A;  1G68 A;  4Y0U A;  4EUZ A;  3GMW A;  1YQS A;  1XA7 A;  1H5X A;  2Y2Q A;  5GL9 A;  1GHM A;  5DVA A;  1K54 C;  3V3R A;  4L0L A;  5AQ9 A;  1HVB A;  4OON A;  5FSR A;  4S2N A;  3ZG7 B;  4KZB A;  1MKI A;  2XFT A;  3IT9 A;  3HVF A;  2Y2J A;  2Y55 A;  3BM6 A;  1KGG A;  4N1H A;  4XXR A;  2WGW B;  1ZC2 A;  3HUM A;  4GDB A;  4X55 A;  3WS2 A;  1O07 A;  1JWV A;  1O7E A;  1MWS A;  2I72 A;  2CC1 A;  1FQG A;  3MKE A;  5CEC A;  4UA9 A;  4D2O A;  3CMZ A;  4OOL A;  5F82 A;  1YT4 A;  5L2F A;  3M6H A;  4P6B A;  3V3S A;  4R23 A;  3SH8 A;  5JYP A;  4E3K A;  4S2O A;  1FR1 A;  3VOZ A;  1LI9 A;  3WWX A;  2ZJ9 A;  1EI5 A;  2VGK A;  4HEF A;  1IYQ A;  1W8Y A; 
#chains in the Genus database with same CATH topology
 3C8C A;  1TDG A;  3QNB A;  1HTZ A;  4NXB A;  3UE1 A;  2PR6 A;  3UB5 P;  3U2A A;  4P0M A;  1LLB A;  3G2Y A;  1PI4 A;  4LV0 A;  4QU3 A;  2Y2L A;  2V8F A;  1OTD A;  5CGX A;  3SZT A;  5DJU A;  3UPO A;  4E3J A;  3VSK A;  3KNF A;  3IXG A;  3O5Y A;  1S0W A;  3MFX A;  5FQK A;  4Q0H A;  1ZHH B;  4EV4 A;  4EWF A;  5CX7 A;  5IT5 A;  4EER A;  1C3B A;  2RCX A;  3KO7 A;  1K57 C;  4P6Z M;  3OPP A;  1HZO A;  1YSP A;  1L0F A;  3LI8 A;  4RRH A;  4MN5 A;  4Y15 A;  1Q2P A;  2VKS A;  1F98 A;  2WGW A;  2M7U A;  1XGJ A;  3H7W A;  5GHZ A;  2O9B A;  1W8Q A;  2JKT I;  2IA2 A;  2Y2N A;  4RRD A;  5FAT A;  1XJ6 A;  4Q8I A;  3NEC A;  2LB5 A;  3NDE A;  3QP5 A;  4ZJ1 A;  4OQI A;  2X01 A;  1CJF A;  3AGD A;  4E6W A;  1W63 M;  2ZL1 A;  3WS0 A;  3LY3 A;  4WEL A;  3C4O A;  4GLQ A;  4S0J A;  2RL3 A;  1ERO A;  1LL8 A;  5F1F A;  5AQ7 A;  1CEG A;  5EM0 A;  4S2P A;  4Y0T A;  4OPQ A;  2QJ5 A;  1K25 A;  5HX9 A;  4RR9 A;  1W79 A;  3MR0 A;  3BWL A;  2EWW A;  3PAG A;  5BOH A;  4GS9 A;  4QY6 A;  3E4Q A;  2PT7 A;  5HDS A;  2XRO A;  1UGU A;  3GR2 A;  4L9F A;  5KSC A;  1CI9 A;  2Y79 A;  4BD1 A;  5HDD A;  2PBY A;  3A3I A;  2P7J A;  3CJM A;  4KQD A;  4F3L A;  2X71 A;  3EGX C;  2P9V A;  3IXD A;  2IWC A;  2ZOH A;  1EW0 A;  3C38 A;  1DJB A;  4RRF A;  4PM8 A;  2HF6 A;  1OT6 A;  1TS6 A;  4Y0O A;  3G35 A;  4KZ5 A;  4YWZ A;  4DJ2 A;  5DFX A;  3OPH A;  3P7N A;  4RA7 A;  1M40 A;  1IYP A;  3MXR A;  1LL5 A;  4MBF A;  2ZC3 B;  4OPY A;  4RRL A;  2B95 A;  1A0K A;  1ZTU A;  2HJE A;  4DE2 A;  2C6W B;  2UV0 E;  5FAP A;  5M19 A;  1P9W A;  4FCF A;  5IS1 A;  4Y3I A;  4S0K A;  3CWF A;  1RCJ A;  4EU0 A;  4KZ3 A;  5CTN A;  5C5K A;  2YKH A;  1DP6 A;  4S2M A;  2HP5 A;  2J8Y A;  4LGW A;  4S02 A;  2VA0 A;  2XDM A;  1PZO A;  2Y2P A;  3HLB A;  1T19 A;  1D7E A;  3H9W A;  3MFD A;  3ZVW A;  3IS2 A;  3IX8 A;  1PWC A;  1E3U A;  3F1P A;  2JKR M;  3RTY A;  3T4O A;  5DTT A;  3HUN A;  3MQ0 A;  1LI0 A;  1ERQ A;  5EV0 A;  4KUO A;  4E3I A;  3RJU A;  3G34 A;  1JKE A;  1ESU A;  2WUQ A;  1GSX A;  2Y2K A;  3BEB A;  3QP4 A;  2OAQ 1;  3I7J A;  3ZG9 B;  5HZH A;  1S67 L;  3VP2 A;  1MBL A;  3LCE A;  1QME A;  3KOD A;  5G4Z A;  4KG6 A;  2Y4A A;  3B33 A;  3T1R A;  1ACF A;  2OWJ A;  5AVF A;  4S2K A;  3M2J A;  3LEZ A;  2IWB A;  1ONG A;  2WKH A;  2A49 A;  5EVE A;  3G2Z A;  3VOL A;  1MY8 A;  2HZ5 A;  1H3Q A;  5FDH A;  2K31 A;  1TS0 A;  3VV4 A;  1K54 A;  1PFL A;  4OOM A;  1J7G A;  2W3E A;  2OAP 1;  2JN7 A;  3G6O A;  3QHY A;  4RVA A;  3IF6 C;  4GHI A;  1TD5 A;  3IWO A;  3T4K A;  4HJ3 A;  4WN5 A;  5CHJ A;  3PBR A;  3LR0 A;  3DTK A;  4HY8 A;  2PU4 A;  4DDY A;  2W0N A;  3A3D A;  4KQR A;  3E0Y A;  3FPV A;  2OLU A;  2EX9 A;  3OLO A;  3UNW A;  4IED A;  4GN2 A;  4FTX A;  3EGD C;  1XP4 A;  3ZVT A;  3EQV A;  3GDI A;  1KE0 A;  3Q81 A;  1VB6 A;  1UWN X;  3D9Y A;  3PBT A;  2J80 A;  3PR6 A;  4GD8 A;  3E2K A;  3VP0 A;  1U60 A;  4XUZ A;  5A8B A;  4GDN A;  3PD4 A;  5HWW A;  1Z6F A;  4RR7 A;  5EOE A;  1MZU A;  3V67 A;  1W5D A;  2HDS A;  4C3Q A;  3VE4 A;  1BLP A;  4Z1W A;  1N9N A;  3NY4 A;  1SZV A;  3WS1 A;  4FSF A;  1YLP A;  3UMD A;  3MMH A;  4ZTK A;  3ZG8 B;  1D1J A;  2WAD A;  3LYX A;  3UB9 A;  1NXY A;  1K4F A;  4BBU A;  3FYZ A;  4WMC A;  2D01 A;  3S7P A;  1T1C A;  4EUV A;  3DTM A;  2WAE A;  2ZC4 B;  4JPM A;  4R38 A;  1VET A;  3H82 A;  4LV2 A;  1JTG A;  2FZ0 A;  2W3G A;  2DMW A;  3ZG5 A;  3NOT C;  4JGR A;  4RRC A;  2FFY A;  3MJQ A;  2Y2M A;  1YSQ A;  3UO9 A;  5EM1 A;  4O8G A;  1NZU A;  1OPX A;  5HDC A;  2HL0 A;  3PTE A;  4BLM A;  4M3K A;  5GLC A;  2INW A;  3E4O A;  4EQI A;  5HWV A;  4ETZ A;  3A0V A;  5DKK A;  2EX2 A;  1CF0 A;  1XGI A;  3FKW A;  1K55 C;  4CLC D;  3KYQ A;  1GHM A;  4L0L A;  5AQ9 A;  2JKF A;  4RRB A;  4KZB A;  3HJK A;  3HVF A;  2Y2J A;  1KGG A;  4XXR A;  2VX8 A;  3WS2 A;  1VHM A;  3D72 A;  3KYE A;  3MKE A;  5F82 A;  1PRQ A;  1NLZ A;  5AVE A;  1P97 A;  3T12 B;  3N7W A;  4X53 A;  5FQQ A;  4JXS A;  3IWI A;  1CK3 A;  4D60 A;  2WKE A;  3ZNT A;  2WKI A;  3W4O A;  3V39 A;  1JTD A;  3VOY A;  4BD0 A;  2OKV A;  3ZCZ A;  2A2L A;  5L10 A;  2ZC7 A;  2QWS A;  4RX2 A;  2O9C A;  1OT9 A;  2A24 A;  1IEL A;  3A3E A;  3HBR A;  4RRQ A;  1HLU P;  1WA9 A;  3Q7V B;  3G31 A;  1L0E A;  4JLF A;  1NWZ A;  4N9L A;  2XFS A;  4WZ4 A;  1Y28 A;  2V1B A;  3PYP A;  1XPB A;  3G30 A;  3OPL A;  1MXO A;  3DWZ A;  1E25 A;  2Y8H A;  2WK0 A;  4CQH A;  1N9L A;  3M6B A;  5DF7 A;  4ESP A;  2GDN A;  1FCN A;  5CHM A;  2WZX A;  3U4L P;  4JF6 A;  4UA6 A;  5FI6 A;  3BQA A;  4CLC E;  3O87 A;  4OKP A;  4XT2 B;  5HFO A;  3E2L A;  1H8Y A;  2Y59 A;  4HJ4 A;  1ZG6 A;  4KZ9 A;  3WRZ A;  3IH8 A;  3KOC A;  1RGY A;  1FSW A;  4Q0I A;  5CGW A;  2HL2 A;  3HLF A;  1DP9 A;  4MNR A;  3LO7 A;  1H8M A;  3HLW A;  1STZ A;  3IH9 A;  4R4S A;  1ZKJ A;  1Y2Q A;  3KO4 A;  3PBQ A;  4PKY G;  4GNU A;  5HSQ A;  4DF6 A;  5CEB A;  5U47 A;  3UDX A;  3T4S A;  5EOO A;  4KQQ A;  4PPR A;  5AJG A;  2W1T A;  3CUE C;  2P04 A;  4QY5 A;  3RXX A;  2X02 A;  1YAX A;  4E3N A;  1IYS A;  4WYY A;  2ZMA A;  1ES5 A;  4U0T A;  2VEA A;  1GA0 A;  3MXQ A;  2Q0O A;  4X1L A;  2QKP A;  3PD3 A;  2K7S A;  3RXW A;  3PHY A;  1K6R A;  1JWZ A;  4UHU A;  3B47 A;  1YM1 A;  3F1O B;  1VEU A;  5DKL A;  2HDU A;  4NKP A;  4O0P A;  3FKV A;  3ICY A;  4OQG A;  3IHB A;  4DE1 A;  3ISG A;  3GRJ A;  4UA7 A;  4H8R A;  2WZZ A;  3HLE A;  3Q7Z A;  3GVB A;  1BLS A;  1MWR A;  2DRW A;  3PD2 A;  2ZM8 A;  4JF4 A;  4LV3 A;  1MC0 A;  1DJA A;  1I2S A;  3LFV A;  3HL9 A;  3NI9 A;  2GJ3 A;  2ZC6 B;  1LHY A;  4LRX C;  3ZFZ A;  4X68 A;  1TDL A;  1DP8 A;  4K0W A;  3Q1F A;  3KO3 A;  1RP5 A;  2HP6 A;  1AWI A;  2ZQ8 A;  3BLM A;  1Y54 A;  2HPB A;  5HPF A;  5EPH A;  4I38 A;  5CTM A;  3MZD A;  4WUJ A;  3KX0 X;  1NJ4 A;  3LIA A;  3WS5 A;  2CMN A;  5FDS A;  2BTF P;  2P08 A;  5A90 A;  2WYX A;  3UDI A;  5IU1 A;  2V1Z A;  1ES4 A;  1MWU A;  3QP1 A;  1NY0 A;  4FD8 A;  2Q9M A;  4Y7P A;  3DAV A;  2Z6C A;  4BEN A;  2PBD P;  2R78 A;  4LRZ E;  4RR6 A;  4UEY A;  1SCW A;  3OCL A;  1IFQ A;  4HQA A;  2QPN A;  5JYO A;  1W7F A;  1K6S A;  4WL9 A;  5I5L A;  5FI2 A;  2Y2G A;  4X1M A;  2EXA A;  3W4P A;  1KE4 A;  3L9K A;  3SH7 A;  4H6J B;  1J3W A;  3KO9 A;  3MBZ A;  3LI9 A;  4X6T A;  4DE3 A;  3SS4 A;  5TBM A;  1J9M A;  1ERM A;  5FA7 A;  4RRR A;  4E3M A;  5DF8 A;  5J4E A;  5HL1 A;  1NLY A;  2PAV P;  4EBP A;  3W4Q A;  2Q9N A;  2VV8 A;  1Y4O A;  3N8S A;  4CJN A;  1LT0 A;  5HAR A;  3DW0 A;  3Q82 A;  3R7W A;  2O0Y A;  2ZLY A;  1YKD A;  5L07 A;  2XK1 A;  3O3V A;  4FUW A;  1FOF A;  2EX6 A;  1V9Z A;  1SHV A;  5HAP A;  2J9O A;  4IHQ A;  4MBH A;  5IHV A;  3BFD A;  3LMT A;  2OOL A;  3NOU C;  3T4Q A;  5DF9 A;  3W2Z A;  4C75 A;  4HI4 A;  3AGE A;  1Q2Q A;  3CIT A;  3F1N B;  1MKM A;  1XJ4 A;  4N1X A;  3NJA A;  4XUX A;  1XKZ A;  3S7O A;  1OME A;  5A92 A;  1TF1 A;  3BLS A;  4YNR A;  2EXB A;  1S4R A;  3S1Y A;  5J8X A;  3LGO A;  1IKG A;  1MWT A;  2VJW A;  2AVX A;  3UPN A;  2NUT C;  1XA1 A;  4G3V A;  1LSW A;  1XJ2 A;  2DNS A;  3BYD A;  4OH0 A;  4C6Y A;  2V9A A;  3GV9 A;  4HBU A;  1SDN A;  5AQA A;  5AQB A;  2QMI A;  3C2W A;  2ZMV A;  5G18 A;  4WEK A;  4PM6 A;  2OLV A;  2JBF A;  1TVF A;  2PD7 A;  4GKU A;  1PWD A;  1DRM A;  4QB8 A;  3CPT B;  4S2I A;  3MS6 A;  4NK3 A;  1LL9 A;  4CLC A;  1M6K A;  2I9V A;  4RR8 A;  5HAI A;  3N8R A;  1S1Y A;  4HBT A;  1SDE A;  1SKF A;  4BBT A;  3B42 A;  1F2K A;  3BJN A;  1G28 A;  2VZW A;  5FQI A;  4QD4 A;  3TE8 A;  1L0G A;  5A91 A;  1TS7 A;  3UME A;  1I2W A;  2L0W A;  1YMX A;  2K2N A;  4R6L A;  2ZQ9 A;  3MSH A;  2V2F F;  3T50 A;  1RGZ A;  4ARZ A;  4QWO A;  2H5S A;  4ZBE A;  3ZYT A;  3S7Q A;  5F69 A;  3ULF A;  1L0D A;  4GJ4 A;  1GHI A;  1G68 A;  1XA7 A;  2Y2Q A;  5DVA A;  1K54 C;  4Y17 A;  1HVB A;  4II7 A;  1T18 A;  4OON A;  5FSR A;  4S2N A;  1GSV A;  4N1H A;  2WGW B;  1ZC2 A;  3HUM A;  3H7W B;  3TRC A;  2CC1 A;  2W3F A;  3UB6 A;  4UA9 A;  4S03 A;  4OOL A;  2JKR I;  3M6H A;  5DFY A;  3V3S A;  4RRM A;  4R23 A;  4S2O A;  4I3J A;  3SW1 A;  2VGK A;  4HEF A;  5DJT A;  1IYQ A;  4E04 A;  4OPZ A;  4WEJ A;  1BLC A;  1KE3 A;  3AGF A;  2H10 A;  4NET A;  3LR5 A;  4KZ6 A;  3JVU A;  2ZL1 B;  2J9P A;  1YLZ A;  3GEC A;  5CHU A;  2VV7 A;  1KVM A;  4LLO B;  4HNB A;  5EVI A;  3MF0 A;  4EW7 A;  4JGQ A;  3HCY A;  3P98 A;  4BMW A;  3OC2 A;  1OTB A;  2W27 A;  3SOI A;  4E3L A;  4EET B;  1PI5 A;  1G6A A;  3V50 A;  1EWZ A;  4R70 A;  2H0Y A;  4PMA A;  2JC7 A;  5A93 A;  2HDR A;  5KSH A;  5FQM A;  2GX5 A;  4LFU A;  4GS9 B;  2VK3 A;  3V5M A;  5F1G A;  3OCN A;  2ZQC A;  5TFQ A;  1TEM A;  5GLA A;  1FCM A;  5TJJ A;  4F3L B;  1UWP X;  2P9V B;  3D4F A;  5TR7 A;  3IX4 A;  4B9O A;  4O01 A;  5M1A A;  1N9O A;  5K5B A;  5GLD A;  5CED A;  1PNE A;  3JVV A;  4OPR A;  2KDK A;  4G3K A;  4N92 A;  3A0R A;  3EOI A;  4O7D A;  1XXM A;  3LIC A;  1S6R A;  4LCM A;  4X25 A;  4EBL A;  1NRF A;  4JBF A;  3N6I A;  1DJC A;  4WZ5 A;  5F83 A;  1BUE A;  5L09 A;  4RYE A;  5E2H A;  1PWG A;  4AFI A;  1I5Q A;  2GZA A;  2HKZ A;  3NBL A;  2KX6 A;  1FR6 A;  2VGL S;  3FV7 A;  4YFM A;  4JXV A;  4GCZ A;  5EE8 A;  4DXB A;  1V9Y A;  2H28 A;  4IVK A;  3UY6 A;  1MPL A;  1E3U D;  4R1G A;  5HL6 A;  4BBV A;  3EEA A;  5CGS A;  4LPZ A;  1KDS A;  2B18 A;  5FAS A;  2Y91 A;  3UB8 A;  3UE3 A;  2V0U A;  3C30 A;  4KG2 A;  2WGI A;  1IEM A;  3IS2 B;  4R3J A;  1ODV A;  2HGV A;  2G7U A;  2GNX A;  2XH9 A;  4NG2 A;  4BJP A;  3F1P B;  3MZF A;  3A0S A;  3IXH A;  4IUH A;  2XQZ A;  1F5M A;  4EXO A;  3LR3 A;  3BRM A;  4BL3 A;  1YLT A;  2XSS A;  4DMZ A;  4HHD A;  1PW8 A;  3VFF A;  3TOI A;  1YLW A;  2Y2O A;  4Y13 A;  1AXB A;  1PW1 A;  3S22 A;  3PD5 A;  4FH4 A;  2O9A A;  4CPK A;  1Z09 A;  4JGO A;  3HLC A;  2Z6D A;  2PYP A;  4NXG A;  2ZOI A;  4MBK A;  2XD1 A;  4JXW A;  4KZA A;  3GSG A;  3LID A;  2FFF B;  1BZA A;  3HRE A;  3BW6 A;  3C4P A;  2G2W A;  4ZRR A;  3BQ8 A;  3KYZ A;  3P01 A;  4MDZ A;  3IF6 B;  3NUL A;  2UWX A;  1CI8 A;  2ZM0 A;  4A5R A;  3K3C A;  4IVI A;  4ZAM A;  5E2E A;  3IWQ A;  4GHI B;  3VFH A;  5F6A A;  2B5R A;  1K56 D;  4B93 A;  2O99 A;  1WYB A;  3LIB A;  4HP4 A;  3O88 A;  5F68 A;  3TG9 A;  3WRT A;  3ZHH A;  3BFG A;  4R3A A;  3IQA A;  1PZP A;  1ESI A;  3HLD A;  4HJ6 A;  3B3X A;  4GW9 A;  2KLI A;  2QJ7 A;  4S0I A;  1TS8 A;  4I39 A;  2ACG A;  1TC5 A;  4DKI A;  1F9I A;  3ZG0 A;  5HW3 A;  5TGF A;  3NIA A;  3D3O A;  4L9G A;  3T4T A;  4BL2 A;  2DCF A;  1S66 L;  5G4Y A;  3LIE A;  2NUP C;  1LSV A;  2EFU A;  1ZG4 A;  3N4I A;  4F94 A;  3NCK A;  3ZGA B;  4S2J A;  1GHP A;  2BG1 A;  3T1X A;  1FIK A;  4IUK A;  4BWI A;  2MJ6 A;  1BTL A;  1GSW A;  3S4X A;  4BQM A;  5GHY A;  1HD8 A;  4I5S A;  1S4S A;  3CLO A;  4NXE A;  2G2U A;  1VET B;  5CXW A;  3H82 B;  4E3O A;  2B02 A;  2VGL M;  3FWL A;  3K2N A;  1XFN A;  5D3O A;  3P09 A;  1FSY A;  3PAE A;  2ZQA A;  4U3T A;  5HD5 A;  4GB7 A;  4RRK A;  2L1M A;  4WBG A;  4R0Q A;  4RRG A;  4N9K A;  2WKQ A;  4DDS A;  1K38 A;  3CG5 A;  3ZQ5 A;  4KEN B;  2A3U A;  1BLH A;  1OTE A;  4WF0 A;  5FAQ A;  3QP6 A;  4R3B A;  2WKR A;  3MXS A;  5F5Y A;  1G5U A;  3KOB A;  2ZD8 A;  5EFW A;  2WKP A;  4PM7 A;  5HWT A;  1ALQ A;  3LUQ A;  4OP5 A;  3UE0 A;  2Y2H A;  4Y2F A;  1K57 A;  1GA9 A;  4NEE D;  1NYM A;  1WE4 A;  3FPW A;  3OPR A;  2XGN A;  4OQ0 A;  1K0K A;  2EX8 A;  3EWK A;  3BY9 A;  3Q07 A;  2OSU A;  2M7V A;  5EVL A;  1SKO B;  2Y2I A;  2OV5 A;  5FL3 A;  1KVL A;  2V1A A;  2Z2M B;  3NDG A;  3R4K A;  3BEC A;  4X56 A;  2XEP A;  2ZMF A;  1KGF A;  4OLD A;  3FC7 A;  1VM1 A;  4ZJ3 A;  4B4Z A;  1XFQ A;  3IBR A;  2V20 A;  1LSX A;  4NXF A;  1XJ3 A;  5GLB A;  3NC8 A;  5J61 A;  4WM9 A;  3BFE A;  4GOG A;  5CRF A;  3FG8 A;  3LR4 A;  4GD6 A;  5LBR A;  3KSF A;  5KIZ A;  4LCL A;  2A24 B;  5CER A;  3CI6 A;  3PBS A;  4Y0U A;  4EUZ A;  3GMW A;  1YQS A;  1W63 Q;  1JNU A;  5HPI A;  1OTI A;  3LIF A;  5HD3 A;  2HJ9 C;  2QYB A;  1MKI A;  2XFT A;  3IT9 A;  1O07 A;  1FQG A;  3KSG A;  4MCW A;  3KO5 A;  4DN0 A;  3KO6 A;  1YT4 A;  4P6B A;  5JYP A;  2VLG A;  2PRF A;  4E3K A;  3CAX A;  1FR1 A;  3VOZ A;  1LI9 A;  2ZJ9 A;  4NBI A;  3S7N A;  4PKY A;  1W8Y A;  4FOF A;  1D06 A;  3N8L A;  1T1B A;  2WGV A;  3T1S A;  3UE6 A;  1IYO A;  1NZO A;  4Y5F A;  3EQU A;  2ZQ7 A;  3IXB A;  4OOY A;  3SS5 A;  3E98 A;  4B4X A;  5E2G A;  2PU2 A;  3DWK A;  3GQZ A;  3MZE A;  4RRI A;  2E8J A;  3ZDJ A;  2L4R A;  5DTS A;  2PD8 A;  3WS4 A;  2HDQ A;  1GCE A;  4NBJ A;  5EUA A;  4JF5 A;  2W1T B;  3RH8 B;  4KG5 A;  4IBR A;  2VGJ A;  3UPP A;  1OTA A;  2XA7 S;  3VP3 A;  3PBO A;  4CLC C;  5I94 A;  1S1Z A;  2J3T C;  1H0M A;  3NOP C;  2E8I A;  2V8C A;  5MC7 A;  1DY6 A;  2R9X A;  2V0W A;  4OP8 A;  4S0L A;  1VEU B;  1BYW A;  5FEG A;  4L9E A;  3L7H A;  3PBN A;  1L3L A;  4X69 A;  3HUO A;  4HH3 A;  1L2S A;  2D02 A;  4I3A A;  4PM9 A;  4OQH A;  4EEU A;  2JHE A;  4HES A;  3VP1 A;  4RRJ A;  2J3W A;  4HIA A;  3VMA A;  1PYY A;  1YLJ A;  3KNP A;  3Q7V A;  4EEP A;  3DBA A;  3O86 A;  4YOF A;  3JYI A;  4S2N C;  2ZQD A;  3IF6 A;  4EQ1 A;  2JKG A;  3C7U A;  3LMV A;  3IHA A;  4KZ8 A;  3VSL A;  1E4D A;  5FI7 A;  2HP9 A;  1BUL A;  4FH2 A;  4QHC A;  1K4E A;  4XT2 A;  3A3F A;  3UDF A;  1BSG A;  5KZH A;  2J7V A;  4K0X A;  5FEF A;  3LY4 A;  3G4P A;  3GTC A;  2ZM2 A;  3OBF A;  3HLG A;  1K56 A;  3M2K A;  5EVI C;  4Q0J A;  1XX2 A;  1T1A A;  2QHK A;  3MQQ A;  1G6O A;  2XLN A;  3QP2 A;  4MN7 A;  2JE5 A;  3A3J A;  3SH9 A;  5J3W A;  3TW8 A;  3NHQ A;  3FZC A;  5TBM B;  3UN7 A;  1ES3 A;  4UQI S;  4PAU A;  4EBN A;  3VE3 A;  3IX3 A;  4KZ4 A;  5DTK A;  4IJG A;  4JXG A;  4M4X A;  1PIO A;  4QJG A;  5FQJ A;  4E6X A;  3E4P A;  2IWD A;  2PHY A;  2PR5 A;  5HAQ A;  3MQO A;  4QPR A;  3R7W B;  4HP9 A;  4P85 A;  3EEH A;  4Z9Q A;  2HV1 A;  4K91 A;  3TJZ C;  4S2L A;  3F1O A;  4WZ5 C;  4ETX A;  1IKI A;  1KGE A;  1ONH A;  4RQ9 A;  3T4L A;  3KSI A;  4MLL A;  1P9R A;  4R4R A;  2KOI A;  3RFB A;  1N9B A;  5J7E A;  5EEC A;  2H0T A;  3T4J A;  4KQO A;  1P0Z A;  1OJ5 A;  3IBJ A;  1K55 A;  4LRY C;  4MMN A;  1YMS A;  5L8M A;  2P74 A;  4KZ7 A;  3HJI A;  4LEN A;  2XA7 M;  2BAS A;  2BLS A;  2J3T D;  2QZ6 A;  4G3W A;  2XF3 A;  3JPU A;  3SS3 A;  1FIL A;  3BFF A;  2PYR A;  4LV1 A;  2ZC5 B;  4K08 A;  4KUK A;  1CEF A;  4JKT A;  4CLC B;  4MEZ A;  4P6Z S;  1IOU A;  4U0X A;  1SKO A;  2YKF A;  2W3D A;  1H8Z A;  3LEQ A;  3K3D A;  3W8K A;  2ZBB A;  1VQQ A;  3ZNY A;  4ZDX A;  2FH5 A;  5KMW A;  2PDR A;  3ITB A;  2JCH A;  1OJG A;  4PHT A;  1KDW A;  4UAA A;  1ES2 A;  3BY8 A;  1WYC A;  4ARZ B;  4PM5 A;  3T1Q B;  1JVJ A;  3MKF A;  1N4O A;  1KOU A;  4ID4 A;  2C5W B;  2W3H A;  4H6J A;  3OZH A;  3KSH A;  1BT5 A;  2EWV A;  4I3I A;  5M18 A;  3IF5 A;  3CHW P;  1JWP A;  3UB7 A;  2VV6 A;  1X0O A;  4RX3 A;  2W1R A;  2HL1 A;  3OOV A;  4HOI A;  3BFC A;  1YLY A;  1NYY A;  3PXP A;  4OLG A;  4DRT A;  4YIN A;  3VP4 A;  1NRJ A;  4DE0 A;  1CQA A;  3C5A A;  5EVI D;  4DXC A;  4EES A;  2R9W A;  4B88 A;  3LMU A;  2WAF A;  4ZJ2 A;  5FAO A;  5GHX A;  4DJ3 A;  4JGP A;  3ITA A;  4MN6 A;  3TSG A;  3F1N A;  4ME4 A;  3C7V A;  5EVI B;  5E2F A;  3QNC A;  1QMF A;  2EA9 A;  4RRA A;  4GZB A;  2Z2L B;  4OVD A;  3QP8 A;  3DTI A;  4UQI M;  4IBX A;  2EFX A;  2OWH A;  4WMC D;  3CZD A;  5FQ9 A;  2XD5 A;  5E43 A;  3G32 A;  4P87 A;  4HH2 A;  1YPR A;  1H5X A;  5GL9 A;  2DBO A;  3V3R A;  2JKT M;  3ZG7 B;  2LB9 A;  3CUE A;  2Y55 A;  3BM6 A;  4GDB A;  4X55 A;  1JWV A;  1O7E A;  1MWS A;  2I72 A;  5CEC A;  4D2O A;  3CMZ A;  5L2F A;  3DTE A;  3SH8 A;  3CPT A;  4WLA A;  3WWX A;  1EI5 A;  2M1C A;  2XRN A;  2XR0 A;  1FCO A; 
#chains in the Genus database with same CATH homology
 4OPZ A;  4WEJ A;  1BLC A;  1KE3 A;  3AGF A;  1TDG A;  3QNB A;  1HTZ A;  3UE1 A;  2H10 A;  3N8L A;  4NET A;  4KZ6 A;  4P0M A;  2J9P A;  2WGV A;  3N7W A;  4X53 A;  5FQQ A;  1LLB A;  1IYO A;  3G2Y A;  4JXS A;  3IWI A;  1CK3 A;  1YLZ A;  1NZO A;  3EQU A;  2WKE A;  2ZQ7 A;  5CHU A;  3IXB A;  1KVM A;  4OOY A;  1PI4 A;  4LV0 A;  3ZNT A;  2WKI A;  3SS5 A;  4QU3 A;  3W4O A;  5EVI A;  3V39 A;  4B4X A;  5E2G A;  2PU2 A;  1JTD A;  2Y2L A;  3VOY A;  4BD0 A;  2OKV A;  3ZCZ A;  3P98 A;  5CGX A;  2ZC7 A;  3OC2 A;  4E3L A;  3SOI A;  3DWK A;  1PI5 A;  1G6A A;  3UPO A;  4RX2 A;  3V50 A;  1EWZ A;  4E3J A;  3GQZ A;  3MZE A;  2H0Y A;  4PMA A;  3VSK A;  2JC7 A;  3KNF A;  4RRI A;  5A93 A;  3IXG A;  3ZDJ A;  1IEL A;  2HDR A;  1S0W A;  3A3E A;  3HBR A;  5DTS A;  5FQM A;  5FQK A;  4EV4 A;  4EWF A;  5KSH A;  4RRQ A;  3V5M A;  5F1G A;  3OCN A;  3Q7V B;  2ZQC A;  3WS4 A;  3G31 A;  1C3B A;  5TFQ A;  2RCX A;  1L0E A;  4JLF A;  3KO7 A;  1K57 C;  2HDQ A;  1GCE A;  4N9L A;  2XFS A;  4NBJ A;  1TEM A;  3OPP A;  4JF5 A;  1FCM A;  1HZO A;  4WZ4 A;  1L0F A;  5EUA A;  5GLA A;  4RRH A;  4KG5 A;  1Q2P A;  2P9V B;  2WGW A;  1XPB A;  3D4F A;  3G30 A;  3OPL A;  4IBR A;  1MXO A;  3DWZ A;  1XGJ A;  1E25 A;  5TR7 A;  2VGJ A;  5GHZ A;  1W8Q A;  2WK0 A;  3UPP A;  5M1A A;  2Y2N A;  3M6B A;  5DF7 A;  3VP3 A;  4RRD A;  5FAT A;  2GDN A;  1FCN A;  3PBO A;  5CHM A;  4Q8I A;  2WZX A;  5I94 A;  5GLD A;  4JF6 A;  5CED A;  4UA6 A;  5FI6 A;  4OPR A;  3NDE A;  3O87 A;  4N92 A;  4ZJ1 A;  4OKP A;  5HFO A;  2E8I A;  4OQI A;  2X01 A;  3E2L A;  1H8Y A;  2Y59 A;  3AGD A;  4O7D A;  4E6W A;  1DY6 A;  1ZG6 A;  2R9X A;  4OP8 A;  1XXM A;  1S6R A;  4S0L A;  4LCM A;  4KZ9 A;  3WRZ A;  3IH8 A;  4EBL A;  3WS0 A;  3KOC A;  3LY3 A;  1RGY A;  1NRF A;  4WEL A;  1FSW A;  4JBF A;  3N6I A;  3C4O A;  1DJC A;  4WZ5 A;  5F83 A;  1BUE A;  5CGW A;  4RYE A;  5E2H A;  1PWG A;  2RL3 A;  4S0J A;  3PBN A;  2HL2 A;  1ERO A;  1I5Q A;  2HKZ A;  3NBL A;  3HLF A;  5F1F A;  4X69 A;  5AQ7 A;  4MNR A;  3HUO A;  1FR6 A;  1CEG A;  3FV7 A;  3LO7 A;  4S2P A;  4Y0T A;  4OPQ A;  1L2S A;  3HLW A;  1K25 A;  4YFM A;  4JXV A;  5EE8 A;  4DXB A;  3IH9 A;  4R4S A;  4PM9 A;  5HX9 A;  4RR9 A;  1ZKJ A;  1Y2Q A;  3KO4 A;  1W79 A;  4OQH A;  3PBQ A;  4HES A;  4IVK A;  3UY6 A;  1MPL A;  1E3U D;  3VP1 A;  4R1G A;  3PAG A;  4GNU A;  4RRJ A;  3VMA A;  5BOH A;  1PYY A;  1YLJ A;  5CGS A;  4QY6 A;  1KDS A;  3KNP A;  3Q7V A;  4DF6 A;  5CEB A;  3GR2 A;  5KSC A;  1CI9 A;  5U47 A;  5FAS A;  2Y91 A;  3UDX A;  4BD1 A;  5EOO A;  4KQQ A;  4PPR A;  2PBY A;  3O86 A;  3A3I A;  3UE3 A;  3JYI A;  3CJM A;  4KG2 A;  2WGI A;  4S2N C;  1IEM A;  4R3J A;  2X71 A;  2P9V A;  3IXD A;  4QY5 A;  2ZQD A;  3RXX A;  2IWC A;  3IF6 A;  2X02 A;  2XH9 A;  4BJP A;  4E3N A;  1IYS A;  4WYY A;  3MZF A;  3IXH A;  3C7U A;  2XQZ A;  2ZMA A;  1DJB A;  3LMV A;  1ES5 A;  3IHA A;  3BRM A;  4PM8 A;  4U0T A;  4RRF A;  4KZ8 A;  1GA0 A;  4BL3 A;  1YLT A;  1PW8 A;  3VSL A;  1E4D A;  5FI7 A;  3VFF A;  2HP9 A;  1BUL A;  3PD3 A;  4FH2 A;  4Y0O A;  3RXW A;  3TOI A;  3G35 A;  4QHC A;  1K4E A;  4KZ5 A;  3A3F A;  3UDF A;  1BSG A;  1K6R A;  1YLW A;  5KZH A;  2J7V A;  1JWZ A;  2Y2O A;  4K0X A;  3OPH A;  4UHU A;  4RA7 A;  1M40 A;  1YM1 A;  3LY4 A;  1AXB A;  3G4P A;  3GTC A;  1IYP A;  1PW1 A;  3MXR A;  2ZM2 A;  2HDU A;  3S22 A;  3PD5 A;  1LL5 A;  3FKV A;  4MBF A;  2ZC3 B;  4FH4 A;  4OPY A;  4RRL A;  4OQG A;  3IHB A;  1FCO A;  3HLG A;  4DE1 A;  1K56 A;  3M2K A;  3ISG A;  5EVI C;  4CPK A;  3GRJ A;  4UA7 A;  1XX2 A;  4DE2 A;  2C6W B;  3HLC A;  5FAP A;  5M19 A;  4H8R A;  4FCF A;  2WZZ A;  3HLE A;  3Q7Z A;  2XLN A;  3GVB A;  1BLS A;  1MWR A;  4S0K A;  2DRW A;  3PD2 A;  2ZM8 A;  4JF4 A;  4LV3 A;  4MBK A;  2JE5 A;  3A3J A;  1DJA A;  1RCJ A;  1I2S A;  2XD1 A;  4JXW A;  3HL9 A;  4KZ3 A;  5CTN A;  3SH9 A;  4KZA A;  3GSG A;  4S2M A;  3NI9 A;  2ZC6 B;  1LHY A;  2FFF B;  1BZA A;  3ZFZ A;  3HRE A;  2HP5 A;  4X68 A;  2J8Y A;  3C4P A;  1TDL A;  2G2W A;  4S02 A;  3FZC A;  4K0W A;  3UN7 A;  2XDM A;  1ES3 A;  1PZO A;  2Y2P A;  3IF6 B;  3Q1F A;  3KO3 A;  1RP5 A;  2HP6 A;  3HLB A;  4EBN A;  2UWX A;  3MFD A;  3ZVW A;  1CI8 A;  2ZM0 A;  2ZQ8 A;  3BLM A;  4A5R A;  1Y54 A;  4IVI A;  4KZ4 A;  5DTK A;  1PWC A;  2HPB A;  4ZAM A;  5E2E A;  1E3U A;  5EPH A;  3IWQ A;  5CTM A;  3MZD A;  4JXG A;  3VFH A;  1PIO A;  4QJG A;  2B5R A;  1NJ4 A;  5DTT A;  3WS5 A;  5FQJ A;  3HUN A;  1K56 D;  4E6X A;  1WYB A;  1LI0 A;  2IWD A;  1ERQ A;  5A90 A;  2WYX A;  3O88 A;  3UDI A;  4E3I A;  2V1Z A;  3TG9 A;  3WRT A;  3RJU A;  3ZHH A;  1ES4 A;  5HAQ A;  3BFG A;  3G34 A;  1MWU A;  1NY0 A;  1JKE A;  1ESU A;  2WUQ A;  4FD8 A;  4P85 A;  4Z9Q A;  2Y2K A;  3BEB A;  2Q9M A;  4Y7P A;  3I7J A;  4K91 A;  3ZG9 B;  4S2L A;  3IQA A;  1PZP A;  3VP2 A;  4BEN A;  1ESI A;  3HLD A;  1MBL A;  3LCE A;  1QME A;  4WZ5 C;  4RR6 A;  1IKI A;  1KGE A;  1ONH A;  3B3X A;  3KOD A;  1SCW A;  3OCL A;  4KG6 A;  4S0I A;  2QPN A;  2Y4A A;  4MLL A;  5JYO A;  4S2K A;  3M2J A;  4R4R A;  1W7F A;  1K6S A;  3LEZ A;  2IWB A;  1N9B A;  5FI2 A;  2Y2G A;  1ONG A;  5EEC A;  2EXA A;  2WKH A;  1KE4 A;  2A49 A;  2H0T A;  3W4P A;  4KQO A;  3SH7 A;  3G2Z A;  1TC5 A;  4DKI A;  3ZG0 A;  5HW3 A;  1K55 A;  3KO9 A;  1MY8 A;  3MBZ A;  5TGF A;  4X6T A;  3NIA A;  1YMS A;  5FDH A;  2P74 A;  4KZ7 A;  4BL2 A;  2DCF A;  4LEN A;  4DE3 A;  3SS4 A;  1J9M A;  1K54 A;  1J7G A;  4OOM A;  1ERM A;  5FA7 A;  4RRR A;  2BLS A;  2QZ6 A;  2XF3 A;  2EFU A;  5DF8 A;  4E3M A;  3SS3 A;  5HL1 A;  1ZG4 A;  3N4I A;  4F94 A;  3BFF A;  4EBP A;  3NCK A;  3QHY A;  4RVA A;  3W4Q A;  3ZGA B;  2Q9N A;  4LV1 A;  3IF6 C;  2ZC5 B;  4S2J A;  3IWO A;  1GHP A;  2BG1 A;  5CHJ A;  3PBR A;  1CEF A;  3N8S A;  4CJN A;  4JKT A;  5HAR A;  2PU4 A;  4MEZ A;  4DDY A;  4BQM A;  1BTL A;  3A3D A;  4KQR A;  3S4X A;  5GHY A;  1HD8 A;  3DW0 A;  3Q82 A;  2ZLY A;  4U0X A;  2G2U A;  2OLU A;  5CXW A;  2XK1 A;  2EX9 A;  3O3V A;  3UNW A;  4E3O A;  1FOF A;  2EX6 A;  4IED A;  4GN2 A;  3FWL A;  1SHV A;  5D3O A;  1XP4 A;  3P09 A;  1FSY A;  1H8Z A;  3PAE A;  5HAP A;  2J9O A;  2ZQA A;  3ZVT A;  4MBH A;  5IHV A;  3BFD A;  3LMT A;  3EQV A;  4U3T A;  3W8K A;  5DF9 A;  4GB7 A;  4RRK A;  4C75 A;  4WBG A;  1KE0 A;  3Q81 A;  4R0Q A;  1VQQ A;  3ZNY A;  4RRG A;  3AGE A;  4ZDX A;  4N9K A;  5KMW A;  1Q2Q A;  3ITB A;  4DDS A;  2JCH A;  4N1X A;  3PBT A;  1K38 A;  4GD8 A;  3CG5 A;  3E2K A;  4XUX A;  4KEN B;  1XKZ A;  2A3U A;  3VP0 A;  1U60 A;  1OME A;  1KDW A;  4UAA A;  1BLH A;  1ES2 A;  4XUZ A;  1WYC A;  5A92 A;  4GDN A;  3PD4 A;  3BLS A;  4PM5 A;  1Z6F A;  2EXB A;  1JVJ A;  3MKF A;  1N4O A;  5EOE A;  3S1Y A;  5FAQ A;  4RR7 A;  4R3B A;  5J8X A;  4ID4 A;  2C5W B;  1W5D A;  2HDS A;  3MXS A;  4C3Q A;  2XR0 A;  1BLP A;  3OZH A;  1IKG A;  1MWT A;  3KOB A;  3UPN A;  1BT5 A;  2ZD8 A;  3NY4 A;  4PM7 A;  3WS1 A;  1ALQ A;  4FSF A;  1YLP A;  5M18 A;  1XA1 A;  4OP5 A;  2DNS A;  3BYD A;  4OH0 A;  4C6Y A;  3IF5 A;  3UE0 A;  2Y2H A;  1JWP A;  4ZTK A;  1K57 A;  1GA9 A;  3ZG8 B;  1NYM A;  1WE4 A;  3GV9 A;  4HBU A;  1SDN A;  5AQA A;  4RX3 A;  2HL1 A;  5AQB A;  2QMI A;  2WAD A;  3OPR A;  1NXY A;  2XGN A;  4OQ0 A;  5G18 A;  1K4F A;  2EX8 A;  4WEK A;  4PM6 A;  3Q07 A;  3BFC A;  3FYZ A;  2OSU A;  1YLY A;  1NYY A;  2OLV A;  2JBF A;  4WMC A;  5EVL A;  1TVF A;  4OLG A;  4GKU A;  1PWD A;  4DRT A;  4QB8 A;  4YIN A;  2Y2I A;  2OV5 A;  4S2I A;  3VP4 A;  4NK3 A;  1LL9 A;  3DTM A;  2WAE A;  2ZC4 B;  4DE0 A;  4JPM A;  1KVL A;  1M6K A;  4RR8 A;  2Z2M B;  3C5A A;  3NDG A;  3BEC A;  4X56 A;  2XEP A;  5EVI D;  4DXC A;  5HAI A;  4LV2 A;  1KGF A;  4OLD A;  3N8R A;  2R9W A;  1VM1 A;  4ZJ3 A;  4B88 A;  4B4Z A;  3LMU A;  2WAF A;  1JTG A;  4HBT A;  1SDE A;  1SKF A;  4ZJ2 A;  3ZG5 A;  2V20 A;  4RRC A;  2FFY A;  5FAO A;  5GHX A;  5FQI A;  3ITA A;  4QD4 A;  2Y2M A;  3TSG A;  1L0G A;  5A91 A;  5EVI B;  3C7V A;  3UO9 A;  1I2W A;  5E2F A;  1YMX A;  5GLB A;  3NC8 A;  1NZU A;  5J61 A;  3QNC A;  4WM9 A;  1QMF A;  2ZQ9 A;  4RRA A;  4GZB A;  2V2F F;  2Z2L B;  3BFE A;  3PTE A;  4OVD A;  2HL0 A;  1RGZ A;  4GOG A;  5CRF A;  4BLM A;  4M3K A;  5GLC A;  4IBX A;  4GD6 A;  4ZBE A;  2EFX A;  2H5S A;  4EQI A;  4LCL A;  3CZD A;  4WMC D;  5FQ9 A;  2EX2 A;  1L0D A;  1GHI A;  1XGI A;  3FKW A;  1K55 C;  2XD5 A;  5E43 A;  5CER A;  3PBS A;  3G32 A;  4P87 A;  1G68 A;  4Y0U A;  4EUZ A;  3GMW A;  1YQS A;  1XA7 A;  1H5X A;  2Y2Q A;  5GL9 A;  1GHM A;  5DVA A;  1K54 C;  2DBO A;  3V3R A;  4L0L A;  5AQ9 A;  1HVB A;  4OON A;  4RRB A;  5FSR A;  4S2N A;  3ZG7 B;  4KZB A;  1MKI A;  2XFT A;  3IT9 A;  3HVF A;  2Y2J A;  2Y55 A;  3BM6 A;  1KGG A;  4N1H A;  4XXR A;  2WGW B;  1ZC2 A;  3HUM A;  4GDB A;  4X55 A;  3WS2 A;  1O07 A;  1JWV A;  1O7E A;  1MWS A;  2I72 A;  2CC1 A;  1FQG A;  3MKE A;  5CEC A;  3KO5 A;  4UA9 A;  4S03 A;  4D2O A;  3CMZ A;  4OOL A;  5F82 A;  1YT4 A;  5L2F A;  4RRM A;  3M6H A;  4P6B A;  3V3S A;  4R23 A;  3SH8 A;  5JYP A;  4E3K A;  4S2O A;  1FR1 A;  3VOZ A;  1LI9 A;  3WWX A;  2ZJ9 A;  1EI5 A;  2VGK A;  4HEF A;  4NBI A;  1IYQ A;  1W8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...